HHsearch results for GI: 254780466 and protein with PDBid: 1wy7_A

>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structural genomics; HET: SAH; 2.20A {Pyrococcus horikoshii OT3} SCOP: c.66.1.32
Probab=98.18  E-value=4.5e-06  Score=55.73  Aligned_cols=63  Identities=19%  Similarity=0.298  Sum_probs=50.4

Q ss_pred             CCCHHHHHHHHHHC----CCCCCEEEECCCCCHHHHHHHHHHC-CEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             78189999999852----8998889986888517999999809-816999728999999999996305
Q gi|254780466|r  207 QKPEALLSRILVSS----TKPGDIILDPFFGSGTSGAVAKKLR-RSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       207 qKP~~LleriI~~~----S~~gDiVLDPF~GSGTT~~aA~~lg-R~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      +-|..+..+++...    .-+|..|||+|||||..+++|...| .+.+|+|+++..++.|++.++...
T Consensus        29 ~Tp~~ia~~~~~~a~~~~dl~g~~vlDlg~G~G~l~i~a~~~g~~~v~~vDid~~~~~~a~~N~~~~~   96 (207)
T 1wy7_A           29 RTPGNAASELLWLAYSLGDIEGKVVADLGAGTGVLSYGALLLGAKEVICVEVDKEAVDVLIENLGEFK   96 (207)
T ss_dssp             CCCHHHHHHHHHHHHHTTSSTTCEEEEETCTTCHHHHHHHHTTCSEEEEEESCHHHHHHHHHHTGGGT
T ss_pred             CCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCCHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHCC
T ss_conf             99999999999999864987989899913425699999997499869998798999999999999839