HHsearch results for GI: 254780466 and protein with PDBid: 3cc8_A

>3cc8_A Putative methyltransferase; NP_977653.1, structural genomics, joint center for structural genomics, JCSG; 1.64A {Bacillus cereus atcc 10987}
Probab=94.36  E-value=0.055  Score=30.88  Aligned_cols=54  Identities=26%  Similarity=0.207  Sum_probs=43.8

Q ss_pred             HHHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHCCC
Q ss_conf             985289988899868885179999998098169997289999999999963056
Q gi|254780466|r  217 LVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQP  270 (375)
Q Consensus       217 I~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~~  270 (375)
                      +.....++..|||-=||+|..+..-.+.|-+.+|+|+++..++.|++++.++.-
T Consensus        26 ~~~~~~~~~~ILDIGcG~G~~~~~l~~~~~~v~giD~s~~~i~~a~~~~~~~~~   79 (230)
T 3cc8_A           26 LKHIKKEWKEVLDIGCSSGALGAAIKENGTRVSGIEAFPEAAEQAKEKLDHVVL   79 (230)
T ss_dssp             HTTCCTTCSEEEEETCTTSHHHHHHHTTTCEEEEEESSHHHHHHHHTTSSEEEE
T ss_pred             HHHCCCCCCEEEEECCCCCHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEE
T ss_conf             973685799699951888699999997599899996725666665411312331