HHsearch results for GI: 254780466 and protein with PDBid: 3m70_A

>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae}
Probab=95.79  E-value=0.064  Score=30.49  Aligned_cols=64  Identities=11%  Similarity=0.061  Sum_probs=48.3

Q ss_pred             CCCCCCCHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             3687781899999998528998889986888517999999809816999728999999999996305
Q gi|254780466|r  203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       203 ~HPTqKP~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      .|++.-...+++.+  ...+ +.-|||-=||+|..+....+.|.+.+|+|+++..++.|++|.....
T Consensus       103 ~~~~~~~~~~~~~~--~~~~-~~~vLDiGcG~G~~~~~la~~g~~v~gvD~s~~~i~~a~~~~~~~~  166 (286)
T 3m70_A          103 YNTTAIHGDVVDAA--KIIS-PCKVLDLGCGQGRNSLYLSLLGYDVTSWDHNENSIAFLNETKEKEN  166 (286)
T ss_dssp             HCCCCCCHHHHHHH--HHSC-SCEEEEESCTTCHHHHHHHHTTCEEEEEESCHHHHHHHHHHHHHTT
T ss_pred             CCCCCHHHHHHHHC--CCCC-CCEEEEECCCCCHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCC
T ss_conf             36631489999858--8899-6979998377989999998589979999898899999998654226