HHsearch results for GI: 254780466 and protein with PDBid: 2qfm_A

>2qfm_A Spermine synthase; spermidine aminopropyltransferase, SPMSY, structural genomics, structural genomics consortium, SGC; HET: SPD MTA; 1.80A {Homo sapiens} PDB: 3c6k_A* 3c6m_A*
Probab=95.71  E-value=0.024  Score=33.10  Aligned_cols=45  Identities=24%  Similarity=0.152  Sum_probs=33.2

Q ss_pred             CCCEEEECCCCCHHHHHHHHHHC-CEEEEEEECHHHHHHHHHHHHH
Q ss_conf             98889986888517999999809-8169997289999999999963
Q gi|254780466|r  223 PGDIILDPFFGSGTSGAVAKKLR-RSFIGIEMKQDYIDIATKRIAS  267 (375)
Q Consensus       223 ~gDiVLDPF~GSGTT~~aA~~lg-R~~IGiE~~~~Y~~~a~~Rl~~  267 (375)
                      +..-||--=+|.|.++..+.+.+ .+-..+|+|++-++++++-+..
T Consensus       188 ~pk~VLIIGGGdG~~~revlk~~~~~V~~VEID~~Vve~akk~~~~  233 (364)
T 2qfm_A          188 TGKDVLILGGGDGGILCEIVKLKPKMVTMVEIDQMVIDGCKKYMRK  233 (364)
T ss_dssp             TTCEEEEEECTTCHHHHHHHTTCCSEEEEEESCHHHHHHHHHHCCC
T ss_pred             CCCEEEEEECCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHH
T ss_conf             9885999969943999999861784289971038999999986565