HHsearch results for GI: 254780466 and protein with PDBid: 1ws6_A

>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus HB8} SCOP: c.66.1.46
Probab=98.08  E-value=8.7e-06  Score=53.99  Aligned_cols=54  Identities=20%  Similarity=0.246  Sum_probs=47.2

Q ss_pred             HHHHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             998528998889986888517999999809816999728999999999996305
Q gi|254780466|r  216 ILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       216 iI~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      ++...-.+|..|||+|||||+.+++|...|-+.+++|+|++.++.+++-++...
T Consensus        34 ~l~~~~~~~~~vLDl~~G~G~~~i~a~~~ga~vv~vD~~~~ai~~~~~N~~~~g   87 (171)
T 1ws6_A           34 YLRLRYPRRGRFLDPFAGSGAVGLEAASEGWEAVLVEKDPEAVRLLKENVRRTG   87 (171)
T ss_dssp             HHHHHCTTCCEEEEETCSSCHHHHHHHHTTCEEEEECCCHHHHHHHHHHHHHHT
T ss_pred             HHHCCCCCCCEEEECCCCHHHHHHHHHHCCCCCCCEECCHHHHHHHHHHHHHCC
T ss_conf             973645797989996206789999999808953006068789999998788606