HHsearch results for GI: 254780466 and protein with PDBid: 3c0k_A

>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12}
Probab=97.16  E-value=0.00045  Score=43.58  Aligned_cols=61  Identities=15%  Similarity=0.111  Sum_probs=47.2

Q ss_pred             CCCCCCHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHC-CEEEEEEECHHHHHHHHHHHHHC
Q ss_conf             687781899999998528998889986888517999999809-81699972899999999999630
Q gi|254780466|r  204 HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLR-RSFIGIEMKQDYIDIATKRIASV  268 (375)
Q Consensus       204 HPTqKP~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~lg-R~~IGiE~~~~Y~~~a~~Rl~~~  268 (375)
                      +.-|.+.   .+.+...+ +|.-|||.|+|||+.+++|...| ..-+++|+++.+++.|++-.+.-
T Consensus       205 flDqR~~---R~~v~~~~-~g~rVLdlf~~tG~~si~Aa~~GA~~V~~vD~s~~al~~a~~N~~~N  266 (396)
T 3c0k_A          205 YLDQRDS---RLATRRYV-ENKRVLNCFSYTGGFAVSALMGGCSQVVSVDTSQEALDIARQNVELN  266 (396)
T ss_dssp             CGGGHHH---HHHHHHHC-TTCEEEEESCTTCSHHHHHHHTTCSEEEEEESCHHHHHHHHHHHHHT
T ss_pred             CHHHHHH---HHHHHHHC-CCCEEEECCCCCCHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHH
T ss_conf             5306899---99999765-99868753886688999999779975999989899999999999982