HHsearch results for GI: 254780466 and protein with PDBid: 2yxe_A

>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, structural genomics; 2.00A {Methanocaldococcus jannaschii DSM2661}
Probab=95.30  E-value=0.072  Score=30.17  Aligned_cols=61  Identities=20%  Similarity=0.210  Sum_probs=48.1

Q ss_pred             HHHHHHHHHHC-CCCCCEEEECCCCCHHHHHH-HHHHCC--EEEEEEECHHHHHHHHHHHHHCCC
Q ss_conf             89999999852-89988899868885179999-998098--169997289999999999963056
Q gi|254780466|r  210 EALLSRILVSS-TKPGDIILDPFFGSGTSGAV-AKKLRR--SFIGIEMKQDYIDIATKRIASVQP  270 (375)
Q Consensus       210 ~~LleriI~~~-S~~gDiVLDPF~GSGTT~~a-A~~lgR--~~IGiE~~~~Y~~~a~~Rl~~~~~  270 (375)
                      ..+.-+++.+. -++|+.|||-=+|||-..+. |+-.|.  +-+++|++++.++.|++++.....
T Consensus        63 P~~~a~~l~~l~l~~g~~VLeIGtGsGY~ta~la~l~g~~g~V~~iE~~~~l~~~a~~~l~~~~~  127 (215)
T 2yxe_A           63 IHMVGMMCELLDLKPGMKVLEIGTGCGYHAAVTAEIVGEDGLVVSIERIPELAEKAERTLRKLGY  127 (215)
T ss_dssp             HHHHHHHHHHTTCCTTCEEEEECCTTSHHHHHHHHHHCTTSEEEEEESCHHHHHHHHHHHHHHTC
T ss_pred             HHHHHHHHHHHCCCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHCCC
T ss_conf             79999999863589998899827884199999999848887189995288999999999986156