HHsearch results for GI: 254780466 and protein with PDBid: 2pxx_A

>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens}
Probab=95.31  E-value=0.064  Score=30.49  Aligned_cols=61  Identities=13%  Similarity=0.026  Sum_probs=48.3

Q ss_pred             CHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHC-CEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             1899999998528998889986888517999999809-816999728999999999996305
Q gi|254780466|r  209 PEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLR-RSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       209 P~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~lg-R~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      +.+-+..++...-++++-|||.=||+|..+..-.+.| .+.+|+|+++..++.+++|.....
T Consensus        28 ~~~~l~~~~~~~l~~~~~iLDiGCG~G~~~~~L~~~g~~~v~giD~s~~~i~~~~~~~~~~~   89 (215)
T 2pxx_A           28 DFSSFRALLEPELRPEDRILVLGCGNSALSYELFLGGFPNVTSVDYSSVVVAAMQACYAHVP   89 (215)
T ss_dssp             CHHHHHHHHGGGCCTTCCEEEETCTTCSHHHHHHHTTCCCEEEEESCHHHHHHHHHHTTTCT
T ss_pred             CHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHCCCC
T ss_conf             87899999996389999899963777799999998489839998276256679999834786