HHsearch results for GI: 254780466 and protein with PDBid: 3bus_A

>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes}
Probab=95.81  E-value=0.067  Score=30.37  Aligned_cols=62  Identities=19%  Similarity=0.287  Sum_probs=51.3

Q ss_pred             HHHHHHHHHHC-CCCCCEEEECCCCCHHHH-HHHHHHCCEEEEEEECHHHHHHHHHHHHHCCCC
Q ss_conf             89999999852-899888998688851799-999980981699972899999999999630568
Q gi|254780466|r  210 EALLSRILVSS-TKPGDIILDPFFGSGTSG-AVAKKLRRSFIGIEMKQDYIDIATKRIASVQPL  271 (375)
Q Consensus       210 ~~LleriI~~~-S~~gDiVLDPF~GSGTT~-~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~~~  271 (375)
                      ..++++++... -++|+.|||-=||+|.++ ..++..|-+.+|+|+++..++.++++.......
T Consensus        47 ~~~~~~l~~~~~l~~g~~VLDiGcG~G~~~~~~~~~~~~~v~gvD~s~~~~~~~~~~~~~~~~~  110 (273)
T 3bus_A           47 DRLTDEMIALLDVRSGDRVLDVGCGIGKPAVRLATARDVRVTGISISRPQVNQANARATAAGLA  110 (273)
T ss_dssp             HHHHHHHHHHSCCCTTCEEEEESCTTSHHHHHHHHHSCCEEEEEESCHHHHHHHHHHHHHTTCT
T ss_pred             HHHHHHHHHHCCCCCCCEEEEECCCCCHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCC
T ss_conf             9999999986698997989997897998899999845988999978488899999999871777