HHsearch results for GI: 254780466 and protein with PDBid: 2b78_A

>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51
Probab=96.91  E-value=0.00059  Score=42.87  Aligned_cols=53  Identities=8%  Similarity=0.124  Sum_probs=43.1

Q ss_pred             HHHHHCCCCCCEEEECCCCCHHHHHHHHHHC-CEEEEEEECHHHHHHHHHHHHHC
Q ss_conf             9998528998889986888517999999809-81699972899999999999630
Q gi|254780466|r  215 RILVSSTKPGDIILDPFFGSGTSGAVAKKLR-RSFIGIEMKQDYIDIATKRIASV  268 (375)
Q Consensus       215 riI~~~S~~gDiVLDPF~GSGTT~~aA~~lg-R~~IGiE~~~~Y~~~a~~Rl~~~  268 (375)
                      +++.. -.+|.-|||.|+|+|.-+++|...| +.-+++|+++.+++.+++..+.-
T Consensus       205 ~l~~~-~~~g~rVLDlfs~tGgfsl~aa~~gA~~V~~vD~s~~a~~~a~~N~~~N  258 (385)
T 2b78_A          205 ELING-SAAGKTVLNLFSYTAAFSVAAAMGGAMATTSVDLAKRSRALSLAHFEAN  258 (385)
T ss_dssp             HHHHT-TTBTCEEEEETCTTTHHHHHHHHTTBSEEEEEESCTTHHHHHHHHHHHT
T ss_pred             HHHHH-HCCCCCEEEECCCCCHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHH
T ss_conf             99998-5599916863676878999998779958885267699999999989984