HHsearch results for GI: 254780466 and protein with PDBid: 2qm3_A

>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638}
Probab=97.56  E-value=0.00026  Score=45.02  Aligned_cols=66  Identities=11%  Similarity=0.102  Sum_probs=52.2

Q ss_pred             CCCCCCHHHHHHHHHHC---CCCCCEEEECCCCCHH-HHHHHHHHCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             68778189999999852---8998889986888517-999999809816999728999999999996305
Q gi|254780466|r  204 HPTQKPEALLSRILVSS---TKPGDIILDPFFGSGT-SGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       204 HPTqKP~~LleriI~~~---S~~gDiVLDPF~GSGT-T~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      +....|+.+..|+..+.   ..+|.-|||.|+|+|| .+.++...+.+-+|+|+++..++.|++..+...
T Consensus       150 q~~~~~~~~~~r~~~~~~~~~~~g~~vldlg~g~g~~l~~~l~~~~~~V~~vDi~~~~l~~a~~~a~~~g  219 (373)
T 2qm3_A          150 QAYVTPETTVARVILMHTRGDLENKDIFVLGDDDLTSIALMLSGLPKRIAVLDIDERLTKFIEKAANEIG  219 (373)
T ss_dssp             CCCBCHHHHHHHHHHHHHTTCSTTCEEEEESCTTCHHHHHHHHTCCSEEEEECSCHHHHHHHHHHHHHHT
T ss_pred             CCCCCHHHHHHHHHHHHHCCCCCCCEEEEEECCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHC
T ss_conf             0214488999999999863777899799997992499999997699989999797999999999999819