HHsearch results for GI: 254780466 and protein with PDBid: 1yb2_A

>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum dsm 1728} SCOP: c.66.1.13
Probab=95.15  E-value=0.017  Score=34.07  Aligned_cols=66  Identities=12%  Similarity=0.179  Sum_probs=46.8

Q ss_pred             CEECCCHHHHHHHCCCCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCE
Q ss_conf             08517259989728414711898477876155871333678513001344357789899999889999999986396872
Q gi|254780466|r   22 KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGT  101 (375)
Q Consensus        22 kI~~GDcl~~l~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvLK~~Gs  101 (375)
                      .++++|..+   .++++++|+||.|.|=                     .|              +.+.+++++||++|.
T Consensus       165 ~~~~~Di~e---~~~~~~fD~V~ld~p~---------------------p~--------------~~l~~~~~~LKpGG~  206 (275)
T 1yb2_A          165 RTSRSDIAD---FISDQMYDAVIADIPD---------------------PW--------------NHVQKIASMMKPGSV  206 (275)
T ss_dssp             EEECSCTTT---CCCSCCEEEEEECCSC---------------------GG--------------GSHHHHHHTEEEEEE
T ss_pred             HHEEHHHHH---CCCCCCCCCEEEECCC---------------------HH--------------HHHHHHHHHCCCCCE
T ss_conf             111011221---0244423305870568---------------------99--------------999999975688828


Q ss_pred             EEEEC-CHHHHHHHHHHHHHCCCCE
Q ss_conf             99983-4688899998764057860
Q gi|254780466|r  102 LWVIG-SYHNIFRIGTMLQNLNFWI  125 (375)
Q Consensus       102 i~v~~-~~~~i~~i~~~l~~~gf~~  125 (375)
                      +.+.. ....+.++...|.+.||+.
T Consensus       207 lv~~~P~i~Qv~k~~~~L~~~Gf~~  231 (275)
T 1yb2_A          207 ATFYLPNFDQSEKTVLSLSASGMHH  231 (275)
T ss_dssp             EEEEESSHHHHHHHHHHSGGGTEEE
T ss_pred             EEEEECCHHHHHHHHHHHHHCCCEE
T ss_conf             9999899999999999999879857