HHsearch results for GI: 254780466 and protein with PDBid: 2ar0_A

>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45
Probab=97.80  E-value=6.1e-05  Score=48.86  Aligned_cols=61  Identities=23%  Similarity=0.331  Sum_probs=46.2

Q ss_pred             CCCCCCHHHHHHHHHHC-CCCCCEEEECCCCCHHHHHHHHHH--------------------CCEEEEEEECHHHHHHHH
Q ss_conf             68778189999999852-899888998688851799999980--------------------981699972899999999
Q gi|254780466|r  204 HPTQKPEALLSRILVSS-TKPGDIILDPFFGSGTSGAVAKKL--------------------RRSFIGIEMKQDYIDIAT  262 (375)
Q Consensus       204 HPTqKP~~LleriI~~~-S~~gDiVLDPF~GSGTT~~aA~~l--------------------gR~~IGiE~~~~Y~~~a~  262 (375)
                      |-|+.  .+.+.++... ..+|+.|+||.||||+.+++|.+.                    ...++|+|+++.-+.+|.
T Consensus       151 ffTP~--~Iv~~mv~ll~p~~~~~I~DPacGsG~fL~~a~~~l~~~~~~~~~~~~~~~~~~~~~~~~G~E~~~~~~~la~  228 (541)
T 2ar0_A          151 YFTPR--PLIKTIIHLLKPQPREVVQDPAAGTAGFLIEADRYVKSQTNDLDDLDGDTQDFQIHRAFIGLELVPGTRRLAL  228 (541)
T ss_dssp             CCCCH--HHHHHHHHHHCCCTTCCEEETTCTTTHHHHHHHHHHHTTTTTTTTSCHHHHHHHHHTSEEEEESCHHHHHHHH
T ss_pred             ECCCH--HHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHCCHHHHHHHH
T ss_conf             67989--9999999862899887304657785605799999999843662111046788888766630206699999998


Q ss_pred             HHHH
Q ss_conf             9996
Q gi|254780466|r  263 KRIA  266 (375)
Q Consensus       263 ~Rl~  266 (375)
                      -.+-
T Consensus       229 ~nl~  232 (541)
T 2ar0_A          229 MNCL  232 (541)
T ss_dssp             HHHH
T ss_pred             HHHH
T ss_conf             6466