HHsearch results for GI: 254780466 and protein with PDBid: 2b3t_A

>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A*
Probab=96.17  E-value=0.031  Score=32.39  Aligned_cols=90  Identities=14%  Similarity=0.193  Sum_probs=61.7

Q ss_pred             CEECCCHHHHHHHCCCCCCCEEEECCCCCCCCCCC------EECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             08517259989728414711898477876155871------333678513001344357789899999889999999986
Q gi|254780466|r   22 KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQ------LYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRV   95 (375)
Q Consensus        22 kI~~GDcl~~l~~Lpd~sVDlI~tDPPYni~~~~~------~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~Rv   95 (375)
                      ++++||.++   .++++++|+|++.|||--.-+..      .+.|...           ....++=+.+.+..+.++.++
T Consensus       162 ~~~~~D~~~---~~~~~~fDlIvsNPPYi~~~~~~~~~~~v~~EP~~A-----------L~gg~dGl~~~~~ii~~a~~~  227 (276)
T 2b3t_A          162 HILQSDWFS---ALAGQQFAMIVSNPPYIDEQDPHLQQGDVRFEPLTA-----------LVAADSGMADIVHIIEQSRNA  227 (276)
T ss_dssp             EEECCSTTG---GGTTCCEEEEEECCCCBCTTCHHHHSSGGGSSCSTT-----------TBCHHHHTHHHHHHHHHHGGG
T ss_pred             EEEECCCCC---CCCCCCEEEEEECCCCCCHHHHHCCCCCCCCCHHHH-----------HHCCCCHHHHHHHHHHHHHHH
T ss_conf             999757643---367884157885698677134540775212337888-----------617864789999999999985


Q ss_pred             CCCCCEEEEECCHHHHHHHHHHHHHCCCCE
Q ss_conf             396872999834688899998764057860
Q gi|254780466|r   96 LKPNGTLWVIGSYHNIFRIGTMLQNLNFWI  125 (375)
Q Consensus        96 LK~~Gsi~v~~~~~~i~~i~~~l~~~gf~~  125 (375)
                      |+++|.+++-.++.....+..++++.||..
T Consensus       228 L~~~G~l~lEig~~q~~~v~~~~~~~gf~~  257 (276)
T 2b3t_A          228 LVSGGFLLLEHGWQQGEAVRQAFILAGYHD  257 (276)
T ss_dssp             EEEEEEEEEECCSSCHHHHHHHHHHTTCTT
T ss_pred             CCCCCEEEEEECCHHHHHHHHHHHHCCCCE
T ss_conf             167988999989069999999999779964