HHsearch results for GI: 254780466 and protein with PDBid: 1xva_A

>1xva_A Glycine N-methyltransferase; HET: SAM; 2.20A {Escherichia coli} SCOP: c.66.1.5 PDB: 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A*
Probab=96.11  E-value=0.018  Score=33.83  Aligned_cols=48  Identities=15%  Similarity=0.140  Sum_probs=42.4

Q ss_pred             CCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             998889986888517999999809816999728999999999996305
Q gi|254780466|r  222 KPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       222 ~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      ..+.-|||.-||+|..+....+.|.+-+|+|++++.++.|+++.....
T Consensus        55 ~~~~~vLDiGcG~G~~~~~la~~g~~v~gvD~s~~ml~~a~~~~~~~~  102 (292)
T 1xva_A           55 HGCHRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRR  102 (292)
T ss_dssp             TTCCEEEESSCTTSHHHHHHHHTTCEEEEEESCHHHHHHHHHHHHHTT
T ss_pred             CCCCEEEEECCCCCHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCC
T ss_conf             184999990478849999999779969999899999999999998644