HHsearch results for GI: 254780466 and protein with PDBid: 2pwy_A

>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus HB27}
Probab=96.39  E-value=0.019  Score=33.75  Aligned_cols=128  Identities=18%  Similarity=0.226  Sum_probs=70.9

Q ss_pred             HHHHHH-HCCCCCCEEEECCCCCHHHHHH-HHHHC--CEEEEEEECHHHHHHHHHHHHHCCCCCHHHHCCCCCCC-CCCC
Q ss_conf             999998-5289988899868885179999-99809--81699972899999999999630568765630244433-3775
Q gi|254780466|r  213 LSRILV-SSTKPGDIILDPFFGSGTSGAV-AKKLR--RSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKR-TEPR  287 (375)
Q Consensus       213 leriI~-~~S~~gDiVLDPF~GSGTT~~a-A~~lg--R~~IGiE~~~~Y~~~a~~Rl~~~~~~~~~~~~~~~~~~-~~~r  287 (375)
                      +..++. +--.||+.|||.-+|||....+ |...+  -+.+|+|++++.++.|+++++...-.....+...+... ..+-
T Consensus        85 ~~~Ii~~l~i~pG~~VLEiG~GsG~lt~~lA~~v~~~g~V~~~d~~~~~~~~A~~n~~~~~~~~~v~~~~~d~~~~~~~~  164 (258)
T 2pwy_A           85 ASAMVTLLDLAPGMRVLEAGTGSGGLTLFLARAVGEKGLVESYEARPHHLAQAERNVRAFWQVENVRFHLGKLEEAELEE  164 (258)
T ss_dssp             HHHHHHHTTCCTTCEEEEECCTTSHHHHHHHHHHCTTSEEEEEESCHHHHHHHHHHHHHHCCCCCEEEEESCGGGCCCCT
T ss_pred             HHHHHHHCCCCCCCEEEECCCCHHHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHHCCCCCCEEEEECCHHHCCCCC
T ss_conf             99999971989999999877706799999999728873899984899999999999998089985568836578855556


Q ss_pred             CCHHHHHHCCCCCCCCEEECCCCCEEEEECCCCCEEECCEECCHHHHHHHHCCCCCCCCEE
Q ss_conf             5234698828658776576689806999815981786986531999998744981006711
Q gi|254780466|r  288 VAFNLLVERGLIQPGQILTNAQGNISATVCADGTLISGTELGSIHRVGAKVSGSETCNGWN  348 (375)
Q Consensus       288 vpfg~lie~g~l~~g~~L~~~~~~~~a~v~~DG~l~~~~~~gsIh~i~a~~~~~~~cNGw~  348 (375)
                      ..|.. |.-.+..|-+.|-    ...-..+++|.|+.  ...+|.|+...++..+. +||.
T Consensus       165 ~~~d~-v~ld~p~p~~~l~----~~~~~LKpGG~lv~--~~p~~~Q~~~~~~~l~~-~gf~  217 (258)
T 2pwy_A          165 AAYDG-VALDLMEPWKVLE----KAALALKPDRFLVA--YLPNITQVLELVRAAEA-HPFR  217 (258)
T ss_dssp             TCEEE-EEEESSCGGGGHH----HHHHHEEEEEEEEE--EESCHHHHHHHHHHHTT-TTEE
T ss_pred             CCCCE-EEECCCCHHHHHH----HHHHHCCCCCEEEE--EECCHHHHHHHHHHHHH-CCCE
T ss_conf             43238-9964889999999----99986678959999--93988999999999998-8983