HHsearch results for GI: 254780466 and protein with PDBid: 2yx1_A

>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 2zzm_A*
Probab=97.85  E-value=3.1e-05  Score=50.66  Aligned_cols=52  Identities=19%  Similarity=0.385  Sum_probs=43.8

Q ss_pred             HHHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             98528998889986888517999999809816999728999999999996305
Q gi|254780466|r  217 LVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       217 I~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      |.....+|+.|||+|||+|+.+++|.+ +.+-+++|+|+..++.+++.++.-.
T Consensus       189 i~~~~~~~~~vlD~f~g~G~~~i~~~~-~~~v~a~d~n~~a~~~~~~N~~~N~  240 (336)
T 2yx1_A          189 IMKKVSLNDVVVDMFAGVGPFSIACKN-AKKIYAIDINPHAIELLKKNIKLNK  240 (336)
T ss_dssp             HHHHCCTTCEEEETTCTTSHHHHHTTT-SSEEEEEESCHHHHHHHHHHHHHTT
T ss_pred             HHHHCCCCCEEEEECCCCCHHHHHCCC-CCEEEEEECCHHHHHHHHHHHHHHC
T ss_conf             664117898899965764676653135-5169999799999999999999829