HHsearch alignment for GI: 254780466 and conserved domain: pfam08123

>pfam08123 DOT1 Histone methylation protein DOT1. The DOT1 domain regulates gene expression by methylating histone H3. H3 methylation by DOT1 has been shown to be required for the DNA damage checkpoint in yeast.
Probab=93.74  E-value=0.35  Score=27.36  Aligned_cols=59  Identities=20%  Similarity=0.263  Sum_probs=45.5

Q ss_pred             HHHHHHHHHC-CCCCCEEEECCCCCHHHH-HHHHHHC-CEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             9999999852-899888998688851799-9999809-816999728999999999996305
Q gi|254780466|r  211 ALLSRILVSS-TKPGDIILDPFFGSGTSG-AVAKKLR-RSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       211 ~LleriI~~~-S~~gDiVLDPF~GSGTT~-~aA~~lg-R~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
T Consensus        29 ~fis~ii~~~~l~~~dvF~DLGSGVGnvv~QaAl~tgc~~s~GiEi~~~~a~~A~~~~~~~~   90 (205)
T pfam08123        29 EFLSDVLDKCNLGPQDVFVDLGSGVGNCVLQAALEFGCKLSFGCEIMDNASNLAELQDEEFK   90 (205)
T ss_pred             HHHHHHHHHHCCCCCCEEEECCCCCCHHHHHHHHHHCCCEEEEEEECCCHHHHHHHHHHHHH
T ss_conf             99999999839897688998588832999999987096538888865668999999999999