HHsearch results for GI: 254780466 and protein with PDBid: 2gb4_A

>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A*
Probab=96.13  E-value=0.023  Score=33.21  Aligned_cols=57  Identities=12%  Similarity=0.065  Sum_probs=46.8

Q ss_pred             HHHHHHHH-HCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHH
Q ss_conf             99999998-5289988899868885179999998098169997289999999999963
Q gi|254780466|r  211 ALLSRILV-SSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIAS  267 (375)
Q Consensus       211 ~LleriI~-~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~  267 (375)
                      .|.+.+-. ...++|.-||||-||+|-.++-..+.|-+-+|+|+++..++.+.++...
T Consensus        55 ~L~~~~~~~~~~~~~~rvL~pgCG~G~da~~LA~~G~~V~gvD~S~~Ai~~a~~~~~~  112 (252)
T 2gb4_A           55 LLKKHLDTFLKGQSGLRVFFPLCGKAIEMKWFADRGHTVVGVEISEIGIREFFAEQNL  112 (252)
T ss_dssp             HHHHHHHHHHTTCCSCEEEETTCTTCTHHHHHHHTTCEEEEECSCHHHHHHHHHHTTC
T ss_pred             HHHHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHCCCEEEEECCCHHHHHHHHHHCCC
T ss_conf             9999999860889999899989878088999984898489981629999999987545