HHsearch alignment for GI: 254780466 and conserved domain: pfam05958

>pfam05958 tRNA_U5-meth_tr tRNA (Uracil-5-)-methyltransferase. This family consists of (Uracil-5-)-methyltransferases EC:2.1.1.35 from bacteria, archaea and eukaryotes. A 5-methyluridine (m(5)U) residue at position 54 is a conserved feature of bacterial and eukaryotic tRNAs. The methylation of U54 is catalysed by the tRNA(m5U54)methyltransferase, which in Saccharomyces cerevisiae is encoded by the nonessential TRM2 gene. It is thought that tRNA modification enzymes might have a role in tRNA maturation not necessarily linked to their known catalytic activity.
Probab=97.58  E-value=0.00036  Score=45.48  Aligned_cols=61  Identities=13%  Similarity=0.166  Sum_probs=47.6

Q ss_pred             CCCCCCHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHH
Q ss_conf             68778189999999852899888998688851799999980981699972899999999999
Q gi|254780466|r  204 HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRI  265 (375)
Q Consensus       204 HPTqKP~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl  265 (375)
T Consensus       179 N~~~-~~~l~~~a~~~~~~~~~~vlDlYcG~Gtfsl~lA~~~~~V~GvE~~~~AV~~A~~Na  239 (353)
T pfam05958       179 NAAV-NIKMLEWACEVTQGSKGDLLELYCGNGNFSLALAQNFRRVLATEIAKPSVNAAQYNI  239 (353)
T ss_pred             CHHH-HHHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHCCEEEEEECCHHHHHHHHHHH
T ss_conf             9899-999999999986268995899846888888999864787999962599999999989