HHsearch results for GI: 254780466 and protein with PDBid: 3bt7_A

>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli}
Probab=97.65  E-value=0.00018  Score=45.94  Aligned_cols=59  Identities=15%  Similarity=0.180  Sum_probs=49.5

Q ss_pred             CHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHH
Q ss_conf             18999999985289988899868885179999998098169997289999999999963
Q gi|254780466|r  209 PEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIAS  267 (375)
Q Consensus       209 P~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~  267 (375)
                      .+.|.+.++......++-|+|-|||+||-+..-.+...+-+|+|+++..++.|++.++.
T Consensus       199 ~~~l~~~v~~~~~~~~~~vlDLycG~Gt~sl~La~~~~~V~gvE~~~~av~~A~~Na~~  257 (369)
T 3bt7_A          199 NIQMLEWALDVTKGSKGDLLELYCGNGNFSLALARNFDRVLATEIAKPSVAAAQYNIAA  257 (369)
T ss_dssp             HHHHHHHHHHHTTTCCSEEEEESCTTSHHHHHHGGGSSEEEEECCCHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHCCCEEEEEEECHHHHHHHHHHHHH
T ss_conf             99999999987156776488737896588999873085788999702678999999997