HHsearch results for GI: 254780466 and protein with PDBid: 2b25_A

>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural genomics consortium, SGC; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13
Probab=93.73  E-value=0.034  Score=32.19  Aligned_cols=69  Identities=13%  Similarity=0.061  Sum_probs=39.2

Q ss_pred             EECCCHHHHHHHCCCCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCEE
Q ss_conf             85172599897284147118984778761558713336785130013443577898999998899999999863968729
Q gi|254780466|r   23 IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTL  102 (375)
Q Consensus        23 I~~GDcl~~l~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvLK~~Gsi  102 (375)
                      +.++|..+....+++.++|.||.|-|-                     -|              +.+.+++|+|||+|.+
T Consensus       171 ~~~~di~~~~~~~~~~~~D~VfLDlp~---------------------P~--------------~~l~~~~r~LKPGG~l  215 (336)
T 2b25_A          171 FIHKDISGATEDIKSLTFDAVALDMLN---------------------PH--------------VTLPVFYPHLKHGGVC  215 (336)
T ss_dssp             EEESCTTCCC-------EEEEEECSSS---------------------TT--------------TTHHHHGGGEEEEEEE
T ss_pred             EEECCHHHCCCCCCCCCCCEEECCCCC---------------------HH--------------HHHHHHHHHCCCCCEE
T ss_conf             997766652355688753331046769---------------------89--------------9999999846679799


Q ss_pred             EEECC-HHHHHHHHHHHHHCCCCEE
Q ss_conf             99834-6888999987640578601
Q gi|254780466|r  103 WVIGS-YHNIFRIGTMLQNLNFWIL  126 (375)
Q Consensus       103 ~v~~~-~~~i~~i~~~l~~~gf~~~  126 (375)
                      .++.- ...+.++..+|+..++.+.
T Consensus       216 vvy~P~i~Qv~~~~~~L~~~~~~f~  240 (336)
T 2b25_A          216 AVYVVNITQVIELLDGIRTCELALS  240 (336)
T ss_dssp             EEEESSHHHHHHHHHHHHHHTCCEE
T ss_pred             EEECCCHHHHHHHHHHHHHCCCCCE
T ss_conf             9993989999999999997289943