HHsearch results for GI: 254780466 and protein with PDBid: 3i9f_A

>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus}
Probab=96.00  E-value=0.003  Score=38.58  Aligned_cols=61  Identities=18%  Similarity=0.236  Sum_probs=47.1

Q ss_pred             CCCHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHCCC
Q ss_conf             7818999999985289988899868885179999998098169997289999999999963056
Q gi|254780466|r  207 QKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQP  270 (375)
Q Consensus       207 qKP~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~~  270 (375)
                      ++|+.++..++.   .+.+.|||.=||+|..+..-.+.+.+.+|+|+++..++.|++|++++..
T Consensus         4 e~~~~~~~~l~~---~~~~~VLDiGcG~G~~~~~l~~~~~~v~gvD~s~~~i~~a~~~~~~~~~   64 (170)
T 3i9f_A            4 ERPEEYLPNIFE---GKKGVIVDYGCGNGFYCKYLLEFATKLYCIDINVIALKEVKEKFDSVIT   64 (170)
T ss_dssp             --CTTTHHHHHS---SCCEEEEEETCTTCTTHHHHHTTEEEEEEECSCHHHHHHHHHHCTTSEE
T ss_pred             CCHHHHHHHHHC---CCCCEEEEEECCCCHHHHHHHHCCCEEEEEECCCCCCCEECCCCEEEEE
T ss_conf             059999987557---8969799980899799999996299899994564201000122103553