HHsearch results for GI: 254780466 and protein with PDBid: 1nv8_A

>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A*
Probab=96.08  E-value=0.0046  Score=37.45  Aligned_cols=67  Identities=21%  Similarity=0.153  Sum_probs=51.6

Q ss_pred             CCCCCCHHHHHHHHHHCC-CCCCEEEECCCCCHHHHHH-HHHHCCEEEEEEECHHHHHHHHHHHHHCCC
Q ss_conf             687781899999998528-9988899868885179999-998098169997289999999999963056
Q gi|254780466|r  204 HPTQKPEALLSRILVSST-KPGDIILDPFFGSGTSGAV-AKKLRRSFIGIEMKQDYIDIATKRIASVQP  270 (375)
Q Consensus       204 HPTqKP~~LleriI~~~S-~~gDiVLDPF~GSGTT~~a-A~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~~  270 (375)
                      =|-+=-+.|.+.++.... ++...|+|..+|||..+++ |+.-+.+.+|+|++++.+++|++-.++...
T Consensus       103 IPRpeTE~Lve~~~~~~~~~~~~~vlDlgtGSG~I~isla~~p~~~V~avDiS~~Al~vA~~Na~~~~~  171 (284)
T 1nv8_A          103 VPRPETEELVELALELIRKYGIKTVADIGTGSGAIGVSVAKFSDAIVFATDVSSKAVEIARKNAERHGV  171 (284)
T ss_dssp             CCCTTHHHHHHHHHHHHHHHTCCEEEEESCTTSHHHHHHHHHSSCEEEEEESCHHHHHHHHHHHHHTTC
T ss_pred             CCCCHHHHHHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHCCCEEEECCCHHHHHHHHHHHHHCCC
T ss_conf             288758999998887650378867998604605988767652014516763979999999999984489