HHsearch results for GI: 254780466 and protein with PDBid: 3a27_A

>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii}
Probab=97.87  E-value=4.3e-05  Score=49.75  Aligned_cols=53  Identities=15%  Similarity=0.169  Sum_probs=42.8

Q ss_pred             HHHCCCCCCEEEECCCCCHHHHHHHHHH--CCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             9852899888998688851799999980--9816999728999999999996305
Q gi|254780466|r  217 LVSSTKPGDIILDPFFGSGTSGAVAKKL--RRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       217 I~~~S~~gDiVLDPF~GSGTT~~aA~~l--gR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      |...-.+|+.|||+|||+|.-++.+.+.  +.+.+++|+|++.++.+++.++.-.
T Consensus       113 i~~~v~~ge~VlDl~aG~G~~~i~~ak~~~~~~V~aiDinp~av~~l~~N~~~N~  167 (272)
T 3a27_A          113 MAFISNENEVVVDMFAGIGYFTIPLAKYSKPKLVYAIEKNPTAYHYLCENIKLNK  167 (272)
T ss_dssp             HHTSCCTTCEEEETTCTTTTTHHHHHHHTCCSEEEEEECCHHHHHHHHHHHHHTT
T ss_pred             HHHCCCCCCEEEEECCCCCHHHHHHHHCCCCEEEEEEECCHHHHHHHHHHHHHCC
T ss_conf             8734589999999378658899998750695099999599999999999999849