HHsearch results for GI: 254780466 and protein with PDBid: 2h00_A

>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54
Probab=90.75  E-value=0.81  Score=23.79  Aligned_cols=60  Identities=12%  Similarity=-0.002  Sum_probs=43.3

Q ss_pred             HHHHHHHHHHCC---CCCCEEEECCCCCHHHH--HHHHHHCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             899999998528---99888998688851799--9999809816999728999999999996305
Q gi|254780466|r  210 EALLSRILVSST---KPGDIILDPFFGSGTSG--AVAKKLRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       210 ~~LleriI~~~S---~~gDiVLDPF~GSGTT~--~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      +.+++.++....   .+.-.|||-=+|||.-+  +++..-+-+++|+|++++.+++|++-++.-.
T Consensus        49 ~~~i~dlL~~~~~~~~~~~~~lDiGtGsg~I~~~L~~~~~~~~~~~~Di~~~al~~A~~N~~~n~  113 (254)
T 2h00_A           49 IHWVEDLIGHQDSDKSTLRRGIDIGTGASCIYPLLGATLNGWYFLATEVDDMCFNYAKKNVEQNN  113 (254)
T ss_dssp             HHHHHHHHCCCCGGGCCCCEEEEESCTTTTHHHHHHHHHHCCEEEEEESCHHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHCCCCCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHC
T ss_conf             99999997054666677754899567878999999997799759999899999999999999838