HHsearch results for GI: 254780466 and protein with PDBid: 3dxy_A

>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, tRNA processing; HET: SAM; 1.50A {Escherichia coli K12} PDB: 3dxx_A* 3dxz_A*
Probab=94.99  E-value=0.056  Score=30.86  Aligned_cols=80  Identities=10%  Similarity=0.183  Sum_probs=48.6

Q ss_pred             HCC-CEECCCHHHHHHH-CCCCCCCEEEECCCC-CCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             327-0851725998972-841471189847787-6155871333678513001344357789899999889999999986
Q gi|254780466|r   19 WKD-KIIKGNSISVLEK-LPAKSVDLIFADPPY-NLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRV   95 (375)
Q Consensus        19 ~~n-kI~~GDcl~~l~~-Lpd~sVDlI~tDPPY-ni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~Rv   95 (375)
                      ..| +++++|..+.+.. +|++|+|.|+.=-|= |-+.+....            .   .-        ..+.+.++.|+
T Consensus        83 l~Ni~~~~~da~~~l~~~~~~~s~d~I~i~FPDPWpKkkh~Kr------------R---lv--------~~~fl~~l~~~  139 (218)
T 3dxy_A           83 LSNLRVMCHDAVEVLHKMIPDNSLRMVQLFFPDPWHKARHNKR------------R---IV--------QVPFAELVKSK  139 (218)
T ss_dssp             CSSEEEECSCHHHHHHHHSCTTCEEEEEEESCCCCCSGGGGGG------------S---SC--------SHHHHHHHHHH
T ss_pred             HCCCCEECCCHHHHHHHHCCCCCCCCCEECCCCCCCCCCCCCC------------C---CC--------CHHHHHHHHHH
T ss_conf             0455056453899998752456454432316887777432462------------5---56--------15589999986


Q ss_pred             CCCCCEEEEECCHHHHH-HHHHHHHHC
Q ss_conf             39687299983468889-999876405
Q gi|254780466|r   96 LKPNGTLWVIGSYHNIF-RIGTMLQNL  121 (375)
Q Consensus        96 LK~~Gsi~v~~~~~~i~-~i~~~l~~~  121 (375)
                      ||++|.+++.+|+...+ .+...+...
T Consensus       140 Lk~gG~l~l~TD~~~Y~~~~~~~~~~~  166 (218)
T 3dxy_A          140 LQLGGVFHMATDWEPYAEHMLEVMSSI  166 (218)
T ss_dssp             EEEEEEEEEEESCHHHHHHHHHHHHTS
T ss_pred             CCCCCEEEEEECCHHHHHHHHHHHHHC
T ss_conf             288989999979799999999999868