HHsearch results for GI: 254780466 and protein with PDBid: 2yvl_A

>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural genomics, NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus VF5}
Probab=96.64  E-value=0.0089  Score=35.70  Aligned_cols=135  Identities=17%  Similarity=0.133  Sum_probs=77.4

Q ss_pred             CCCCC--CHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHCCCCCHHHHCCCCC
Q ss_conf             68778--1899999998528998889986888517999999809816999728999999999996305687656302444
Q gi|254780466|r  204 HPTQK--PEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTG  281 (375)
Q Consensus       204 HPTqK--P~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~~~~~~~~~~~~~  281 (375)
                      |-||-  |...-.-+..+--.||+.|||.-+|||...+...+.+-+-+++|++++.++.|++.+++..-.++..+...+.
T Consensus        70 r~~qiiypkD~~~Ii~~l~i~pG~rVLEiGtGsG~lt~~La~~~g~v~t~e~~e~~~~~A~~n~~~~g~~~nv~~~~~D~  149 (248)
T 2yvl_A           70 RKTQIIYPKDSFYIALKLNLNKEKRVLEFGTGSGALLAVLSEVAGEVWTFEAVEEFYKTAQKNLKKFNLGKNVKFFNVDF  149 (248)
T ss_dssp             CSSCCCCHHHHHHHHHHTTCCTTCEEEEECCTTSHHHHHHHHHSSEEEEECSCHHHHHHHHHHHHHTTCCTTEEEECSCT
T ss_pred             CCCCCCCHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHHCCCCCEEEEECCH
T ss_conf             88740678999999998289999979973743119999998607879998288999999999899700577059999122


Q ss_pred             CC-CCCCCCHHHHHHCCCCCCCCEEECCCCCEEEEECCCCCEEECCEECCHHHHHHHHCCCCCCCCE
Q ss_conf             33-3775523469882865877657668980699981598178698653199999874498100671
Q gi|254780466|r  282 KR-TEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTLISGTELGSIHRVGAKVSGSETCNGW  347 (375)
Q Consensus       282 ~~-~~~rvpfg~lie~g~l~~g~~L~~~~~~~~a~v~~DG~l~~~~~~gsIh~i~a~~~~~~~cNGw  347 (375)
                      .. ..+...|.. |.-.+..|-+.|-    ......+++|.|+.  -.-+|.|+...++..+  ++|
T Consensus       150 ~~~~~~~~~fD~-V~ld~p~p~~~l~----~~~~~LKpGG~lv~--~~P~i~Qv~~~~~~l~--~~f  207 (248)
T 2yvl_A          150 KDAEVPEGIFHA-AFVDVREPWHYLE----KVHKSLMEGAPVGF--LLPTANQVIKLLESIE--NYF  207 (248)
T ss_dssp             TTSCCCTTCBSE-EEECSSCGGGGHH----HHHHHBCTTCEEEE--EESSHHHHHHHHHHST--TTE
T ss_pred             HHCCCCCCCCCE-EEEECCCHHHHHH----HHHHHCCCCCEEEE--EECCHHHHHHHHHHHH--HCC
T ss_conf             214324587899-9991787688899----99984288978999--9297999999999997--086