HHsearch results for GI: 254780466 and protein with PDBid: 2okc_A

>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, structural genomics; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45
Probab=97.66  E-value=9.5e-05  Score=47.68  Aligned_cols=62  Identities=16%  Similarity=0.234  Sum_probs=47.3

Q ss_pred             CCCCCCHHHHHHHHHHC-CCCCCEEEECCCCCHHHHHHHHHH---------------CCEEEEEEECHHHHHHHHHHHHH
Q ss_conf             68778189999999852-899888998688851799999980---------------98169997289999999999963
Q gi|254780466|r  204 HPTQKPEALLSRILVSS-TKPGDIILDPFFGSGTSGAVAKKL---------------RRSFIGIEMKQDYIDIATKRIAS  267 (375)
Q Consensus       204 HPTqKP~~LleriI~~~-S~~gDiVLDPF~GSGTT~~aA~~l---------------gR~~IGiE~~~~Y~~~a~~Rl~~  267 (375)
                      |-|+  ..+.+.++... .++++.|+||+||||+.+++|.+.               .-...|+|+++..+.+|+-.+.-
T Consensus       153 ffTP--~~Iv~~mv~ll~~~~~~~IlDPacGsG~fL~~~~~~~~~~~~~~~~~~~~~~~~i~G~e~~~~~~~la~~nl~l  230 (445)
T 2okc_A          153 YFTP--RPLIQAMVDCINPQMGETVCDPACGTGGFLLTAYDYMKGQSASKEKRDFLRDKALHGVDNTPLVVTLASMNLYL  230 (445)
T ss_dssp             GCCC--HHHHHHHHHHHCCCTTCCEEETTCTTCHHHHHHHHHHHTCC-CCHHHHHHHHTTEEEEESCHHHHHHHHHHHHH
T ss_pred             ECCC--HHHHHHHHHHCCCCCCCEEECCCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHCEECEECCHHHHHHHHHHCCC
T ss_conf             6598--99999999760799999781278897665999999998731227777553010142341209999999962310