HHsearch results for GI: 254780466 and protein with PDBid: 2qrv_A

>2qrv_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens}
Probab=91.24  E-value=0.34  Score=26.11  Aligned_cols=33  Identities=24%  Similarity=0.371  Sum_probs=21.1

Q ss_pred             HHCC-CEECCCHHHHHHH-C-CCCCCCEEEECCCCC
Q ss_conf             5327-0851725998972-8-414711898477876
Q gi|254780466|r   18 EWKD-KIIKGNSISVLEK-L-PAKSVDLIFADPPYN   50 (375)
Q Consensus        18 ~~~n-kI~~GDcl~~l~~-L-pd~sVDlI~tDPPYn   50 (375)
                      ++-+ .+++||.-++... + ....+|+++.+||--
T Consensus        59 n~~~~~~~~~Di~~~~~~~~~~~~~~Dil~ggpPCQ   94 (295)
T 2qrv_A           59 RHQGKIMYVGDVRSVTQKHIQEWGPFDLVIGGSPCN   94 (295)
T ss_dssp             HTTTCEEEECCGGGCCHHHHHHTCCCSEEEECCCCG
T ss_pred             HCCCCCCCCCCEEEEEECCCCCCCCCEEEECCCCCC
T ss_conf             789997703660157402445677673997268887