HHsearch results for GI: 254780466 and protein with PDBid: 3lkd_A

>3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus}
Probab=93.97  E-value=0.078  Score=29.99  Aligned_cols=77  Identities=17%  Similarity=0.204  Sum_probs=36.8

Q ss_pred             EECCCHHHHH-HHCCCCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCC-CCC
Q ss_conf             8517259989-72841471189847787615587133367851300134435778989999988999999998639-687
Q gi|254780466|r   23 IIKGNSISVL-EKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLK-PNG  100 (375)
Q Consensus        23 I~~GDcl~~l-~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvLK-~~G  100 (375)
                      |.++|.+..- .....+.+|+|++.|||+.............++..+.....  .+..+|     .|+..+...|+ ++|
T Consensus       280 i~~~d~l~~~~~~~~~~~fD~Il~NPPfg~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~-----~fi~~~~~~L~~~gG  352 (542)
T 3lkd_A          280 LHNADTLDEDWPTQEPTNFDGVLMNPPYSAKWSASSGFMDDPRFSPFGKLAP--KSKADF-----AFLLHGYYHLKQDNG  352 (542)
T ss_dssp             EEESCTTTSCSCCSSCCCBSEEEECCCTTCCCCCCGGGGGSTTTGGGSSCCC--TTCCHH-----HHHHHHHHTBCTTTC
T ss_pred             EECCCCCCCCCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCHHH-----HHHHHHHHHHCCCCC
T ss_conf             3205654444432323200035634886777674211123510013577899--862599-----999999998663787


Q ss_pred             EEEEEC
Q ss_conf             299983
Q gi|254780466|r  101 TLWVIG  106 (375)
Q Consensus       101 si~v~~  106 (375)
                      .+.|+.
T Consensus       353 ~~~iV~  358 (542)
T 3lkd_A          353 VMAIVL  358 (542)
T ss_dssp             EEEEEE
T ss_pred             EEEEEE
T ss_conf             299995