HHsearch results for GI: 254780466 and protein with PDBid: 3lkd_A

>3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus}
Probab=97.74  E-value=5.7e-05  Score=49.06  Aligned_cols=63  Identities=25%  Similarity=0.377  Sum_probs=48.7

Q ss_pred             CCCCCCH-HHHHHHHHHC--CCCCCEEEECCCCCHHHHHHHHHHCC-----EEEEEEECHHHHHHHHHHHH
Q ss_conf             6877818-9999999852--89988899868885179999998098-----16999728999999999996
Q gi|254780466|r  204 HPTQKPE-ALLSRILVSS--TKPGDIILDPFFGSGTSGAVAKKLRR-----SFIGIEMKQDYIDIATKRIA  266 (375)
Q Consensus       204 HPTqKP~-~LleriI~~~--S~~gDiVLDPF~GSGTT~~aA~~lgR-----~~IGiE~~~~Y~~~a~~Rl~  266 (375)
                      |-|+.++ .|+-.++...  .++|+.|+||.||||+.+++|.+.-+     .+.|.|+++..+.+|+-++.
T Consensus       199 ~~TP~~Iv~lmv~l~~~~~~~~~~~~I~DPacGsGgfL~~a~~~~~~~~~~~~~G~e~~~~~~~la~~nl~  269 (542)
T 3lkd_A          199 FYTPQPVAKLMTQIAFLGREDKQGFTLYDATMGSGSLLLNAKRYSRQPQTVVYFGQELNTSTYNLARMNMI  269 (542)
T ss_dssp             CCCCHHHHHHHHHHHHTTCTTCTTCEEEETTCTTSTTGGGHHHHCSCTTTCEEEEEESCHHHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHCCCCCCCCCCCEEECCCCCCCHHHHHHHHHHHHHCCEEEEEEECCHHHHHHHHHHHH
T ss_conf             58988999857864255645678986832778845588988887750055578744266799999999878