HHsearch results for GI: 254780466 and protein with PDBid: 1nkv_A

>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21
Probab=97.69  E-value=0.00037  Score=44.10  Aligned_cols=66  Identities=27%  Similarity=0.286  Sum_probs=52.0

Q ss_pred             CCCCCC--HHHHHHHHHHC-CCCCCEEEECCCCCHHHH-HHHHHHCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             687781--89999999852-899888998688851799-9999809816999728999999999996305
Q gi|254780466|r  204 HPTQKP--EALLSRILVSS-TKPGDIILDPFFGSGTSG-AVAKKLRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       204 HPTqKP--~~LleriI~~~-S~~gDiVLDPF~GSGTT~-~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      |.++.|  .+.+..++... -.||+-|||--||+|..+ .+|...|-+.+|+|+++..++.|++|++..-
T Consensus        14 ~~~~~P~~~~~~~~l~~~l~l~pg~rVLDiGcG~G~~~~~la~~~~~~v~gvD~s~~~l~~a~~~~~~~g   83 (256)
T 1nkv_A           14 HRIHNPFTEEKYATLGRVLRMKPGTRILDLGSGSGEMLCTWARDHGITGTGIDMSSLFTAQAKRRAEELG   83 (256)
T ss_dssp             CSSSSSCCHHHHHHHHHHTCCCTTCEEEEETCTTCHHHHHHHHHTCCEEEEEESCHHHHHHHHHHHHHTT
T ss_pred             CCCCCCCCHHHHHHHHHHCCCCCCCEEEEECCCCCHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHC
T ss_conf             4234888899999999970899999999985888889999998649989999898367789988677606