HHsearch results for GI: 254780466 and protein with PDBid: 3l8d_A

>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.70A {Bacillus thuringiensis}
Probab=95.38  E-value=0.036  Score=32.05  Aligned_cols=51  Identities=16%  Similarity=0.169  Sum_probs=44.1

Q ss_pred             HHHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHH
Q ss_conf             985289988899868885179999998098169997289999999999963
Q gi|254780466|r  217 LVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIAS  267 (375)
Q Consensus       217 I~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~  267 (375)
                      +....+++..|||-=||+|..+..-.+.|-+.+|+|.++..++.|++|...
T Consensus        47 ~~~~l~~~~~VLDiGcG~G~~~~~l~~~~~~v~giD~s~~~l~~a~~~~~~   97 (242)
T 3l8d_A           47 FEQYVKKEAEVLDVGCGDGYGTYKLSRTGYKAVGVDISEVMIQKGKERGEG   97 (242)
T ss_dssp             HHHHSCTTCEEEEETCTTSHHHHHHHHTTCEEEEEESCHHHHHHHHTTTCB
T ss_pred             HHHHCCCCCEEEEECCCCCHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCC
T ss_conf             998589969799965888599999996499899997974667998750344