HHsearch results for GI: 254780466 and protein with PDBid: 1fbn_A

>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A
Probab=95.76  E-value=0.018  Score=33.79  Aligned_cols=49  Identities=16%  Similarity=0.057  Sum_probs=40.3

Q ss_pred             CCCCCCEEEECCCCCHHHHHHHHHHCC--EEEEEEECHHHHHHHHHHHHHC
Q ss_conf             289988899868885179999998098--1699972899999999999630
Q gi|254780466|r  220 STKPGDIILDPFFGSGTSGAVAKKLRR--SFIGIEMKQDYIDIATKRIASV  268 (375)
Q Consensus       220 ~S~~gDiVLDPF~GSGTT~~aA~~lgR--~~IGiE~~~~Y~~~a~~Rl~~~  268 (375)
                      .-+||+.|||-=||||||+........  +.+|+|+++..++.+.+|.+..
T Consensus        71 ~ikpg~~VLDlGcGtG~~~~~la~~~~~G~V~aVDiSp~mi~~a~~~a~~~  121 (230)
T 1fbn_A           71 PIKRDSKILYLGASAGTTPSHVADIADKGIVYAIEYAPRIMRELLDACAER  121 (230)
T ss_dssp             CCCTTCEEEEESCCSSHHHHHHHHHTTTSEEEEEESCHHHHHHHHHHTTTC
T ss_pred             CCCCCCEEEEECCCCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHC
T ss_conf             879999999967977989999997589965999979989999999877644