HHsearch results for GI: 254780466 and protein with PDBid: 3e05_A

>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxylating); porphyrin metabolism, S-adenosyl-methionine, structural genomics; 1.80A {Geobacter metallireducens gs-15}
Probab=97.23  E-value=0.0022  Score=39.40  Aligned_cols=64  Identities=14%  Similarity=0.157  Sum_probs=49.6

Q ss_pred             CCCCCCHHHHHHHH--HHCCCCCCEEEECCCCCHHHHHHHHHHCC--EEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             68778189999999--85289988899868885179999998098--16999728999999999996305
Q gi|254780466|r  204 HPTQKPEALLSRIL--VSSTKPGDIILDPFFGSGTSGAVAKKLRR--SFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       204 HPTqKP~~LleriI--~~~S~~gDiVLDPF~GSGTT~~aA~~lgR--~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      +|..|.+-  +-++  ..--++||.|||--+|||..++++.+.+.  +-+++|++++.++.|+++++...
T Consensus        21 ~~~tk~ev--ra~~l~~L~l~pg~~VLDiG~GsG~la~~~a~~~~~~~V~aiD~~~~~~~~a~~n~~~~g   88 (204)
T 3e05_A           21 KLITKQEV--RAVTLSKLRLQDDLVMWDIGAGSASVSIEASNLMPNGRIFALERNPQYLGFIRDNLKKFV   88 (204)
T ss_dssp             TTSCCHHH--HHHHHHHTTCCTTCEEEEETCTTCHHHHHHHHHCTTSEEEEEECCHHHHHHHHHHHHHHT
T ss_pred             CCCCHHHH--HHHHHHHCCCCCCCEEEEEEEEHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHCC
T ss_conf             78668999--999998609999399999831078999999997899679999499999999999999819