Query         gi|254780466|ref|YP_003064879.1| putative modification methylase [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 375
No_of_seqs    229 out of 1832
Neff          6.3 
Searched_HMMs 23785
Date          Mon May 30 12:03:24 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780466.hhm -d /home/congqian_1/database/pdb/pdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 1g60_A Adenine-specific methyl 100.0       0       0  424.0  21.8  232   18-269     2-258 (260)
  2 1eg2_A Modification methylase  100.0       0       0  417.8  19.6  253   18-300    37-318 (319)
  3 2zig_A TTHA0409, putative modi 100.0       0       0  382.0  15.8  245   16-273    17-285 (297)
  4 1boo_A Protein (N-4 cytosine-s 100.0       0       0  364.6  17.1  262   12-292     6-321 (323)
  5 3ldu_A Putative methylase; str  98.4 4.9E-07 2.1E-11   61.6   6.8   68  202-269   173-281 (385)
  6 3lpm_A Putative methyltransfer  98.4 8.5E-07 3.6E-11   60.1   7.0  108   18-135    96-206 (259)
  7 2nxc_A L11 mtase, ribosomal pr  98.4 5.7E-07 2.4E-11   61.2   6.0   63  203-268   103-165 (254)
  8 3k0b_A Predicted N6-adenine-sp  98.3 1.1E-06 4.6E-11   59.5   7.1   68  203-270   180-288 (393)
  9 1wy7_A Hypothetical protein PH  98.2 4.5E-06 1.9E-10   55.7   7.2   63  207-269    29-96  (207)
 10 3mti_A RRNA methylase; SAM-dep  98.1   1E-05 4.4E-10   53.5   8.3   62  208-269     7-68  (185)
 11 3gdh_A Trimethylguanosine synt  98.1 1.1E-05 4.6E-10   53.4   8.1   60  209-268    62-123 (241)
 12 1ws6_A Methyltransferase; stru  98.1 8.7E-06 3.7E-10   54.0   7.1   54  216-269    34-87  (171)
 13 3eey_A Putative rRNA methylase  98.1 1.6E-05 6.7E-10   52.4   8.0   58  212-269    11-71  (197)
 14 2frn_A Hypothetical protein PH  98.0 1.6E-05 6.8E-10   52.4   7.5   52  218-269   120-172 (278)
 15 2ozv_A Hypothetical protein AT  98.0 1.3E-05 5.3E-10   53.0   6.4   91   22-125    93-188 (260)
 16 2fhp_A Methylase, putative; al  98.0 4.6E-05 1.9E-09   49.6   8.8   72  197-270    18-92  (187)
 17 3a27_A TYW2, uncharacterized p  97.9 4.3E-05 1.8E-09   49.8   7.5   53  217-269   113-167 (272)
 18 2yx1_A Hypothetical protein MJ  97.9 3.1E-05 1.3E-09   50.7   6.5   52  217-269   189-240 (336)
 19 3grz_A L11 mtase, ribosomal pr  97.8 3.7E-05 1.6E-09   50.2   6.8   62  203-267    43-105 (205)
 20 2esr_A Methyltransferase; stru  97.8 5.8E-05 2.4E-09   49.0   7.7   71  198-270     6-79  (177)
 21 1ne2_A Hypothetical protein TA  97.8 6.3E-05 2.7E-09   48.8   7.3   65  204-270    30-99  (200)
 22 2ar0_A M.ecoki, type I restric  97.8 6.1E-05 2.6E-09   48.9   7.2   61  204-266   151-232 (541)
 23 1dus_A MJ0882; hypothetical pr  97.8 8.8E-05 3.7E-09   47.9   7.4   54  216-269    44-98  (194)
 24 3khk_A Type I restriction-modi  97.8 6.3E-05 2.6E-09   48.8   6.7   61  204-266   227-304 (544)
 25 3lkd_A Type I restriction-modi  97.7 5.7E-05 2.4E-09   49.1   6.4   63  204-266   199-269 (542)
 26 2b3t_A Protein methyltransfera  97.7 4.1E-05 1.7E-09   49.9   5.1   66  204-269    90-157 (276)
 27 1nkv_A Hypothetical protein YJ  97.7 0.00037 1.6E-08   44.1   9.8   66  204-269    14-83  (256)
 28 2f8l_A Hypothetical protein LM  97.7  0.0001 4.3E-09   47.5   6.9   65  204-268   108-182 (344)
 29 2okc_A Type I restriction enzy  97.7 9.5E-05   4E-09   47.7   6.4   62  204-267   153-230 (445)
 30 2fpo_A Methylase YHHF; structu  97.7 0.00014   6E-09   46.6   7.3   73  196-270    27-102 (202)
 31 3bt7_A TRNA (uracil-5-)-methyl  97.7 0.00018 7.8E-09   45.9   7.9   59  209-267   199-257 (369)
 32 2yxd_A Probable cobalt-precorr  97.6 0.00033 1.4E-08   44.4   8.8   65  204-269    17-81  (183)
 33 3evz_A Methyltransferase; NYSG  97.6 0.00017 7.2E-09   46.1   7.2   54  216-269    48-103 (230)
 34 1l3i_A Precorrin-6Y methyltran  97.6  0.0004 1.7E-08   43.9   8.6   65  205-269    14-79  (192)
 35 2qm3_A Predicted methyltransfe  97.6 0.00026 1.1E-08   45.0   7.5   66  204-269   150-219 (373)
 36 2as0_A Hypothetical protein PH  97.5 0.00038 1.6E-08   44.1   8.1   62  204-268   201-263 (396)
 37 2ih2_A Modification methylase   97.5 2.6E-05 1.1E-09   51.1   2.0   77   20-105    82-163 (421)
 38 1nw3_A Histone methyltransfera  97.5 0.00054 2.2E-08   43.1   8.7   60  209-268   140-202 (416)
 39 3bxo_A N,N-dimethyltransferase  97.4  0.0003 1.2E-08   44.7   6.6   61  210-270    27-87  (239)
 40 1pjz_A Thiopurine S-methyltran  97.4  0.0012 5.1E-08   41.0   9.5   65  204-268     3-67  (203)
 41 2ift_A Putative methylase HI07  97.4 0.00045 1.9E-08   43.6   7.2   69  201-271    31-102 (201)
 42 1u2z_A Histone-lysine N-methyl  97.4 0.00083 3.5E-08   42.0   8.4   59  210-268   228-289 (433)
 43 1uwv_A 23S rRNA (uracil-5-)-me  97.3 0.00062 2.6E-08   42.7   7.3   59  209-267   271-330 (433)
 44 2jjq_A Uncharacterized RNA met  97.3  0.0011 4.8E-08   41.1   8.4   56  209-266   278-333 (425)
 45 1wxx_A TT1595, hypothetical pr  97.3 0.00045 1.9E-08   43.6   6.2   55  214-269   201-255 (382)
 46 2fhp_A Methylase, putative; al  97.3 7.7E-05 3.2E-09   48.2   2.2   58   21-107    96-155 (187)
 47 1dus_A MJ0882; hypothetical pr  97.3 0.00023 9.5E-09   45.4   4.4   70   20-121   103-173 (194)
 48 3e05_A Precorrin-6Y C5,15-meth  97.2  0.0022 9.2E-08   39.4   9.0   64  204-269    21-88  (204)
 49 1wxx_A TT1595, hypothetical pr  97.2 0.00044 1.8E-08   43.6   5.1   21  210-230   267-287 (382)
 50 2pjd_A Ribosomal RNA small sub  97.2 0.00028 1.2E-08   44.9   3.9   49  221-269   194-244 (343)
 51 2igt_A SAM dependent methyltra  97.2  0.0014 5.8E-08   40.6   7.4   63  204-267   134-197 (332)
 52 3c0k_A UPF0064 protein YCCW; P  97.2 0.00045 1.9E-08   43.6   4.9   61  204-268   205-266 (396)
 53 1xxl_A YCGJ protein; structura  97.2  0.0018 7.6E-08   39.9   8.0   54  215-268    12-66  (239)
 54 1wzn_A SAM-dependent methyltra  97.1  0.0027 1.1E-07   38.8   8.7   58  211-268    28-86  (252)
 55 2fpo_A Methylase YHHF; structu  97.1 0.00029 1.2E-08   44.7   3.7   56   20-107   104-161 (202)
 56 3evz_A Methyltransferase; NYSG  97.1 7.8E-05 3.3E-09   48.2   0.6   93   18-124   103-195 (230)
 57 3g5t_A Trans-aconitate 3-methy  97.1  0.0032 1.3E-07   38.4   8.7   63  207-269    20-85  (299)
 58 1ri5_A MRNA capping enzyme; me  97.1  0.0016 6.8E-08   40.2   7.1   56  215-270    56-112 (298)
 59 3dmg_A Probable ribosomal RNA   97.1  0.0017 7.2E-08   40.1   7.2   60  210-269   217-279 (381)
 60 2esr_A Methyltransferase; stru  97.1 0.00044 1.9E-08   43.6   4.1   57   21-107    83-139 (177)
 61 3kr9_A SAM-dependent methyltra  97.1   0.002 8.6E-08   39.6   7.5   53  217-269     9-63  (225)
 62 2e58_A MNMC2; tRNA wobble urid  97.1 0.00015 6.1E-09   46.6   1.6   76   20-125   167-242 (308)
 63 3lcc_A Putative methyl chlorid  97.0 0.00043 1.8E-08   43.7   3.9   60  209-268    52-111 (235)
 64 2avn_A Ubiquinone/menaquinone   97.0  0.0024 9.9E-08   39.2   7.5   58  210-267    41-98  (260)
 65 2igt_A SAM dependent methyltra  97.0  0.0007 2.9E-08   42.4   4.5   69   19-107   203-273 (332)
 66 3fpf_A Mtnas, putative unchara  97.0   0.004 1.7E-07   37.8   8.4   61  209-269   107-170 (298)
 67 1y8c_A S-adenosylmethionine-de  96.9  0.0026 1.1E-07   38.9   6.9   59  210-268    24-82  (246)
 68 2b78_A Hypothetical protein SM  96.9 0.00059 2.5E-08   42.9   3.6   53  215-268   205-258 (385)
 69 2pjd_A Ribosomal RNA small sub  96.9   0.019 8.1E-07   33.7  11.3   35   87-121    93-128 (343)
 70 1ve3_A Hypothetical protein PH  96.9  0.0068 2.8E-07   36.4   8.8   61  209-269    24-84  (227)
 71 3dr5_A Putative O-methyltransf  96.8  0.0013 5.5E-08   40.8   5.0   58  211-268    43-104 (221)
 72 3bwc_A Spermidine synthase; SA  96.8   0.002 8.4E-08   39.7   5.8   83   17-125   147-234 (304)
 73 3cgg_A SAM-dependent methyltra  96.8   0.003 1.3E-07   38.5   6.6   55  215-269    38-92  (195)
 74 3m33_A Uncharacterized protein  96.8  0.0031 1.3E-07   38.5   6.6   61  208-268    33-93  (226)
 75 3jwg_A HEN1, methyltransferase  96.8  0.0051 2.1E-07   37.2   7.5   66  204-269     5-77  (219)
 76 3mb5_A SAM-dependent methyltra  96.7  0.0063 2.6E-07   36.6   7.8  130  204-340    72-206 (255)
 77 1g8a_A Fibrillarin-like PRE-rR  96.7  0.0029 1.2E-07   38.6   6.0   50  220-269    70-122 (227)
 78 2p8j_A S-adenosylmethionine-de  96.7  0.0054 2.3E-07   37.0   7.1   57  213-269    11-70  (209)
 79 2yvl_A TRMI protein, hypotheti  96.6  0.0089 3.7E-07   35.7   8.0  135  204-347    70-207 (248)
 80 2qm3_A Predicted methyltransfe  96.6  0.0013 5.4E-08   40.8   3.6   53   22-105   224-276 (373)
 81 3ccf_A Cyclopropane-fatty-acyl  96.6   0.008 3.4E-07   36.0   7.5   61  206-269    43-103 (279)
 82 3dlc_A Putative S-adenosyl-L-m  96.6  0.0057 2.4E-07   36.9   6.6   59  211-269    31-90  (219)
 83 1yb2_A Hypothetical protein TA  96.6  0.0069 2.9E-07   36.4   7.0   55  218-272   105-162 (275)
 84 3d2l_A SAM-dependent methyltra  96.5   0.011 4.6E-07   35.1   7.8   58  210-269    21-78  (243)
 85 3hm2_A Precorrin-6Y C5,15-meth  96.5  0.0078 3.3E-07   36.0   7.1   51  219-269    21-73  (178)
 86 3lpm_A Putative methyltransfer  96.5  0.0048   2E-07   37.3   5.9   47  222-268    48-95  (259)
 87 1dl5_A Protein-L-isoaspartate   96.5   0.019 7.9E-07   33.7   8.7  112  209-324    60-197 (317)
 88 2ift_A Putative methylase HI07  96.4  0.0013 5.6E-08   40.7   2.7   58   21-107   106-164 (201)
 89 3lec_A NADB-rossmann superfami  96.4   0.012 4.9E-07   35.0   7.4   53  217-269    15-69  (230)
 90 3dlc_A Putative S-adenosyl-L-m  96.4  0.0027 1.1E-07   38.9   4.1   20   87-106   129-148 (219)
 91 1o54_A SAM-dependent O-methylt  96.4    0.02 8.2E-07   33.6   8.5  132  209-348    98-232 (277)
 92 2pwy_A TRNA (adenine-N(1)-)-me  96.4   0.019 7.8E-07   33.8   8.4  128  213-348    85-217 (258)
 93 3hem_A Cyclopropane-fatty-acyl  96.4   0.033 1.4E-06   32.3   9.6   64  204-269    54-119 (302)
 94 1im8_A YECO; methyltransferase  96.4   0.018 7.5E-07   33.9   8.2   59  212-270    47-109 (244)
 95 3dmg_A Probable ribosomal RNA   96.4   0.002 8.4E-08   39.6   3.3   23   88-110   121-143 (381)
 96 3g2m_A PCZA361.24; SAM-depende  96.3   0.012 5.1E-07   34.9   6.9   56  213-268    72-127 (299)
 97 3hnr_A Probable methyltransfer  96.3   0.011 4.8E-07   35.1   6.7   55  210-267    35-89  (220)
 98 3dli_A Methyltransferase; PSI-  96.3   0.042 1.8E-06   31.6   9.6   25   21-45     83-107 (240)
 99 2fk8_A Methoxy mycolic acid sy  96.3   0.022 9.4E-07   33.3   8.2   64  204-269    72-137 (318)
100 2b25_A Hypothetical protein; s  96.3   0.026 1.1E-06   32.8   8.5  143  204-353    84-246 (336)
101 3p2e_A 16S rRNA methylase; met  96.2  0.0044 1.9E-07   37.5   4.5   55  215-269    16-72  (225)
102 1i1n_A Protein-L-isoaspartate   96.2   0.019   8E-07   33.7   7.7   59  211-269    62-126 (226)
103 2dul_A N(2),N(2)-dimethylguano  96.2   0.012   5E-07   34.9   6.6   50   22-106   115-164 (378)
104 3fzg_A 16S rRNA methylase; met  96.2   0.015 6.5E-07   34.3   7.1   60  210-270    37-98  (200)
105 2b3t_A Protein methyltransfera  96.2   0.031 1.3E-06   32.4   8.5   90   22-125   162-257 (276)
106 1ws6_A Methyltransferase; stru  96.2  0.0019 8.1E-08   39.7   2.3   34   17-50     86-121 (171)
107 1jg1_A PIMT;, protein-L-isoasp  96.2   0.025 1.1E-06   33.0   8.0   60  210-269    77-138 (235)
108 1mjf_A Spermidine synthase; sp  96.2   0.018 7.6E-07   33.8   7.2   90   20-142   135-229 (281)
109 3kkz_A Uncharacterized protein  96.1   0.018 7.8E-07   33.8   7.3   59  210-268    31-92  (267)
110 2fca_A TRNA (guanine-N(7)-)-me  96.1   0.025 1.1E-06   33.0   7.9   77   22-123    91-171 (213)
111 2r6z_A UPF0341 protein in RSP   96.1   0.012 4.9E-07   35.0   6.2   47  222-268    82-128 (258)
112 2gb4_A Thiopurine S-methyltran  96.1   0.023 9.6E-07   33.2   7.7   57  211-267    55-112 (252)
113 3lcv_B Sisomicin-gentamicin re  96.1  0.0058 2.5E-07   36.8   4.6   55  215-269   124-180 (281)
114 1vl5_A Unknown conserved prote  96.1    0.02 8.5E-07   33.5   7.4   56  214-269    27-83  (260)
115 1xva_A Glycine N-methyltransfe  96.1   0.018 7.6E-07   33.8   7.1   48  222-269    55-102 (292)
116 3dh0_A SAM dependent methyltra  96.1   0.025   1E-06   33.0   7.8   61  206-269    23-86  (219)
117 2o57_A Putative sarcosine dime  96.1   0.036 1.5E-06   32.0   8.5   61  208-268    66-128 (297)
118 2p7i_A Hypothetical protein; p  96.1  0.0052 2.2E-07   37.1   4.2   52  215-267    35-86  (250)
119 1nv8_A HEMK protein; class I a  96.1  0.0046 1.9E-07   37.4   3.9   67  204-270   103-171 (284)
120 3ocj_A Putative exported prote  96.1   0.011 4.5E-07   35.2   5.8   59  211-269   106-167 (305)
121 3i9f_A Putative type 11 methyl  96.0   0.003 1.3E-07   38.6   2.6   61  207-270     4-64  (170)
122 3gnl_A Uncharacterized protein  96.0   0.027 1.1E-06   32.8   7.4   53  217-269    15-69  (244)
123 2zfu_A Nucleomethylin, cerebra  95.9  0.0039 1.7E-07   37.9   3.1   40   87-126   132-174 (215)
124 1zx0_A Guanidinoacetate N-meth  95.9   0.014 5.9E-07   34.5   5.9   60  210-269    47-107 (236)
125 2kw5_A SLR1183 protein; struct  95.9   0.017   7E-07   34.1   6.2   58  209-268    17-74  (202)
126 1zx0_A Guanidinoacetate N-meth  95.9  0.0039 1.6E-07   37.9   3.0   61   20-105   109-169 (236)
127 1xj5_A Spermidine synthase 1;   95.9   0.011 4.4E-07   35.3   5.1   64   17-106   172-235 (334)
128 2fyt_A Protein arginine N-meth  95.9   0.017 7.2E-07   34.0   6.2   53  214-267    53-108 (340)
129 2ozv_A Hypothetical protein AT  95.9   0.014   6E-07   34.5   5.7   46  221-266    34-81  (260)
130 3gjy_A Spermidine synthase; AP  95.9   0.012 4.9E-07   35.0   5.1   62   19-106   139-200 (317)
131 2r6z_A UPF0341 protein in RSP   95.8  0.0047   2E-07   37.4   3.1   26  209-234   148-173 (258)
132 3ll7_A Putative methyltransfer  95.8   0.024   1E-06   33.1   6.6   29   22-50    146-174 (410)
133 3bus_A REBM, methyltransferase  95.8   0.067 2.8E-06   30.4   8.9   62  210-271    47-110 (273)
134 3m70_A Tellurite resistance pr  95.8   0.064 2.7E-06   30.5   8.7   64  203-269   103-166 (286)
135 1yzh_A TRNA (guanine-N(7)-)-me  95.8  0.0049 2.1E-07   37.3   3.0   49  220-268    38-88  (214)
136 3iv6_A Putative Zn-dependent a  95.8   0.029 1.2E-06   32.6   6.9   55  213-267    35-89  (261)
137 1fbn_A MJ fibrillarin homologu  95.8   0.018 7.7E-07   33.8   5.8   49  220-268    71-121 (230)
138 3bgv_A MRNA CAP guanine-N7 met  95.7   0.049   2E-06   31.2   7.9   47  221-267    32-79  (313)
139 2qfm_A Spermine synthase; sper  95.7   0.024   1E-06   33.1   6.3   45  223-267   188-233 (364)
140 1nt2_A Fibrillarin-like PRE-rR  95.7   0.028 1.2E-06   32.7   6.5   51  219-269    53-105 (210)
141 3h2b_A SAM-dependent methyltra  95.6   0.043 1.8E-06   31.6   7.3   66  201-269    22-87  (203)
142 2qy6_A UPF0209 protein YFCK; s  95.6  0.0029 1.2E-07   38.6   1.3   34  211-246   194-227 (257)
143 1kpg_A CFA synthase;, cyclopro  95.5   0.062 2.6E-06   30.6   7.9   63  210-272    50-114 (287)
144 1vbf_A 231AA long hypothetical  95.5   0.073 3.1E-06   30.1   8.2   59  211-269    57-116 (231)
145 1nv8_A HEMK protein; class I a  95.4   0.056 2.3E-06   30.9   7.4   86   22-123   176-266 (284)
146 2b2c_A Spermidine synthase; be  95.4   0.023 9.6E-07   33.2   5.2   62   18-106   161-222 (314)
147 2pbf_A Protein-L-isoaspartate   95.4   0.091 3.8E-06   29.6   8.3   50  220-269    77-133 (227)
148 3l8d_A Methyltransferase; stru  95.4   0.036 1.5E-06   32.0   6.2   51  217-267    47-97  (242)
149 3id6_C Fibrillarin-like rRNA/T  95.4   0.048   2E-06   31.3   6.9   50  220-269    73-125 (232)
150 3e23_A Uncharacterized protein  95.4   0.079 3.3E-06   29.9   7.9   57  210-267    31-87  (211)
151 2pxx_A Uncharacterized protein  95.3   0.064 2.7E-06   30.5   7.3   61  209-269    28-89  (215)
152 2yxe_A Protein-L-isoaspartate   95.3   0.072   3E-06   30.2   7.6   61  210-270    63-127 (215)
153 3e8s_A Putative SAM dependent   95.2   0.035 1.5E-06   32.1   5.6   48  221-268    50-97  (227)
154 1yb2_A Hypothetical protein TA  95.2   0.017   7E-07   34.1   3.9   66   22-125   165-231 (275)
155 2gs9_A Hypothetical protein TT  95.1   0.044 1.9E-06   31.5   6.1   53  215-269    28-80  (211)
156 2hnk_A SAM-dependent O-methylt  95.1   0.019 7.8E-07   33.8   4.0   59  211-269    50-109 (239)
157 1qam_A ERMC' methyltransferase  95.1   0.088 3.7E-06   29.7   7.4   68  210-277    16-87  (244)
158 3dli_A Methyltransferase; PSI-  95.1   0.022 9.2E-07   33.3   4.3   49  221-269    39-87  (240)
159 1p91_A Ribosomal RNA large sub  95.0    0.07 2.9E-06   30.3   6.8   60  210-269    72-133 (269)
160 3dxy_A TRNA (guanine-N(7)-)-me  95.0   0.056 2.3E-06   30.9   6.2   80   19-121    83-166 (218)
161 1sui_A Caffeoyl-COA O-methyltr  94.9   0.033 1.4E-06   32.2   5.0   60  210-269    68-128 (247)
162 3f4k_A Putative methyltransfer  94.9    0.15 6.1E-06   28.3   8.2   59  210-268    31-92  (257)
163 1yzh_A TRNA (guanine-N(7)-)-me  94.9   0.086 3.6E-06   29.7   7.0   91   19-134    90-183 (214)
164 2oyr_A UPF0341 protein YHIQ; a  94.9   0.057 2.4E-06   30.8   6.1   57  210-267    76-132 (258)
165 2yqz_A Hypothetical protein TT  94.9   0.058 2.4E-06   30.8   6.0   66  204-269    18-85  (263)
166 3ckk_A TRNA (guanine-N(7)-)-me  94.8    0.02 8.4E-07   33.6   3.6   24   87-110   149-172 (235)
167 2ipx_A RRNA 2'-O-methyltransfe  94.8   0.073 3.1E-06   30.2   6.5   49  221-269    75-126 (233)
168 1g6q_1 HnRNP arginine N-methyl  94.8   0.063 2.7E-06   30.5   6.1   53   22-103    90-142 (328)
169 2yui_A Anamorsin; cytokine-ind  94.7   0.055 2.3E-06   30.9   5.6   72   23-124    51-132 (182)
170 2o07_A Spermidine synthase; st  94.6   0.026 1.1E-06   32.8   3.8  107   16-159   146-257 (304)
171 3ggd_A SAM-dependent methyltra  94.6   0.084 3.5E-06   29.8   6.4   50  218-267    51-100 (245)
172 3g5l_A Putative S-adenosylmeth  94.6   0.081 3.4E-06   29.9   6.3   47  221-267    42-89  (253)
173 3cvo_A Methyltransferase-like   94.6    0.13 5.4E-06   28.7   7.3  165  199-370     6-198 (202)
174 1i9g_A Hypothetical protein RV  94.6    0.18 7.7E-06   27.7   8.0  138  204-348    78-223 (280)
175 2a14_A Indolethylamine N-methy  94.6   0.015 6.5E-07   34.2   2.5   60  210-269    42-102 (263)
176 2vdw_A Vaccinia virus capping   94.6    0.15 6.4E-06   28.2   7.6   47  223-269    48-95  (302)
177 3jwh_A HEN1; methyltransferase  94.5    0.15 6.2E-06   28.3   7.5   48  222-269    28-77  (217)
178 1iy9_A Spermidine synthase; ro  94.5    0.12   5E-06   28.8   6.9   92   17-140   127-223 (275)
179 1m6y_A S-adenosyl-methyltransf  94.5    0.17   7E-06   28.0   7.7   24   23-50     13-36  (301)
180 2okc_A Type I restriction enzy  94.4   0.048   2E-06   31.3   4.7   70   21-106   238-307 (445)
181 2f8l_A Hypothetical protein LM  94.4    0.02 8.6E-07   33.5   2.8   74   17-105   182-255 (344)
182 3cc8_A Putative methyltransfer  94.4   0.055 2.3E-06   30.9   5.0   54  217-270    26-79  (230)
183 1or8_A Protein arginine N-meth  94.3   0.099 4.2E-06   29.3   6.1   23   23-47    110-132 (340)
184 2fca_A TRNA (guanine-N(7)-)-me  94.2   0.068 2.9E-06   30.3   5.1   52  218-269    33-86  (213)
185 3adn_A Spermidine synthase; am  94.2   0.014 5.9E-07   34.5   1.6   58   21-105   140-197 (294)
186 3ege_A Putative methyltransfer  94.2   0.082 3.5E-06   29.8   5.5   18   88-105   113-130 (261)
187 3dxy_A TRNA (guanine-N(7)-)-me  94.1    0.03 1.3E-06   32.5   3.2   51  219-269    30-82  (218)
188 2b9e_A NOL1/NOP2/SUN domain fa  94.1    0.18 7.5E-06   27.8   7.1   50  220-269    99-151 (309)
189 2oo3_A Protein involved in cat  94.0     0.3 1.3E-05   26.4  10.4   85   20-132   138-227 (283)
190 2vdv_E TRNA (guanine-N(7)-)-me  94.0    0.02 8.5E-07   33.5   2.1   47  221-267    47-95  (246)
191 3lkd_A Type I restriction-modi  94.0   0.078 3.3E-06   30.0   5.1   77   23-106   280-358 (542)
192 3mgg_A Methyltransferase; NYSG  94.0    0.32 1.3E-05   26.3   8.6   46  222-267    36-83  (276)
193 3g07_A 7SK snRNA methylphospha  93.9   0.085 3.6E-06   29.7   5.2   47  222-268    45-93  (292)
194 1r18_A Protein-L-isoaspartate(  93.9    0.32 1.3E-05   26.3   8.6   58  211-268    69-137 (227)
195 1i9g_A Hypothetical protein RV  93.9    0.07 2.9E-06   30.3   4.8   66   22-124   156-223 (280)
196 2i62_A Nicotinamide N-methyltr  93.9   0.025   1E-06   33.0   2.5   61  209-269    42-103 (265)
197 3dh0_A SAM dependent methyltra  93.9   0.018 7.8E-07   33.8   1.7   39   87-126   124-176 (219)
198 1uir_A Polyamine aminopropyltr  93.7   0.043 1.8E-06   31.6   3.4   93   19-140   132-230 (314)
199 2b25_A Hypothetical protein; s  93.7   0.034 1.4E-06   32.2   2.8   69   23-126   171-240 (336)
200 1o9g_A RRNA methyltransferase;  93.7    0.33 1.4E-05   26.1   7.9   73  198-270    25-102 (250)
201 2oyr_A UPF0341 protein YHIQ; a  93.6    0.03 1.3E-06   32.5   2.4   28   22-50    148-175 (258)
202 3ofk_A Nodulation protein S; N  93.5   0.065 2.7E-06   30.5   3.9   48  221-268    49-96  (216)
203 3frh_A 16S rRNA methylase; met  93.5    0.23 9.5E-06   27.2   6.7   47  222-269   104-150 (253)
204 2vdv_E TRNA (guanine-N(7)-)-me  93.4    0.17   7E-06   28.0   6.0   82   18-122   105-190 (246)
205 1inl_A Spermidine synthase; be  93.3    0.05 2.1E-06   31.2   3.1   61   20-106   145-205 (296)
206 3mb5_A SAM-dependent methyltra  93.2    0.14 6.1E-06   28.4   5.3   17  208-225   172-188 (255)
207 2pwy_A TRNA (adenine-N(1)-)-me  93.1    0.12 5.1E-06   28.8   4.9   36   89-124   181-217 (258)
208 3bkx_A SAM-dependent methyltra  93.1     0.1 4.2E-06   29.3   4.4   58  209-269    32-98  (275)
209 2ar0_A M.ecoki, type I restric  93.1    0.13 5.4E-06   28.7   4.9   70   20-106   243-312 (541)
210 2i7c_A Spermidine synthase; tr  93.0    0.13 5.3E-06   28.7   4.8  106   17-159   130-240 (283)
211 2p35_A Trans-aconitate 2-methy  92.9    0.15 6.4E-06   28.2   5.1   57  210-269    23-81  (259)
212 2yvl_A TRMI protein, hypotheti  92.8    0.36 1.5E-05   25.9   7.0   62   22-120   143-205 (248)
213 2i6g_A Putative methyltransfer  92.6    0.47   2E-05   25.3   7.3   56  211-269    22-77  (199)
214 3b3j_A Histone-arginine methyl  92.6    0.28 1.2E-05   26.6   6.1   99  220-321   155-275 (480)
215 2pt6_A Spermidine synthase; tr  92.5    0.15 6.3E-06   28.2   4.7   43  225-267   118-162 (321)
216 2g1p_A DNA adenine methylase;   92.4    0.23 9.6E-06   27.1   5.5   28   22-51    159-186 (278)
217 2pxx_A Uncharacterized protein  92.3    0.12 5.2E-06   28.7   4.0   27   80-106   133-159 (215)
218 3hvi_A Catechol O-methyltransf  92.1    0.11 4.6E-06   29.1   3.6   58  210-269    47-107 (221)
219 3dtn_A Putative methyltransfer  92.1     0.6 2.5E-05   24.6   7.4   58  210-267    29-90  (234)
220 3b3f_A Histone-arginine methyl  91.9    0.38 1.6E-05   25.8   6.1   17   87-103   132-148 (341)
221 1wg8_A Predicted S-adenosylmet  91.8    0.48   2E-05   25.2   6.5   21   26-50     12-32  (285)
222 2ih2_A Modification methylase   91.7    0.29 1.2E-05   26.5   5.4   19  209-227   246-264 (421)
223 2ex4_A Adrenal gland protein A  91.6    0.28 1.2E-05   26.6   5.2   57  212-268    66-125 (241)
224 3gu3_A Methyltransferase; alph  91.5    0.68 2.9E-05   24.2   7.8   21   86-106   106-126 (284)
225 1o54_A SAM-dependent O-methylt  91.5    0.24   1E-05   27.0   4.8   35   89-123   196-231 (277)
226 3ldu_A Putative methylase; str  91.5    0.33 1.4E-05   26.2   5.4   13  344-356   335-347 (385)
227 3ou2_A SAM-dependent methyltra  91.4    0.34 1.4E-05   26.1   5.5   45  220-264    43-87  (218)
228 2g1p_A DNA adenine methylase;   91.4    0.28 1.2E-05   26.6   5.0   17   30-49     20-36  (278)
229 3khk_A Type I restriction-modi  91.4   0.098 4.1E-06   29.4   2.7   81   21-106   312-395 (544)
230 3ckk_A TRNA (guanine-N(7)-)-me  91.4    0.17 6.9E-06   28.0   3.8   50  220-269    43-94  (235)
231 2qrv_A DNA (cytosine-5)-methyl  91.2    0.34 1.4E-05   26.1   5.3   33   18-50     59-94  (295)
232 2h00_A Methyltransferase 10 do  90.8    0.81 3.4E-05   23.8   6.9   60  210-269    49-113 (254)
233 2h1r_A Dimethyladenosine trans  90.7     0.7 2.9E-05   24.2   6.5   58  210-267    28-86  (299)
234 3ege_A Putative methyltransfer  90.7     0.1 4.3E-06   29.2   2.2   54  211-264    21-75  (261)
235 1wy7_A Hypothetical protein PH  90.6    0.11 4.5E-06   29.2   2.3   31   16-51     94-124 (207)
236 2dpm_A M.dpnii 1, protein (ade  90.6    0.38 1.6E-05   25.8   5.1   28   22-51    172-199 (284)
237 3m4x_A NOL1/NOP2/SUN family pr  89.8    0.99 4.2E-05   23.3   6.7   97   20-125   156-257 (456)
238 3k0b_A Predicted N6-adenine-sp  89.7    0.32 1.3E-05   26.3   4.1   10   95-104    96-105 (393)
239 2yx1_A Hypothetical protein MJ  89.6     0.2 8.4E-06   27.5   3.0   16  226-241   262-277 (336)
240 1yf3_A DNA adenine methylase;   89.6     0.5 2.1E-05   25.1   5.0   14   37-50    162-175 (259)
241 1yf3_A DNA adenine methylase;   89.5    0.37 1.6E-05   25.9   4.3   16   31-49     18-33  (259)
242 2o57_A Putative sarcosine dime  89.4    0.11 4.8E-06   29.0   1.6   15  239-253   219-233 (297)
243 1zq9_A Probable dimethyladenos  89.4     1.1 4.5E-05   23.1   8.0   26   22-51     80-105 (285)
244 3m6w_A RRNA methylase; rRNA me  89.0     1.1 4.7E-05   22.9   6.9   94   19-121   151-248 (464)
245 2p8j_A S-adenosylmethionine-de  89.0    0.11 4.7E-06   29.0   1.3   54   21-104    73-126 (209)
246 1dct_A Protein (modification m  89.0    0.77 3.3E-05   23.9   5.6   33   16-50     39-72  (324)
247 2r3s_A Uncharacterized protein  89.0    0.97 4.1E-05   23.3   6.1   60  209-269   151-212 (335)
248 3ll7_A Putative methyltransfer  88.8   0.077 3.3E-06   30.0   0.4   47  222-268    92-138 (410)
249 3ajd_A Putative methyltransfer  88.7     1.2   5E-05   22.8   7.9   59  205-269    71-132 (274)
250 3g7u_A Cytosine-specific methy  88.5    0.76 3.2E-05   24.0   5.3   28   23-50     49-82  (376)
251 3a27_A TYW2, uncharacterized p  88.5     0.2 8.6E-06   27.4   2.4   18  226-243   190-207 (272)
252 1vl5_A Unknown conserved prote  88.1    0.14   6E-06   28.4   1.4   19   87-105   121-139 (260)
253 1sqg_A SUN protein, FMU protei  88.0    0.38 1.6E-05   25.8   3.5   51  219-269   242-294 (429)
254 3c3p_A Methyltransferase; NP_9  88.0     1.3 5.5E-05   22.5   7.1   57  211-269    46-105 (210)
255 1xxl_A YCGJ protein; structura  88.0    0.11 4.5E-06   29.2   0.7   52   22-105    72-123 (239)
256 3i9f_A Putative type 11 methyl  87.3    0.26 1.1E-05   26.8   2.3   53   19-105    59-111 (170)
257 3bkw_A MLL3908 protein, S-aden  87.3     1.2 5.2E-05   22.7   5.8   47  221-267    41-88  (243)
258 2c7p_A Modification methylase   87.2     1.1 4.7E-05   23.0   5.5   30   18-50     52-82  (327)
259 2avn_A Ubiquinone/menaquinone   86.9    0.24   1E-05   27.0   1.9   19   86-104   132-150 (260)
260 1g55_A DNA cytosine methyltran  86.5       1 4.3E-05   23.2   5.0   32   18-49     45-78  (343)
261 3kkz_A Uncharacterized protein  86.5    0.15 6.3E-06   28.3   0.7   52   21-105    98-149 (267)
262 3gru_A Dimethyladenosine trans  86.5     1.6 6.7E-05   22.0   7.3   58  210-267    36-94  (295)
263 3l8d_A Methyltransferase; stru  86.4    0.34 1.4E-05   26.1   2.5   28  204-231   127-154 (242)
264 1xtp_A LMAJ004091AAA; SGPP, st  85.8     1.7 7.3E-05   21.8   7.1   56  214-269    83-140 (254)
265 3grz_A L11 mtase, ribosomal pr  85.7    0.49   2E-05   25.2   3.0   20   89-108    51-70  (205)
266 3m33_A Uncharacterized protein  85.0   0.097 4.1E-06   29.4  -0.9   12   95-106    45-56  (226)
267 2yqz_A Hypothetical protein TT  84.7    0.22 9.3E-06   27.2   0.9   52   22-105    89-140 (263)
268 3fut_A Dimethyladenosine trans  84.4       2 8.5E-05   21.4   5.9   58  210-267    33-90  (271)
269 3f4k_A Putative methyltransfer  83.3    0.31 1.3E-05   26.3   1.1   50   22-104    99-148 (257)
270 1ne2_A Hypothetical protein TA  83.2    0.47   2E-05   25.2   2.1   27   21-52     97-123 (200)
271 3duw_A OMT, O-methyltransferas  82.9     2.3 9.8E-05   21.0   7.1   58  210-269    47-107 (223)
272 2frx_A Hypothetical protein YE  82.6     2.4  0.0001   20.9   7.8   92   23-123   172-267 (479)
273 1qyr_A KSGA, high level kasuga  81.2     2.3 9.8E-05   21.0   5.0   30   22-51     70-102 (252)
274 1vlm_A SAM-dependent methyltra  81.1     1.6 6.7E-05   22.0   4.1   39  222-264    46-84  (219)
275 3lbf_A Protein-L-isoaspartate   80.9     2.8 0.00012   20.6   8.7   61  210-270    63-124 (210)
276 2fyt_A Protein arginine N-meth  80.8    0.35 1.5E-05   26.0   0.7   25   23-49    117-141 (340)
277 3g5l_A Putative S-adenosylmeth  80.4    0.48   2E-05   25.2   1.2   20   86-105   125-144 (253)
278 1g6q_1 HnRNP arginine N-methyl  77.5    0.37 1.6E-05   25.9  -0.1   46  222-268    37-83  (328)
279 3ndi_A Methyltransferase; S-ad  77.5     3.5 0.00015   19.9   6.6   30  220-249   316-345 (416)
280 3cbg_A O-methyltransferase; cy  76.5     3.8 0.00016   19.7   5.4   60  210-269    61-121 (232)
281 3me5_A Cytosine-specific methy  74.6       4 0.00017   19.6   4.6   28   22-49    137-179 (482)
282 2avd_A Catechol-O-methyltransf  73.0     4.6 0.00019   19.2   4.9   59  210-269    58-118 (229)
283 2aot_A HMT, histamine N-methyl  72.8     4.7  0.0002   19.2   5.3   45  226-270    55-107 (292)
284 2gpy_A O-methyltransferase; st  71.1     5.1 0.00021   18.9   7.2   63  205-269    36-102 (233)
285 1zcj_A Peroxisomal bifunctiona  67.0     2.3 9.5E-05   21.1   2.0   40  209-248   356-396 (463)
286 1p3d_A UDP-N-acetylmuramate--a  66.0     4.1 0.00017   19.5   3.1   34  224-257   339-378 (475)
287 1tk9_A Phosphoheptose isomeras  63.7     6.7 0.00028   18.2   3.8   46  209-255    96-147 (188)
288 3c3y_A Pfomt, O-methyltransfer  61.7     7.9 0.00033   17.8   6.1   62  207-269    54-119 (237)
289 2q5c_A NTRC family transcripti  60.7     5.6 0.00024   18.7   3.0   60  204-267   123-182 (196)
290 1yub_A Ermam, rRNA methyltrans  60.1    0.36 1.5E-05   25.9  -3.2   28   22-51     78-105 (245)
291 1ixk_A Methyltransferase; open  57.8     9.2 0.00039   17.4   6.7   51  220-270   115-168 (315)
292 1i4w_A Mitochondrial replicati  55.7     9.9 0.00042   17.2   7.4   11  247-257    84-94  (353)
293 2vsy_A XCC0866; transferase, g  55.7     6.8 0.00029   18.2   2.7   30  222-251   452-482 (568)
294 2yxl_A PH0851 protein, 450AA l  53.3      11 0.00046   16.9   7.5   51  219-269   255-308 (450)
295 2wk1_A NOVP; transferase, O-me  52.6      10 0.00043   17.1   3.2   33   90-122    96-132 (282)
296 2g72_A Phenylethanolamine N-me  52.5      11 0.00047   16.9   4.2   59  211-269    59-118 (289)
297 1kag_A SKI, shikimate kinase I  51.8      12 0.00048   16.8   4.9   11  209-219   159-169 (173)
298 2f00_A UDP-N-acetylmuramate--L  51.6     6.7 0.00028   18.2   2.2   31  224-254   345-382 (491)
299 2e55_A Uracil phosphoribosyltr  51.0      12  0.0005   16.7   3.7   43  223-265   122-171 (208)
300 3ftd_A Dimethyladenosine trans  50.3      12 0.00051   16.7   5.3   31   21-52     78-108 (249)
301 3dmp_A Uracil phosphoribosyltr  49.6       6 0.00025   18.5   1.7   44  221-264   128-180 (217)
302 2pt5_A Shikimate kinase, SK; a  48.7      13 0.00054   16.5   3.5   12  208-219   149-160 (168)
303 3gi1_A LBP, laminin-binding pr  46.4     9.8 0.00041   17.2   2.3   63  205-268   212-281 (286)
304 2bm8_A Cephalosporin hydroxyla  43.9      10 0.00042   17.2   2.1   20   90-110    74-93  (236)
305 1xtt_A Probable uracil phospho  42.9      13 0.00056   16.4   2.6   42  223-264   134-182 (216)
306 2dnr_A Synaptojanin-1; RRM dom  42.7      16 0.00067   15.9   3.2   39  207-245    23-69  (91)
307 1o5o_A Uracil phosphoribosyltr  41.8     9.4 0.00039   17.3   1.7   23  222-244   136-158 (221)
308 3i53_A O-methyltransferase; CO  40.8      17 0.00072   15.8   6.4   44  225-269   171-216 (332)
309 1i5e_A Uracil phosphoribosyltr  39.4      11 0.00045   17.0   1.7   42  223-264   125-173 (209)
310 1bd3_D Uprtase, uracil phospho  36.0      13 0.00055   16.5   1.7   44  223-270   157-209 (243)
311 1nvt_A Shikimate 5'-dehydrogen  33.4      16 0.00066   16.0   1.7   66  295-373   216-286 (287)
312 2x58_A Peroxisomal bifunctiona  33.0      16 0.00069   15.9   1.8  120  231-352   306-440 (727)
313 2km1_A Protein DRE2; yeast, an  32.4      10 0.00042   17.2   0.6   48   83-135    75-124 (136)
314 1qzz_A RDMB, aclacinomycin-10-  31.7      24   0.001   14.9   7.1   56  214-270   172-230 (374)
315 1zod_A DGD, 2,2-dialkylglycine  30.4      20 0.00082   15.4   1.8   14  230-243   303-316 (433)
316 1x19_A CRTF-related protein; m  30.1      25  0.0011   14.7   6.9   56  213-269   179-237 (359)
317 2i2c_A Probable inorganic poly  30.0      26  0.0011   14.7   2.7   22  352-373   245-266 (272)
318 2qe6_A Uncharacterized protein  29.8      26  0.0011   14.7   6.6   58  211-268    63-127 (274)
319 2ip2_A Probable phenazine-spec  29.7      26  0.0011   14.7   5.3   55  214-269   158-214 (334)
320 1ej0_A FTSJ; methyltransferase  29.3      26  0.0011   14.6   3.9   86   23-135    66-162 (180)
321 2ehj_A Uracil phosphoribosyltr  29.1      27  0.0011   14.6   4.5   43  224-270   125-174 (208)
322 3opn_A Putative hemolysin; str  28.3      27  0.0012   14.5   7.3   66   87-161   118-205 (232)
323 3bzb_A Uncharacterized protein  28.0      28  0.0012   14.5   8.1   58  210-267    65-125 (281)
324 2i2w_A Phosphoheptose isomeras  27.8      28  0.0012   14.4   3.1   43  211-254   119-167 (212)
325 2prs_A High-affinity zinc upta  27.7      28  0.0012   14.4   4.1   64  205-269   207-278 (284)
326 3ly1_A Putative histidinol-pho  27.6      28  0.0012   14.4   4.8   47  208-269   227-273 (354)
327 2qzj_A Two-component response   26.5      22 0.00093   15.1   1.5   47    1-47      1-56  (136)
328 3cx3_A Lipoprotein; zinc-bindi  25.6      28  0.0012   14.5   1.9   48  205-269   233-280 (284)
329 2e7u_A Glutamate-1-semialdehyd  25.5      26  0.0011   14.7   1.7   23  213-235   189-212 (424)
330 3hn7_A UDP-N-acetylmuramate-L-  25.3      22 0.00093   15.1   1.3   29  223-251   385-419 (524)
331 3mog_A Probable 3-hydroxybutyr  24.9      13 0.00056   16.4   0.1   31  222-253   316-346 (483)
332 2wtb_A MFP2, fatty acid multif  24.7     9.6 0.00041   17.3  -0.6  118  232-351   318-452 (725)
333 1e6c_A Shikimate kinase; phosp  24.2      33  0.0014   14.0   3.7   13  207-219   155-167 (173)
334 3etn_A Putative phosphosugar i  24.1      32  0.0013   14.1   2.0   15   93-107    53-67  (220)
335 1mdo_A ARNB aminotransferase;   23.8      33  0.0014   14.0   3.6   10  210-219   203-212 (393)
336 2hmt_A YUAA protein; RCK, KTN,  23.1      29  0.0012   14.4   1.6   11  112-122    19-29  (144)
337 1x92_A APC5045, phosphoheptose  22.4      35  0.0015   13.8   2.8   44  210-254   100-149 (199)
338 2pju_A Propionate catabolism o  22.3      36  0.0015   13.8   2.6   56  204-264   135-190 (225)
339 1vdm_A Purine phosphoribosyltr  22.1      35  0.0015   13.8   1.9   23  222-244    83-105 (153)
340 3oks_A 4-aminobutyrate transam  22.0      36  0.0015   13.8   1.9   14  230-243   325-338 (451)
341 3mcz_A O-methyltransferase; ad  22.0      36  0.0015   13.8   5.3   46  223-269   179-226 (352)
342 1914_A Signal recognition part  21.8      36  0.0015   13.8   3.0   23   83-106    27-49  (232)
343 1aqu_A EST, estrogen sulfotran  21.5      37  0.0016   13.7   2.6   22   27-48     28-49  (297)
344 1ufw_A Synaptojanin 2; RNP dom  21.3      23 0.00097   14.9   0.8   38  207-244    32-77  (95)
345 2cjg_A L-lysine-epsilon aminot  21.1      34  0.0014   13.9   1.6   10  226-235   235-244 (449)
346 2cmg_A Spermidine synthase; tr  20.5      39  0.0016   13.6   4.4   40  226-265    75-114 (262)
347 1qhx_A CPT, protein (chloramph  20.5      39  0.0016   13.6   4.0   45  222-267    85-132 (178)
348 2jov_A Hypothetical protein CP  20.2     4.8  0.0002   19.1  -2.9   42  208-249    29-78  (85)

No 1  
>1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11
Probab=100.00  E-value=0  Score=423.98  Aligned_cols=232  Identities=33%  Similarity=0.541  Sum_probs=201.8

Q ss_pred             HHCCCEECCCHHHHHHHCCCCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCC
Q ss_conf             53270851725998972841471189847787615587133367851300134435778989999988999999998639
Q gi|254780466|r   18 EWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLK   97 (375)
Q Consensus        18 ~~~nkI~~GDcl~~l~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvLK   97 (375)
                      -.+|+||+|||+++|+.|||+||||||||||||++.                +.||...++++|++|+..|+.+++|+||
T Consensus         2 ~~~n~i~~gD~l~~l~~l~d~sVDlIitdPPY~~~~----------------~~~d~~~~~~~y~~~~~~~~~e~~rvLk   65 (260)
T 1g60_A            2 LEINKIHQMNCFDFLDQVENKSVQLAVIDPPYNLSK----------------ADWDSFDSHNEFLAFTYRWIDKVLDKLD   65 (260)
T ss_dssp             CCSSSEEECCHHHHHHHSCTTCEEEEEECCCCSSCS----------------SGGGCCSSHHHHHHHHHHHHHHHHHHEE
T ss_pred             CCCCEEEECHHHHHHHHCCCCCCCEEEECCCCCCCC----------------CCCCCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             865767713199998538678658799899988877----------------7577788999999999999999988871


Q ss_pred             CCCEEEEECCHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEECCCCCCCC---
Q ss_conf             68729998346888999987640578601246873156777757751765402132210056666502341001123---
Q gi|254780466|r   98 PNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAA---  174 (375)
Q Consensus        98 ~~Gsi~v~~~~~~i~~i~~~l~~~gf~~~n~IIW~K~n~~pn~~g~r~~~~hE~iiw~~K~~~~k~y~fny~~~k~~---  174 (375)
                      ++|++|++++....+++..++++.||.+.+.|||.|.+..|+ .++++..+||.++|++|+..   ++|+++.++..   
T Consensus        66 ~~g~~~~~~~~~~~~~~~~~l~~~~~~~~~~iiW~k~~~~~~-~~~~~~~~~e~~~~~~k~~~---~~~~~~~~~~~~~~  141 (260)
T 1g60_A           66 KDGSLYIFNTPFNCAFICQYLVSKGMIFQNWITWDKRDGMGS-AKRRFSTGQETILFFSKSKN---HTFNYDEVRVPYES  141 (260)
T ss_dssp             EEEEEEEEECHHHHHHHHHHHHHTTCEEEEEEEECCCCSCCC-CSSSCBCCCEEEEEEESSTT---CCCCGGGSCBCCCH
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHCCCCEEEEEEEECCCCCCC-CCCCCCCCCCEEEEECCCCC---CCCCHHHHCCCCCC
T ss_conf             588632015704789999998751443026899941446544-46667764111331035764---42567773365346


Q ss_pred             ----------------------CCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCEEEECCC
Q ss_conf             ----------------------7980104654221025854145778753368778189999999852899888998688
Q gi|254780466|r  175 ----------------------NEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFF  232 (375)
Q Consensus       175 ----------------------n~~~~~~s~w~~pi~~g~er~k~~~g~k~HPTqKP~~LleriI~~~S~~gDiVLDPF~  232 (375)
                                            .....+.++|.++...+.++......+..||||||++|++++|+++|++||+|||||+
T Consensus       142 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vw~~~~~~~~~~~~~~~~~~~Hpt~kP~~L~~~~I~~~s~~gd~VlDpF~  221 (260)
T 1g60_A          142 TDRIKHASEKGILKNGKRWFPNPNGRLCGEVWHFSSQRHKEKVNGKTVKLTHITPKPRDLIERIIRASSNPNDLVLDCFM  221 (260)
T ss_dssp             HHHHHHHHHHTSCBTTBCCCCCTTCBCCBSEECCC------------------CCCCHHHHHHHHHHHCCTTCEEEESSC
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCEECCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCEEEECCC
T ss_conf             64202100047543353015775665433202114656410015764444565556768888899964899998998999


Q ss_pred             CCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             8517999999809816999728999999999996305
Q gi|254780466|r  233 GSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       233 GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      |||||++||+++||+|||||++++|+++|.+||++++
T Consensus       222 GSGtT~~aa~~~~R~~ig~E~~~~y~~~a~~Rl~~~~  258 (260)
T 1g60_A          222 GSGTTAIVAKKLGRNFIGCDMNAEYVNQANFVLNQLE  258 (260)
T ss_dssp             TTCHHHHHHHHTTCEEEEEESCHHHHHHHHHHHHC--
T ss_pred             CCHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHC
T ss_conf             8319999999809949999679999999999999851


No 2  
>1eg2_A Modification methylase RSRI; rossmann fold, exocyclic amino DNA methyltransferase RSRI, DNA binding, DNA modification, DNA methylation; HET: MTA; 1.75A {Rhodobacter sphaeroides} SCOP: c.66.1.11 PDB: 1nw5_A* 1nw6_A* 1nw7_A* 1nw8_A
Probab=100.00  E-value=0  Score=417.83  Aligned_cols=253  Identities=30%  Similarity=0.498  Sum_probs=201.6

Q ss_pred             HHCCCEECCCHHHHHHHCCCCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCC
Q ss_conf             53270851725998972841471189847787615587133367851300134435778989999988999999998639
Q gi|254780466|r   18 EWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLK   97 (375)
Q Consensus        18 ~~~nkI~~GDcl~~l~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvLK   97 (375)
                      +-.|.++.|||+++|+.|||+||||||||||||++..                .||+   +.+|++|+..|+.||+||||
T Consensus        37 ~~~~~~~~gDcle~l~~lpd~SVDLIitDPPYn~~~~----------------~~~~---~~dy~~~~~~~l~e~~rvLk   97 (319)
T 1eg2_A           37 TTRHVYDVCDCLDTLAKLPDDSVQLIICDPPYNIMLA----------------DWDD---HMDYIGWAKRWLAEAERVLS   97 (319)
T ss_dssp             CEEEEEEECCHHHHHHTSCTTCEEEEEECCCSBCCGG----------------GGGT---CSSHHHHHHHHHHHHHHHEE
T ss_pred             CCCCEEEECCHHHHHHHCCCCCCCEEEECCCCCCCCC----------------CCCC---HHHHHHHHHHHHHHHHHHCC
T ss_conf             7644699652899982286887557998999988767----------------5667---78899999999999898748


Q ss_pred             CCCEEEEECCHH---------HHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEECC
Q ss_conf             687299983468---------88999987640578601246873156777757751765402132210056666502341
Q gi|254780466|r   98 PNGTLWVIGSYH---------NIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNY  168 (375)
Q Consensus        98 ~~Gsi~v~~~~~---------~i~~i~~~l~~~gf~~~n~IIW~K~n~~pn~~g~r~~~~hE~iiw~~K~~~~k~y~fny  168 (375)
                      ++|++|+++++.         .+..+..++.+.||++++.|+|.|+++.+  ...++.++||.++|+.|+++   |.|++
T Consensus        98 ~~G~i~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~k~~~~~--~~~~~~~~~e~i~~~~k~~~---~~~~~  172 (319)
T 1eg2_A           98 PTGSIAIFGGLQYQGEAGSGDLISIISHMRQNSKMLLANLIIWNYPNGMS--AQRFFANRHEEIAWFAKTKK---YFFDL  172 (319)
T ss_dssp             EEEEEEEEECSCCCCCTTBCCHHHHHHHHHHHCCCEEEEEEEEECSCCCC--CSSSCCCCEEEEEEEESSTT---CCCCS
T ss_pred             CCCCEEEECCCCCCCCCCCCHHHHHHHHHHHCCCCEEEEEEEEECCCCCC--CCCCCCCCCCCEEECCCCCC---CCCCH
T ss_conf             89778997783323443532047788887522675898899981367876--34556654344110036777---66667


Q ss_pred             CCCCCCCC--------------------CEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCEEE
Q ss_conf             00112379--------------------8010465422102585414577875336877818999999985289988899
Q gi|254780466|r  169 DALKAANE--------------------DVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIIL  228 (375)
Q Consensus       169 ~~~k~~n~--------------------~~~~~s~w~~pi~~g~er~k~~~g~k~HPTqKP~~LleriI~~~S~~gDiVL  228 (375)
                      +.++....                    +..+.+.|.++...+.     ......||||||++|++|||+++|+|||+||
T Consensus       173 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~-----~~~~~~Hpt~kP~~L~erlI~~~S~~gdiVL  247 (319)
T 1eg2_A          173 DAVREPYDEETKAAYMKDKRLNPESVEKGRNPTNVWRMSRLNGN-----SLERVGHPTQKPAAVIERLVRALSHPGSTVL  247 (319)
T ss_dssp             GGGCBCCCHHHHHHHHTCTTSCHHHHHHCBCCCSEEECCCCCTT-----CSSCCSCTTCCCHHHHHHHHHHHSCTTCEEE
T ss_pred             HHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-----CCCCCCCCCCCCHHHHHHHHHHHCCCCCEEE
T ss_conf             87447543344332123434475423478656675346645566-----6333366444838889999876278999999


Q ss_pred             ECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHCCCCCHHHHCCCCCCCCCCCCCHHHHHHCCCCC
Q ss_conf             868885179999998098169997289999999999963056876563024443337755234698828658
Q gi|254780466|r  229 DPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQ  300 (375)
Q Consensus       229 DPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~~~~~~~~~~~~~~~~~~rvpfg~lie~g~l~  300 (375)
                      |||||||||++||++|||+|||||++++|+++|.+||++++.-... -.....+..++|+|||.++|+|-+.
T Consensus       248 DpF~GSGTT~~AA~~lgR~~IG~Ei~~~y~~ia~~Ri~~~~~~~~~-~~~~~~~~~e~~~~~~~~~~~~~~~  318 (319)
T 1eg2_A          248 DFFAGSGVTARVAIQEGRNSICTDAAPVFKEYYQKQLTFLQDDGLI-DKARSYEIVEGAANFGAALQRGDVA  318 (319)
T ss_dssp             ETTCTTCHHHHHHHHHTCEEEEEESSTHHHHHHHHHHHHC----------CCEEEEECGGGTHHHHCC----
T ss_pred             ECCCCCCHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHHCCCHH-HHCCCCCCCCCCCCHHHHHHCCCCC
T ss_conf             8799884899999981993999948999999999999975413101-1012121255667788897524556


No 3  
>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A
Probab=100.00  E-value=0  Score=381.97  Aligned_cols=245  Identities=22%  Similarity=0.254  Sum_probs=169.6

Q ss_pred             HHHHCCCEECCCHHHHHHHCCCCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             35532708517259989728414711898477876155871333678513001344357789899999889999999986
Q gi|254780466|r   16 IFEWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRV   95 (375)
Q Consensus        16 ~~~~~nkI~~GDcl~~l~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~Rv   95 (375)
                      ..-.+|+|++|||+++|+.||++||||||||||||++.++.-.          .+.++...++++|++|+..|+.+|+|+
T Consensus        17 ~~~~~~~i~~GD~le~lk~L~d~SVDLIitDPPYn~~~~y~~~----------~~~~~~~~~~~~y~~~~~~~~~e~~r~   86 (297)
T 2zig_A           17 VSFGVHRLHVGDAREVLASFPEASVHLVVTSPPYWTLKRYEDT----------PGQLGHIEDYEAFLDELDRVWREVFRL   86 (297)
T ss_dssp             ----CEEEEESCHHHHHTTSCTTCEEEEEECCCCCCCC-----------------CCHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCEEEECCHHHHHHHCCCCCCCEEEECCCCCCCCCCCCC----------CCCCCCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             1033787994768999962867775979989699888557887----------665431577999999999999999999


Q ss_pred             CCCCCEEEEECCH--------------HHHHHHHHHHHHCCCCEEEEEEEECCCCCCCC-CCC--CCCCCHHHHHHHHCC
Q ss_conf             3968729998346--------------88899998764057860124687315677775-775--176540213221005
Q gi|254780466|r   96 LKPNGTLWVIGSY--------------HNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF-RGR--RFQNAHETLIWASPS  158 (375)
Q Consensus        96 LK~~Gsi~v~~~~--------------~~i~~i~~~l~~~gf~~~n~IIW~K~n~~pn~-~g~--r~~~~hE~iiw~~K~  158 (375)
                      ||++|++|++++.              ...+.+...+++.|+.+++.++|.|.++++.. .+.  .+...++...++...
T Consensus        87 Lk~~G~i~i~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~g~~~~~~i~w~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~  166 (297)
T 2zig_A           87 LVPGGRLVIVVGDVAVARRRFGRHLVFPLHADIQVRCRKLGFDNLNPIIWHKHTNASLEVEGRGVFLGKPYEPGAIIKTE  166 (297)
T ss_dssp             EEEEEEEEEEECCEEEECC----EEEECHHHHHHHHHHHTTCEEEEEEEEECC----------------CCCTTCCCCCC
T ss_pred             HHHCCCCCCCCCCHHHHHHHCCCCCCCCCHHHHHHHHHHCCCCCCCCCCEECCCCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             97538621003661010000012234551256665555348505155200013677641145430215766752101442


Q ss_pred             CCCCCCEECCCCCCCCC-CCEEECCCCCCCCCC------CCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCEEEECC
Q ss_conf             66665023410011237-980104654221025------85414577875336877818999999985289988899868
Q gi|254780466|r  159 PKAKGYTFNYDALKAAN-EDVQMRSDWLIPICS------GSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPF  231 (375)
Q Consensus       159 ~~~k~y~fny~~~k~~n-~~~~~~s~w~~pi~~------g~er~k~~~g~k~HPTqKP~~LleriI~~~S~~gDiVLDPF  231 (375)
                         ..|.+.+...+... .....++.|.+|...      .........+.+.||||||++|+++||+++|++||+|||||
T Consensus       167 ---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Hpt~kP~~L~~~lI~~~s~~gd~VlDpF  243 (297)
T 2zig_A          167 ---IEYILMQRKPGGYRKPTQEQREKSRLPKEDFHRFFRQIWDDIPGESTKDHPAPFPLELAERLVRMFSFVGDVVLDPF  243 (297)
T ss_dssp             ---EEEEEEEECCSCCCCCCHHHHHHHCCCHHHHHHHSSSEECSCC--------CCSCHHHHHHHHHHHCCTTCEEEETT
T ss_pred             ---HHHEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCEEEECC
T ss_conf             ---01011212467766776454322235645455222100232245333467554887899999997379989999899


Q ss_pred             CCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHCCCCCH
Q ss_conf             885179999998098169997289999999999963056876
Q gi|254780466|r  232 FGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLGN  273 (375)
Q Consensus       232 ~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~~~~~  273 (375)
                      ||||||++||++|||+|||||++++|+++|.+||+++.+-..
T Consensus       244 ~GSGTT~~aa~~l~R~~Ig~E~~~~y~~~a~~Rl~~~~~~~~  285 (297)
T 2zig_A          244 AGTGTTLIAAARWGRRALGVELVPRYAQLAKERFAREVPGFS  285 (297)
T ss_dssp             CTTTHHHHHHHHTTCEEEEEESCHHHHHHHHHHHHHHSTTCC
T ss_pred             CCCHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCC
T ss_conf             995599999998099599997799999999999998654444


No 4  
>1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11
Probab=100.00  E-value=0  Score=364.63  Aligned_cols=262  Identities=22%  Similarity=0.327  Sum_probs=185.4

Q ss_pred             CCCCHHHHCCCEECCCHHHHHHHCCCCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             32433553270851725998972841471189847787615587133367851300134435778989999988999999
Q gi|254780466|r   12 NQNSIFEWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLA   91 (375)
Q Consensus        12 ~~~~~~~~~nkI~~GDcl~~l~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e   91 (375)
                      +..-...-.|+||+|||+++|+.||++||||||||||||++.++..               + ..+..+|++|+.+|+.+
T Consensus         6 ~~~~~~~~~~~l~~GD~l~~l~~L~~~sVdlIytDPPYn~~~~~~~---------------~-~~~~~~y~~~~~~~~~~   69 (323)
T 1boo_A            6 KKPAYTTSNGSMYIGDSLELLESFPEESISLVMTSPPFALQRKKEY---------------G-NLEQHEYVDWFLSFAKV   69 (323)
T ss_dssp             SCCSEECSSEEEEESCHHHHGGGSCSSCEEEEEECCCCSSSCSCSS---------------C-SCHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCCCEEEECCHHHHHHHCCCCCCCEEEECCCCCCCCCCCC---------------C-CCCHHHHHHHHHHHHHH
T ss_conf             7863008998699662899986270489798998999857776778---------------9-98999999999999999


Q ss_pred             HHHHCCCCCEEEEECCH-----------HHHHHHHHHHHHCCCCEEEEEEEECCCCCCCC------CCCCCCCCHHHHHH
Q ss_conf             99863968729998346-----------88899998764057860124687315677775------77517654021322
Q gi|254780466|r   92 CRRVLKPNGTLWVIGSY-----------HNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF------RGRRFQNAHETLIW  154 (375)
Q Consensus        92 ~~RvLK~~Gsi~v~~~~-----------~~i~~i~~~l~~~gf~~~n~IIW~K~n~~pn~------~g~r~~~~hE~iiw  154 (375)
                      ++|+||++|+++++++.           +..+.....+...|+.+...++|.+.++++..      ....+..++|.++|
T Consensus        70 ~~rvLk~~g~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  149 (323)
T 1boo_A           70 VNKKLKPDGSFVVDFGGAYMKGVPARSIYNFRVLIRMIDEVGFFLAEDFYWFNPSKLPSPIEWVNKRKIRVKDAVNTVWW  149 (323)
T ss_dssp             HHHHEEEEEEEEEEECCCEETTEEEECCHHHHHHHHHHHTTCCEEEEEEEEECSSCTTSCTCCCCCTCCSCCCCEEEEEE
T ss_pred             HHHHCCCCCCEEECCCCHHHCCCCCCCCHHHHHHHHHHHHCCCEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCEEE
T ss_conf             99854657864422420221265411002367787777624857731256624778764221235445544445442465


Q ss_pred             HHCCCCCCCCEECCCCCCC---------CCCCEEEC-------------------------CCCCCCCCCCCCC---CCC
Q ss_conf             1005666650234100112---------37980104-------------------------6542210258541---457
Q gi|254780466|r  155 ASPSPKAKGYTFNYDALKA---------ANEDVQMR-------------------------SDWLIPICSGSER---LRN  197 (375)
Q Consensus       155 ~~K~~~~k~y~fny~~~k~---------~n~~~~~~-------------------------s~w~~pi~~g~er---~k~  197 (375)
                      ..++....   ++......         .......+                         +.+.+........   ...
T Consensus       150 ~~k~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  226 (323)
T 1boo_A          150 FSKTEWPK---SDITKVLAPYSDRMKKLIEDPDKFYTPKTRPSGHDIGKSFSKDNGGSIPPNLLQISNSESNGQYLANCK  226 (323)
T ss_dssp             EESSSSCC---CCGGGSCC--------------------------------------CCCCSEEECCSCSCCHHHHHHHH
T ss_pred             ECCCCCCC---CCCCCCCCCCCCCHHCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCC
T ss_conf             13555445---664333443220010012456302146566554554540233457765544433455677741332123


Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHCCCCCHHHHC
Q ss_conf             78753368778189999999852899888998688851799999980981699972899999999999630568765630
Q gi|254780466|r  198 KDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELT  277 (375)
Q Consensus       198 ~~g~k~HPTqKP~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~~~~~~~~~  277 (375)
                      ..+.+.||||||++|++|||+++|+|||+|||||||||||++||++|||+|||||++++|+++|.+||++......+.+.
T Consensus       227 ~~~~~~hpt~KP~~L~~~lI~~~s~~gdiVLDpF~GSGTT~~aa~~lgR~~Ig~El~~~y~~~a~~Rl~~~~~~~~~~~~  306 (323)
T 1boo_A          227 LMGIKAHPARFPAKLPEFFIRMLTEPDDLVVDIFGGSNTTGLVAERESRKWISFEMKPEYVAASAFRFLDNNISEEKITD  306 (323)
T ss_dssp             HTTCCCCSSCCCTHHHHHHHHHHCCTTCEEEETTCTTCHHHHHHHHTTCEEEEEESCHHHHHHHHGGGSCSCSCHHHHHH
T ss_pred             CCCCCCCCCCCCCHHHHHHEEEECCCCCEEEECCCCCCHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHCCCCHHHHHH
T ss_conf             45676677767715542311131799999997999986899999981992899978999999999998764312899999


Q ss_pred             CCCCCCCCCCCCHHH
Q ss_conf             244433377552346
Q gi|254780466|r  278 VLTGKRTEPRVAFNL  292 (375)
Q Consensus       278 ~~~~~~~~~rvpfg~  292 (375)
                      .....+......|.+
T Consensus       307 ~~~~~~~~~~~~~~~  321 (323)
T 1boo_A          307 IYNRILNGESLDLNS  321 (323)
T ss_dssp             HHHHHHTTCCEETTC
T ss_pred             HHHHHCCCCCCCCCC
T ss_conf             999751555578012


No 5  
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile}
Probab=98.42  E-value=4.9e-07  Score=61.58  Aligned_cols=68  Identities=25%  Similarity=0.380  Sum_probs=55.7

Q ss_pred             CCCCCCCCHHHHHHHHHHCC-CCCCEEEECCCCCHHHHHHHHHHC-----------------------------------
Q ss_conf             33687781899999998528-998889986888517999999809-----------------------------------
Q gi|254780466|r  202 KLHPTQKPEALLSRILVSST-KPGDIILDPFFGSGTSGAVAKKLR-----------------------------------  245 (375)
Q Consensus       202 k~HPTqKP~~LleriI~~~S-~~gDiVLDPF~GSGTT~~aA~~lg-----------------------------------  245 (375)
                      ..|+++-.+.|..-+|..+. ++++.|+||||||||-++-|..+.                                   
T Consensus       173 ~~~~ApLretLAaall~l~~~~~~~~l~DPmCGSGTilIEAal~a~~~~pg~~r~f~f~~~~~~~~~~w~~~~~~~~~~~  252 (385)
T 3ldu_A          173 KANKAPIRETLAAGLIYLTPWKAGRVLVDPMCGSGTILIEAAMIGINMAPGLNREFISEKWRTLDKKIWWDVRKDAFNKI  252 (385)
T ss_dssp             C--CCCCCHHHHHHHHHTSCCCTTSCEEETTCTTCHHHHHHHHHHTTCCTTTTSCCGGGGCTTSCHHHHHHHHHHHHHHS
T ss_pred             CCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCHHHHHHHCCCHHHHHHHHHHHHHHH
T ss_conf             67878877999999999637889985578889956799999999808797756223443221268899999999998632


Q ss_pred             -----CEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             -----816999728999999999996305
Q gi|254780466|r  246 -----RSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       246 -----R~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                           =+.+|.|+|+..++.|+.-++..-
T Consensus       253 ~~~~~~~i~g~D~d~~~i~~a~~N~~~ag  281 (385)
T 3ldu_A          253 DNESKFKIYGYDIDEESIDIARENAEIAG  281 (385)
T ss_dssp             CCSCCCCEEEEESCHHHHHHHHHHHHHHT
T ss_pred             CCCCCCCEEEECCCHHHHHHHHHHHHHCC
T ss_conf             04667867996587889999999999739


No 6  
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes}
Probab=98.37  E-value=8.5e-07  Score=60.14  Aligned_cols=108  Identities=14%  Similarity=0.244  Sum_probs=69.9

Q ss_pred             HHCC--CEECCCHHHHHHHCCCCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             5327--08517259989728414711898477876155871333678513001344357789899999889999999986
Q gi|254780466|r   18 EWKD--KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRV   95 (375)
Q Consensus        18 ~~~n--kI~~GDcl~~l~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~Rv   95 (375)
                      .+.+  .+++||..+....++++++|+|+++|||.-..+......+...         .. .-.+......+|+..+.++
T Consensus        96 ~l~~~v~~~~~D~~~~~~~~~~~~fD~Iv~NPPy~~~~~~~~~~~~~~~---------~~-ar~~~~~~l~~~i~~a~~l  165 (259)
T 3lpm_A           96 QLEDQIEIIEYDLKKITDLIPKERADIVTCNPPYFATPDTSLKNTNEHF---------RI-ARHEVMCTLEDTIRVAASL  165 (259)
T ss_dssp             TCTTTEEEECSCGGGGGGTSCTTCEEEEEECCCC---------------------------------HHHHHHHHHHHHH
T ss_pred             CCCHHHEEEEHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCHHH---------HH-CCCCCCCCHHHHHHHHHHH
T ss_conf             7330112330011100010355425478857885368730226823555---------32-1335544899999999986


Q ss_pred             CCCCCEEEEECCHHHHHHHHHHHHHCCCCEEE-EEEEECCC
Q ss_conf             39687299983468889999876405786012-46873156
Q gi|254780466|r   96 LKPNGTLWVIGSYHNIFRIGTMLQNLNFWILN-DIVWRKSN  135 (375)
Q Consensus        96 LK~~Gsi~v~~~~~~i~~i~~~l~~~gf~~~n-~IIW~K~n  135 (375)
                      ||++|.++++........+..++...||.... ..||-+.+
T Consensus       166 Lk~~G~~~~~~~~~rl~ei~~~~~~~gl~~~~i~~V~~~~~  206 (259)
T 3lpm_A          166 LKQGGKANFVHRPERLLDIIDIMRKYRLEPKRIQFVHPRSD  206 (259)
T ss_dssp             EEEEEEEEEEECTTTHHHHHHHHHHTTEEEEEEEEEESSTT
T ss_pred             CCCCCEEEEEECHHHHHHHHHHHHHCCCEEEEEEEECCCCC
T ss_conf             28996899998889999999999977997899998117997


No 7  
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransferase posttranslational modification; 1.59A {Thermus thermophilus HB8} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A*
Probab=98.36  E-value=5.7e-07  Score=61.17  Aligned_cols=63  Identities=27%  Similarity=0.343  Sum_probs=55.5

Q ss_pred             CCCCCCCHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHC
Q ss_conf             368778189999999852899888998688851799999980981699972899999999999630
Q gi|254780466|r  203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASV  268 (375)
Q Consensus       203 ~HPTqKP~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~  268 (375)
                      .|||.   .|+-+.+.....+|+.|||..||||..+++|.++|.+.+|+|+|+.+++.|+++.+.-
T Consensus       103 ~H~TT---~l~l~~l~~~~~~g~~VLDvGcGsGiLsi~aak~G~~V~aiDid~~av~~a~~N~~~N  165 (254)
T 2nxc_A          103 HHETT---RLALKALARHLRPGDKVLDLGTGSGVLAIAAEKLGGKALGVDIDPMVLPQAEANAKRN  165 (254)
T ss_dssp             CSHHH---HHHHHHHHHHCCTTCEEEEETCTTSHHHHHHHHTTCEEEEEESCGGGHHHHHHHHHHT
T ss_pred             CCHHH---HHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHH
T ss_conf             98899---9999999841799798999717778889999845998999988727889999989970


No 8  
>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structural genomics; 1.50A {Listeria monocytogenes str}
Probab=98.35  E-value=1.1e-06  Score=59.49  Aligned_cols=68  Identities=21%  Similarity=0.308  Sum_probs=56.5

Q ss_pred             CCCCCCCHHHHHHHHHHCC-CCCCEEEECCCCCHHHHHHHHHH-------------------------------------
Q ss_conf             3687781899999998528-99888998688851799999980-------------------------------------
Q gi|254780466|r  203 LHPTQKPEALLSRILVSST-KPGDIILDPFFGSGTSGAVAKKL-------------------------------------  244 (375)
Q Consensus       203 ~HPTqKP~~LleriI~~~S-~~gDiVLDPF~GSGTT~~aA~~l-------------------------------------  244 (375)
                      .|+++--+.|..=++..+. ++++.++||||||||-++-|..+                                     
T Consensus       180 ~~~ApLrEtLAaalL~la~~~~~~~llDPmCGSGTilIEAAl~a~~~~pg~~R~f~f~~~~~~~~~~w~~~~~~a~~~~~  259 (393)
T 3k0b_A          180 QGSAPIKETMAAALVLLTSWHPDRPFYDPVCGSGTIPIEAALIGQNIAPGFNREFVSETWDWMPKQVWADARQEAEDLAN  259 (393)
T ss_dssp             SCSCSCCHHHHHHHHHHSCCCTTSCEEETTCTTSHHHHHHHHHHTTCCTTTTSCCGGGGCTTSCHHHHHHHHHHHHHHCC
T ss_pred             CCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCHHHHHCCCCCHHHHHHHHHHHHHHHC
T ss_conf             78888758999999997377899833067899667999999997387888662435442246899999999999875430


Q ss_pred             ---CCEEEEEEECHHHHHHHHHHHHHCCC
Q ss_conf             ---98169997289999999999963056
Q gi|254780466|r  245 ---RRSFIGIEMKQDYIDIATKRIASVQP  270 (375)
Q Consensus       245 ---gR~~IGiE~~~~Y~~~a~~Rl~~~~~  270 (375)
                         .-++||.|+|+..++.|+.-+++.--
T Consensus       260 ~~~~~~i~g~D~d~~ai~~a~~N~~~ag~  288 (393)
T 3k0b_A          260 YDQPLNIIGGDIDARLIEIAKQNAVEAGL  288 (393)
T ss_dssp             TTCCCCEEEEESCHHHHHHHHHHHHHTTC
T ss_pred             CCCCCCEEEEECCHHHHHHHHHHHHHCCC
T ss_conf             58876389995989999999999997387


No 9  
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structural genomics; HET: SAH; 2.20A {Pyrococcus horikoshii OT3} SCOP: c.66.1.32
Probab=98.18  E-value=4.5e-06  Score=55.73  Aligned_cols=63  Identities=19%  Similarity=0.298  Sum_probs=50.4

Q ss_pred             CCCHHHHHHHHHHC----CCCCCEEEECCCCCHHHHHHHHHHC-CEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             78189999999852----8998889986888517999999809-816999728999999999996305
Q gi|254780466|r  207 QKPEALLSRILVSS----TKPGDIILDPFFGSGTSGAVAKKLR-RSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       207 qKP~~LleriI~~~----S~~gDiVLDPF~GSGTT~~aA~~lg-R~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      +-|..+..+++...    .-+|..|||+|||||..+++|...| .+.+|+|+++..++.|++.++...
T Consensus        29 ~Tp~~ia~~~~~~a~~~~dl~g~~vlDlg~G~G~l~i~a~~~g~~~v~~vDid~~~~~~a~~N~~~~~   96 (207)
T 1wy7_A           29 RTPGNAASELLWLAYSLGDIEGKVVADLGAGTGVLSYGALLLGAKEVICVEVDKEAVDVLIENLGEFK   96 (207)
T ss_dssp             CCCHHHHHHHHHHHHHTTSSTTCEEEEETCTTCHHHHHHHHTTCSEEEEEESCHHHHHHHHHHTGGGT
T ss_pred             CCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCCHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHCC
T ss_conf             99999999999999864987989899913425699999997499869998798999999999999839


No 10 
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus}
Probab=98.13  E-value=1e-05  Score=53.53  Aligned_cols=62  Identities=15%  Similarity=0.349  Sum_probs=54.7

Q ss_pred             CCHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             81899999998528998889986888517999999809816999728999999999996305
Q gi|254780466|r  208 KPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       208 KP~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      -|.++...++.-.-+|||+|||-.||+|..+....+.+.+-+|+|++++.++.|+++.+...
T Consensus         7 ~~~~~~~~~l~~~l~~~~~VLD~gcG~G~~t~~LA~~~~~V~aiDis~~al~~a~~n~~~~~   68 (185)
T 3mti_A            7 RPIHMSHDFLAEVLDDESIVVDATMGNGNDTAFLAGLSKKVYAFDVQEQALGKTSQRLSDLG   68 (185)
T ss_dssp             CHHHHHHHHHHTTCCTTCEEEESCCTTSHHHHHHHTTSSEEEEEESCHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHHCCCCCEEEEEEEECCHHHHHHHHCCCEEEECCCCHHHHHHHHHHHHHCC
T ss_conf             37999999999658999999999638889999998269989975898788878999999829


No 11 
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A*
Probab=98.11  E-value=1.1e-05  Score=53.37  Aligned_cols=60  Identities=22%  Similarity=0.280  Sum_probs=48.8

Q ss_pred             CHHHHHHHHH--HCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHC
Q ss_conf             1899999998--52899888998688851799999980981699972899999999999630
Q gi|254780466|r  209 PEALLSRILV--SSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASV  268 (375)
Q Consensus       209 P~~LleriI~--~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~  268 (375)
                      |+.+.+.+..  ....+++.|||.|||+|+-++++.+.|.+.+|+|++++.++.|+++.+..
T Consensus        62 pe~ia~~ia~~~~~~~~~~~vlD~gcG~G~~~~~la~~~~~v~~iD~s~~~i~~a~~n~~~~  123 (241)
T 3gdh_A           62 PEKIAEHIAGRVSQSFKCDVVVDAFCGVGGNTIQFALTGMRVIAIDIDPVKIALARNNAEVY  123 (241)
T ss_dssp             CHHHHHHHHHHHHHHSCCSEEEETTCTTSHHHHHHHHTTCEEEEEESCHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHC
T ss_conf             69999999998650289998999378736889999967998999989778889999999984


No 12 
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus HB8} SCOP: c.66.1.46
Probab=98.08  E-value=8.7e-06  Score=53.99  Aligned_cols=54  Identities=20%  Similarity=0.246  Sum_probs=47.2

Q ss_pred             HHHHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             998528998889986888517999999809816999728999999999996305
Q gi|254780466|r  216 ILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       216 iI~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      ++...-.+|..|||+|||||+.+++|...|-+.+++|+|++.++.+++-++...
T Consensus        34 ~l~~~~~~~~~vLDl~~G~G~~~i~a~~~ga~vv~vD~~~~ai~~~~~N~~~~g   87 (171)
T 1ws6_A           34 YLRLRYPRRGRFLDPFAGSGAVGLEAASEGWEAVLVEKDPEAVRLLKENVRRTG   87 (171)
T ss_dssp             HHHHHCTTCCEEEEETCSSCHHHHHHHHTTCEEEEECCCHHHHHHHHHHHHHHT
T ss_pred             HHHCCCCCCCEEEECCCCHHHHHHHHHHCCCCCCCEECCHHHHHHHHHHHHHCC
T ss_conf             973645797989996206789999999808953006068789999998788606


No 13 
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics, protein structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405}
Probab=98.05  E-value=1.6e-05  Score=52.39  Aligned_cols=58  Identities=19%  Similarity=0.335  Sum_probs=47.1

Q ss_pred             HHHHHHHHCCCCCCEEEECCCCCHHHH-HHHHHHCC--EEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             999999852899888998688851799-99998098--16999728999999999996305
Q gi|254780466|r  212 LLSRILVSSTKPGDIILDPFFGSGTSG-AVAKKLRR--SFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       212 LleriI~~~S~~gDiVLDPF~GSGTT~-~aA~~lgR--~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      =-..+|..+-+||+.|||..||+|..+ ..|.+++.  +.+|+|++++.++.|++|+....
T Consensus        11 ~~~~~l~~~ik~G~~VLDlGcG~G~~t~~la~~~~~~~~V~giDis~~~l~~ar~~~~~~g   71 (197)
T 3eey_A           11 QSHDYIKMFVKEGDTVVDATCGNGNDTAFLASLVGENGRVFGFDIQDKAIANTTKKLTDLN   71 (197)
T ss_dssp             HHHHHHHHHCCTTCEEEESCCTTSHHHHHHHHHHCTTCEEEEECSCHHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHHCCCCCEEEEEEEECCHHHHHHHHHHCCCEEEEEEECCHHHHHHHHHHHHHCC
T ss_conf             9999999858999999999204889999999983898199999738899899999999839


No 14 
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} SCOP: c.66.1.47 PDB: 3k6r_A 3a25_A* 3a26_A*
Probab=98.02  E-value=1.6e-05  Score=52.36  Aligned_cols=52  Identities=19%  Similarity=0.256  Sum_probs=43.5

Q ss_pred             HHCCCCCCEEEECCCCCHHHHHHHHHHC-CEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             8528998889986888517999999809-816999728999999999996305
Q gi|254780466|r  218 VSSTKPGDIILDPFFGSGTSGAVAKKLR-RSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       218 ~~~S~~gDiVLDPF~GSGTT~~aA~~lg-R~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      .....+|+.|||+|||+|..++.|.+.| .+.+++|+|+..++.+++.++.-.
T Consensus       120 ~~~~~~g~~VlDl~aG~G~~~l~~a~~~~~~V~avD~n~~a~~~~~~N~~~n~  172 (278)
T 2frn_A          120 AKVAKPDELVVDMFAGIGHLSLPIAVYGKAKVIAIEKDPYTFKFLVENIHLNK  172 (278)
T ss_dssp             HHHCCTTCEEEETTCTTTTTHHHHHHHTCCEEEEECCCHHHHHHHHHHHHHTT
T ss_pred             HHHCCCCCEEEECCCCCCHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHC
T ss_conf             96536998899917705199999999749869999799999999999999809


No 15 
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175, PSI-2; HET: MSE; 1.70A {Agrobacterium tumefaciens str}
Probab=97.99  E-value=1.3e-05  Score=53.01  Aligned_cols=91  Identities=16%  Similarity=0.323  Sum_probs=54.7

Q ss_pred             CEECCCHH-----HHHHHCCCCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             08517259-----9897284147118984778761558713336785130013443577898999998899999999863
Q gi|254780466|r   22 KIIKGNSI-----SVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVL   96 (375)
Q Consensus        22 kI~~GDcl-----~~l~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvL   96 (375)
                      ++++||..     .....++++++|+|++.|||.-.....  .++.....          ...+...-..+|+..+.++|
T Consensus        93 ~~~~~Di~~~~~~~~~~~~~~~~fD~VvsNPPY~~~~~~~--~~~~~~~~----------a~~~~~~~l~~~i~~a~~lL  160 (260)
T 2ozv_A           93 EVLEADVTLRAKARVEAGLPDEHFHHVIMNPPYNDAGDRR--TPDALKAE----------AHAMTEGLFEDWIRTASAIM  160 (260)
T ss_dssp             EEEECCTTCCHHHHHHTTCCTTCEEEEEECCCC---------------------------------CCHHHHHHHHHHHE
T ss_pred             EEEECHHHCCCHHHHHHHHCCCCCCEEEECCCCCCCCCCC--CCCHHHHH----------HHHHCCCCHHHHHHHHHHHC
T ss_conf             5896332132212344331367626798669844666566--87767788----------77504688999999999972


Q ss_pred             CCCCEEEEECCHHHHHHHHHHHHHCCCCE
Q ss_conf             96872999834688899998764057860
Q gi|254780466|r   97 KPNGTLWVIGSYHNIFRIGTMLQNLNFWI  125 (375)
Q Consensus        97 K~~Gsi~v~~~~~~i~~i~~~l~~~gf~~  125 (375)
                      |++|.++++........+..+|.. .|+.
T Consensus       161 kpgG~l~~i~~~~rl~eil~~l~~-~~~~  188 (260)
T 2ozv_A          161 VSGGQLSLISRPQSVAEIIAACGS-RFGG  188 (260)
T ss_dssp             EEEEEEEEEECGGGHHHHHHHHTT-TEEE
T ss_pred             CCCCEEEEEECHHHHHHHHHHHHC-CCCC
T ss_conf             889899999878889999999867-8997


No 16 
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis V583} SCOP: c.66.1.46
Probab=97.95  E-value=4.6e-05  Score=49.61  Aligned_cols=72  Identities=24%  Similarity=0.312  Sum_probs=54.1

Q ss_pred             CCCCCCCCCCCCCHHHHHHH--HHHCCCCCCEEEECCCCCHHHHHHHHHHC-CEEEEEEECHHHHHHHHHHHHHCCC
Q ss_conf             77875336877818999999--98528998889986888517999999809-8169997289999999999963056
Q gi|254780466|r  197 NKDGEKLHPTQKPEALLSRI--LVSSTKPGDIILDPFFGSGTSGAVAKKLR-RSFIGIEMKQDYIDIATKRIASVQP  270 (375)
Q Consensus       197 ~~~g~k~HPTqKP~~Lleri--I~~~S~~gDiVLDPF~GSGTT~~aA~~lg-R~~IGiE~~~~Y~~~a~~Rl~~~~~  270 (375)
                      ..++..+.||.  ..+-|-+  ++....+|..|||.|+|||.-+..|..-| .+.+++|.|++.++.+++-++....
T Consensus        18 ~~~~~~~RPt~--~~vrealfn~l~~~~~~~~vLDlf~GsG~~~~ea~srGa~~v~~Ve~~~~~~~~~~~N~~~~~~   92 (187)
T 2fhp_A           18 ALDGDNTRPTT--DKVKESIFNMIGPYFDGGMALDLYSGSGGLAIEAVSRGMDKSICIEKNFAALKVIKENIAITKE   92 (187)
T ss_dssp             CCCCCSSCCCC--HHHHHHHHHHHCSCCSSCEEEETTCTTCHHHHHHHHTTCSEEEEEESCHHHHHHHHHHHHHHTC
T ss_pred             CCCCCCCCCCC--HHHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHCCCCEEEEEEECHHHHHHHHHHHHHCCC
T ss_conf             89989958781--8999999998651159998999888737899999975888358999424677676655542024


No 17 
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii}
Probab=97.87  E-value=4.3e-05  Score=49.75  Aligned_cols=53  Identities=15%  Similarity=0.169  Sum_probs=42.8

Q ss_pred             HHHCCCCCCEEEECCCCCHHHHHHHHHH--CCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             9852899888998688851799999980--9816999728999999999996305
Q gi|254780466|r  217 LVSSTKPGDIILDPFFGSGTSGAVAKKL--RRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       217 I~~~S~~gDiVLDPF~GSGTT~~aA~~l--gR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      |...-.+|+.|||+|||+|.-++.+.+.  +.+.+++|+|++.++.+++.++.-.
T Consensus       113 i~~~v~~ge~VlDl~aG~G~~~i~~ak~~~~~~V~aiDinp~av~~l~~N~~~N~  167 (272)
T 3a27_A          113 MAFISNENEVVVDMFAGIGYFTIPLAKYSKPKLVYAIEKNPTAYHYLCENIKLNK  167 (272)
T ss_dssp             HHTSCCTTCEEEETTCTTTTTHHHHHHHTCCSEEEEEECCHHHHHHHHHHHHHTT
T ss_pred             HHHCCCCCCEEEEECCCCCHHHHHHHHCCCCEEEEEEECCHHHHHHHHHHHHHCC
T ss_conf             8734589999999378658899998750695099999599999999999999849


No 18 
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 2zzm_A*
Probab=97.85  E-value=3.1e-05  Score=50.66  Aligned_cols=52  Identities=19%  Similarity=0.385  Sum_probs=43.8

Q ss_pred             HHHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             98528998889986888517999999809816999728999999999996305
Q gi|254780466|r  217 LVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       217 I~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      |.....+|+.|||+|||+|+.+++|.+ +.+-+++|+|+..++.+++.++.-.
T Consensus       189 i~~~~~~~~~vlD~f~g~G~~~i~~~~-~~~v~a~d~n~~a~~~~~~N~~~N~  240 (336)
T 2yx1_A          189 IMKKVSLNDVVVDMFAGVGPFSIACKN-AKKIYAIDINPHAIELLKKNIKLNK  240 (336)
T ss_dssp             HHHHCCTTCEEEETTCTTSHHHHHTTT-SSEEEEEESCHHHHHHHHHHHHHTT
T ss_pred             HHHHCCCCCEEEEECCCCCHHHHHCCC-CCEEEEEECCHHHHHHHHHHHHHHC
T ss_conf             664117898899965764676653135-5169999799999999999999829


No 19 
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, NYSGXRC, structural genomics; 2.00A {Lactobacillus delbrueckii subsp}
Probab=97.84  E-value=3.7e-05  Score=50.16  Aligned_cols=62  Identities=21%  Similarity=0.170  Sum_probs=52.4

Q ss_pred             CCCCCCCHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHC-CEEEEEEECHHHHHHHHHHHHH
Q ss_conf             3687781899999998528998889986888517999999809-8169997289999999999963
Q gi|254780466|r  203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLR-RSFIGIEMKQDYIDIATKRIAS  267 (375)
Q Consensus       203 ~HPTqKP~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~lg-R~~IGiE~~~~Y~~~a~~Rl~~  267 (375)
                      .|||.   .|+-+.+...-.+|..|||..||||..+.++.+.| .+.+|+|+|++.++.|++.++.
T Consensus        43 ~H~tT---~l~l~~L~~~~~~~~~VLDlGcGsG~~~~~~ak~g~~~V~~iDis~~al~~A~~N~~~  105 (205)
T 3grz_A           43 NHQTT---QLAMLGIERAMVKPLTVADVGTGSGILAIAAHKLGAKSVLATDISDESMTAAEENAAL  105 (205)
T ss_dssp             CHHHH---HHHHHHHHHHCSSCCEEEEETCTTSHHHHHHHHTTCSEEEEEESCHHHHHHHHHHHHH
T ss_pred             CCHHH---HHHHHHHHHCCCCCCEEEEEECCHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHH
T ss_conf             88899---9999999834799599999952622999999875996899998989999999999997


No 20 
>2esr_A Methyltransferase; structural genomics, hypothetical protein, PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes MGAS10394} SCOP: c.66.1.46
Probab=97.84  E-value=5.8e-05  Score=49.00  Aligned_cols=71  Identities=23%  Similarity=0.264  Sum_probs=51.3

Q ss_pred             CCCCCCCCCCCC--HHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHC-CEEEEEEECHHHHHHHHHHHHHCCC
Q ss_conf             787533687781--899999998528998889986888517999999809-8169997289999999999963056
Q gi|254780466|r  198 KDGEKLHPTQKP--EALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLR-RSFIGIEMKQDYIDIATKRIASVQP  270 (375)
Q Consensus       198 ~~g~k~HPTqKP--~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~lg-R~~IGiE~~~~Y~~~a~~Rl~~~~~  270 (375)
                      .++.-.+||.--  ++|+..  +...-+|..|||.|+|||..++.|...| .+.+++|+|++.++++++.++....
T Consensus         6 ~~~~~~RPt~~~vre~lfn~--L~~~~~g~~vLDl~~GsG~~~iea~~r~a~~v~~ve~~~~a~~~~~~n~~~~~~   79 (177)
T 2esr_A            6 LDGKITRPTSDKVRGAIFNM--IGPYFNGGRVLDLFAGSGGLAIEAVSRGMSAAVLVEKNRKAQAIIQDNIIMTKA   79 (177)
T ss_dssp             ------------CHHHHHHH--HCSCCCSCEEEEETCTTCHHHHHHHHTTCCEEEEECCCHHHHHHHHHHHHTTTC
T ss_pred             CCCCCCCCCCHHHHHHHHHH--HHHHCCCCEEEECCEEHHHHHHHHHHCCCCCCEEEECHHHHHHHHHHHHHHHCC
T ss_conf             99898786848999999998--775569897999950379999999973862016783428899988875765135


No 21 
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32
Probab=97.80  E-value=6.3e-05  Score=48.76  Aligned_cols=65  Identities=20%  Similarity=0.264  Sum_probs=50.4

Q ss_pred             CCCCCCHHHHHHHHH----HCCCCCCEEEECCCCCHHHHHHHHHHC-CEEEEEEECHHHHHHHHHHHHHCCC
Q ss_conf             687781899999998----528998889986888517999999809-8169997289999999999963056
Q gi|254780466|r  204 HPTQKPEALLSRILV----SSTKPGDIILDPFFGSGTSGAVAKKLR-RSFIGIEMKQDYIDIATKRIASVQP  270 (375)
Q Consensus       204 HPTqKP~~LleriI~----~~S~~gDiVLDPF~GSGTT~~aA~~lg-R~~IGiE~~~~Y~~~a~~Rl~~~~~  270 (375)
                      |+|  |-.+..+++.    .-.-+|..|||++||||.-+++|..+| ++-+|+|+|++.++.|++.+.++.-
T Consensus        30 Y~t--~~~iaa~~~~~~~~~gd~~Gk~VLDlGcGtG~l~i~a~~~ga~~V~~vDid~~a~~~a~~N~~~~~~   99 (200)
T 1ne2_A           30 YPT--DASTAAYFLIEIYNDGNIGGRSVIDAGTGNGILACGSYLLGAESVTAFDIDPDAIETAKRNCGGVNF   99 (200)
T ss_dssp             CCC--CHHHHHHHHHHHHHHTSSBTSEEEEETCTTCHHHHHHHHTTBSEEEEEESCHHHHHHHHHHCTTSEE
T ss_pred             CCC--CHHHHHHHHHHHHHCCCCCCCEEEECCCCHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHCCC
T ss_conf             799--8899999999998669989398998757510999999967998796750899999999998985785


No 22 
>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45
Probab=97.80  E-value=6.1e-05  Score=48.86  Aligned_cols=61  Identities=23%  Similarity=0.331  Sum_probs=46.2

Q ss_pred             CCCCCCHHHHHHHHHHC-CCCCCEEEECCCCCHHHHHHHHHH--------------------CCEEEEEEECHHHHHHHH
Q ss_conf             68778189999999852-899888998688851799999980--------------------981699972899999999
Q gi|254780466|r  204 HPTQKPEALLSRILVSS-TKPGDIILDPFFGSGTSGAVAKKL--------------------RRSFIGIEMKQDYIDIAT  262 (375)
Q Consensus       204 HPTqKP~~LleriI~~~-S~~gDiVLDPF~GSGTT~~aA~~l--------------------gR~~IGiE~~~~Y~~~a~  262 (375)
                      |-|+.  .+.+.++... ..+|+.|+||.||||+.+++|.+.                    ...++|+|+++.-+.+|.
T Consensus       151 ffTP~--~Iv~~mv~ll~p~~~~~I~DPacGsG~fL~~a~~~l~~~~~~~~~~~~~~~~~~~~~~~~G~E~~~~~~~la~  228 (541)
T 2ar0_A          151 YFTPR--PLIKTIIHLLKPQPREVVQDPAAGTAGFLIEADRYVKSQTNDLDDLDGDTQDFQIHRAFIGLELVPGTRRLAL  228 (541)
T ss_dssp             CCCCH--HHHHHHHHHHCCCTTCCEEETTCTTTHHHHHHHHHHHTTTTTTTTSCHHHHHHHHHTSEEEEESCHHHHHHHH
T ss_pred             ECCCH--HHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHCCHHHHHHHH
T ss_conf             67989--9999999862899887304657785605799999999843662111046788888766630206699999998


Q ss_pred             HHHH
Q ss_conf             9996
Q gi|254780466|r  263 KRIA  266 (375)
Q Consensus       263 ~Rl~  266 (375)
                      -.+-
T Consensus       229 ~nl~  232 (541)
T 2ar0_A          229 MNCL  232 (541)
T ss_dssp             HHHH
T ss_pred             HHHH
T ss_conf             6466


No 23 
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4
Probab=97.75  E-value=8.8e-05  Score=47.90  Aligned_cols=54  Identities=20%  Similarity=0.196  Sum_probs=46.6

Q ss_pred             HHHHC-CCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             99852-8998889986888517999999809816999728999999999996305
Q gi|254780466|r  216 ILVSS-TKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       216 iI~~~-S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      ++... ..+++.|||..||||..++++.+.+.+.+|+|+|++.++.|+++++.-.
T Consensus        44 Ll~~l~~~~~~~vLDiGcG~G~~~~~la~~~~~v~~iDis~~~i~~a~~n~~~~~   98 (194)
T 1dus_A           44 LVENVVVDKDDDILDLGCGYGVIGIALADEVKSTTMADINRRAIKLAKENIKLNN   98 (194)
T ss_dssp             HHHHCCCCTTCEEEEETCTTSHHHHHHGGGSSEEEEEESCHHHHHHHHHHHHHTT
T ss_pred             HHHHCCCCCCCEEEEECCCCCHHHHHHHHHCCEEEEEECCHHHHHHHHHHHHHHC
T ss_conf             9982898899949995696429999999738847998263678899999999819


No 24 
>3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei}
Probab=97.75  E-value=6.3e-05  Score=48.78  Aligned_cols=61  Identities=20%  Similarity=0.196  Sum_probs=47.1

Q ss_pred             CCCCCCHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHH-----------------CCEEEEEEECHHHHHHHHHHHH
Q ss_conf             68778189999999852899888998688851799999980-----------------9816999728999999999996
Q gi|254780466|r  204 HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKL-----------------RRSFIGIEMKQDYIDIATKRIA  266 (375)
Q Consensus       204 HPTqKP~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~l-----------------gR~~IGiE~~~~Y~~~a~~Rl~  266 (375)
                      |-|+  ..+.+-++.......+.|+||.||||+.+++|.+.                 .-...|+|+++..+.+|+-++.
T Consensus       227 ffTP--~~Iv~lmv~ll~p~~~~I~DPacGsGgfLi~a~~~i~~~~~~~~~~~~~~~~~~~l~G~Ei~~~~~~la~~nm~  304 (544)
T 3khk_A          227 YYTP--KSIVTLIVEMLEPYKGRVYDPAMGSGGFFVSSDKFIEKHANVKHYNASEQKKQISVYGQESNPTTWKLAAMNMV  304 (544)
T ss_dssp             TCCC--HHHHHHHHHHHCCCSEEEEESSCTTCHHHHHHHHHHHHHHHHHTSCHHHHGGGEEEEECCCCHHHHHHHHHHHH
T ss_pred             ECCC--HHHHHHHHHCCCCCCCCEECCCCCCCHHHHHHHHHHHHHCCCCCCCCHHHHHHCEEECCCCCHHHHHHHHHHHH
T ss_conf             5481--89999998623899883703777761789999999998245222220222201106150387799999998898


No 25 
>3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus}
Probab=97.74  E-value=5.7e-05  Score=49.06  Aligned_cols=63  Identities=25%  Similarity=0.377  Sum_probs=48.7

Q ss_pred             CCCCCCH-HHHHHHHHHC--CCCCCEEEECCCCCHHHHHHHHHHCC-----EEEEEEECHHHHHHHHHHHH
Q ss_conf             6877818-9999999852--89988899868885179999998098-----16999728999999999996
Q gi|254780466|r  204 HPTQKPE-ALLSRILVSS--TKPGDIILDPFFGSGTSGAVAKKLRR-----SFIGIEMKQDYIDIATKRIA  266 (375)
Q Consensus       204 HPTqKP~-~LleriI~~~--S~~gDiVLDPF~GSGTT~~aA~~lgR-----~~IGiE~~~~Y~~~a~~Rl~  266 (375)
                      |-|+.++ .|+-.++...  .++|+.|+||.||||+.+++|.+.-+     .+.|.|+++..+.+|+-++.
T Consensus       199 ~~TP~~Iv~lmv~l~~~~~~~~~~~~I~DPacGsGgfL~~a~~~~~~~~~~~~~G~e~~~~~~~la~~nl~  269 (542)
T 3lkd_A          199 FYTPQPVAKLMTQIAFLGREDKQGFTLYDATMGSGSLLLNAKRYSRQPQTVVYFGQELNTSTYNLARMNMI  269 (542)
T ss_dssp             CCCCHHHHHHHHHHHHTTCTTCTTCEEEETTCTTSTTGGGHHHHCSCTTTCEEEEEESCHHHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHCCCCCCCCCCCEEECCCCCCCHHHHHHHHHHHHHCCEEEEEEECCHHHHHHHHHHHH
T ss_conf             58988999857864255645678986832778845588988887750055578744266799999999878


No 26 
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A*
Probab=97.70  E-value=4.1e-05  Score=49.91  Aligned_cols=66  Identities=18%  Similarity=0.225  Sum_probs=53.8

Q ss_pred             CCCCCCHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHH--CCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             68778189999999852899888998688851799999980--9816999728999999999996305
Q gi|254780466|r  204 HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKL--RRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       204 HPTqKP~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~l--gR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      =|-+--+.|++..+.......-.|||..+|||.-+++..+.  +-+.+|+|++++.+++|++-+++..
T Consensus        90 IPRpeTE~lv~~~l~~~~~~~~~ilDlgtGsG~I~i~la~~~p~~~v~a~Dis~~Al~~A~~Na~~~~  157 (276)
T 2b3t_A           90 IPRPDTECLVEQALARLPEQPCRILDLGTGTGAIALALASERPDCEIIAVDRMPDAVSLAQRNAQHLA  157 (276)
T ss_dssp             CCCTTHHHHHHHHHHHSCSSCCEEEEETCTTSHHHHHHHHHCTTSEEEEECSSHHHHHHHHHHHHHHT
T ss_pred             CCCCHHHHHHHHHHHHCCCCCCEEEEECCCCHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHCC
T ss_conf             69976999999998751457861764146532999999986898758864176688999999999749


No 27 
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21
Probab=97.69  E-value=0.00037  Score=44.10  Aligned_cols=66  Identities=27%  Similarity=0.286  Sum_probs=52.0

Q ss_pred             CCCCCC--HHHHHHHHHHC-CCCCCEEEECCCCCHHHH-HHHHHHCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             687781--89999999852-899888998688851799-9999809816999728999999999996305
Q gi|254780466|r  204 HPTQKP--EALLSRILVSS-TKPGDIILDPFFGSGTSG-AVAKKLRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       204 HPTqKP--~~LleriI~~~-S~~gDiVLDPF~GSGTT~-~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      |.++.|  .+.+..++... -.||+-|||--||+|..+ .+|...|-+.+|+|+++..++.|++|++..-
T Consensus        14 ~~~~~P~~~~~~~~l~~~l~l~pg~rVLDiGcG~G~~~~~la~~~~~~v~gvD~s~~~l~~a~~~~~~~g   83 (256)
T 1nkv_A           14 HRIHNPFTEEKYATLGRVLRMKPGTRILDLGSGSGEMLCTWARDHGITGTGIDMSSLFTAQAKRRAEELG   83 (256)
T ss_dssp             CSSSSSCCHHHHHHHHHHTCCCTTCEEEEETCTTCHHHHHHHHHTCCEEEEEESCHHHHHHHHHHHHHTT
T ss_pred             CCCCCCCCHHHHHHHHHHCCCCCCCEEEEECCCCCHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHC
T ss_conf             4234888899999999970899999999985888889999998649989999898367789988677606


No 28 
>2f8l_A Hypothetical protein LMO1582; 16411011, structural genomics, PSI, protein structure initiative, joint center for structural genomics; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45
Probab=97.68  E-value=0.0001  Score=47.48  Aligned_cols=65  Identities=18%  Similarity=0.188  Sum_probs=46.0

Q ss_pred             CCCCCCHH-HHHHHHHH--CCCCCCEEEECCCCCHHHHHHHHH-H------CCEEEEEEECHHHHHHHHHHHHHC
Q ss_conf             68778189-99999985--289988899868885179999998-0------981699972899999999999630
Q gi|254780466|r  204 HPTQKPEA-LLSRILVS--STKPGDIILDPFFGSGTSGAVAKK-L------RRSFIGIEMKQDYIDIATKRIASV  268 (375)
Q Consensus       204 HPTqKP~~-LleriI~~--~S~~gDiVLDPF~GSGTT~~aA~~-l------gR~~IGiE~~~~Y~~~a~~Rl~~~  268 (375)
                      |-|+.++. |+-.++..  -.++++.||||+||||+.++++.+ +      .-+.+|+|+++..+.+|+..+.-.
T Consensus       108 ~~TP~~i~~~m~~l~~~~~~~~~~~~vlDp~cGsG~~l~~~~~~l~~~~~~~~~~~g~di~~~~~~~a~~n~~~~  182 (344)
T 2f8l_A          108 QMTPDSIGFIVAYLLEKVIQKKKNVSILDPACGTANLLTTVINQLELKGDVDVHASGVDVDDLLISLALVGADLQ  182 (344)
T ss_dssp             CCCCHHHHHHHHHHHHHHHTTCSEEEEEETTCTTSHHHHHHHHHHHTTSSCEEEEEEEESCHHHHHHHHHHHHHH
T ss_pred             ECCCHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCHHHHHHHHHHHHCCCCCEEEEEEECCHHHHHHHHHCCCCC
T ss_conf             378489999999999998378999889954899668999999998753677618999989999999999640002


No 29 
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, structural genomics; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45
Probab=97.66  E-value=9.5e-05  Score=47.68  Aligned_cols=62  Identities=16%  Similarity=0.234  Sum_probs=47.3

Q ss_pred             CCCCCCHHHHHHHHHHC-CCCCCEEEECCCCCHHHHHHHHHH---------------CCEEEEEEECHHHHHHHHHHHHH
Q ss_conf             68778189999999852-899888998688851799999980---------------98169997289999999999963
Q gi|254780466|r  204 HPTQKPEALLSRILVSS-TKPGDIILDPFFGSGTSGAVAKKL---------------RRSFIGIEMKQDYIDIATKRIAS  267 (375)
Q Consensus       204 HPTqKP~~LleriI~~~-S~~gDiVLDPF~GSGTT~~aA~~l---------------gR~~IGiE~~~~Y~~~a~~Rl~~  267 (375)
                      |-|+  ..+.+.++... .++++.|+||+||||+.+++|.+.               .-...|+|+++..+.+|+-.+.-
T Consensus       153 ffTP--~~Iv~~mv~ll~~~~~~~IlDPacGsG~fL~~~~~~~~~~~~~~~~~~~~~~~~i~G~e~~~~~~~la~~nl~l  230 (445)
T 2okc_A          153 YFTP--RPLIQAMVDCINPQMGETVCDPACGTGGFLLTAYDYMKGQSASKEKRDFLRDKALHGVDNTPLVVTLASMNLYL  230 (445)
T ss_dssp             GCCC--HHHHHHHHHHHCCCTTCCEEETTCTTCHHHHHHHHHHHTCC-CCHHHHHHHHTTEEEEESCHHHHHHHHHHHHH
T ss_pred             ECCC--HHHHHHHHHHCCCCCCCEEECCCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHCEECEECCHHHHHHHHHHCCC
T ss_conf             6598--99999999760799999781278897665999999998731227777553010142341209999999962310


No 30 
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protein structure initiative, midwest center for structural genomics; HET: MSE; 2.05A {Escherichia coli K12} SCOP: c.66.1.46
Probab=97.65  E-value=0.00014  Score=46.60  Aligned_cols=73  Identities=26%  Similarity=0.272  Sum_probs=52.6

Q ss_pred             CCCCCCCCCCCCC--CHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHC-CEEEEEEECHHHHHHHHHHHHHCCC
Q ss_conf             5778753368778--1899999998528998889986888517999999809-8169997289999999999963056
Q gi|254780466|r  196 RNKDGEKLHPTQK--PEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLR-RSFIGIEMKQDYIDIATKRIASVQP  270 (375)
Q Consensus       196 k~~~g~k~HPTqK--P~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~lg-R~~IGiE~~~~Y~~~a~~Rl~~~~~  270 (375)
                      +...+..+.||.=  -++|...|  ....++..|||.|+|||+-+..|..-| ...+.+|.|++.++++++-++....
T Consensus        27 ~~~~~~~~RPt~~rvrealFn~L--~~~~~~~~vLDLfaGsG~lgiEalsRGa~~v~fVE~~~~a~~~l~~N~~~~~~  102 (202)
T 2fpo_A           27 PVPDSPGLRPTTDRVRETLFNWL--APVIVDAQCLDCFAGSGALGLEALSRYAAGATLIEMDRAVSQQLIKNLATLKA  102 (202)
T ss_dssp             ECCCC------CHHHHHHHHHHH--HHHHTTCEEEETTCTTCHHHHHHHHTTCSEEEEECSCHHHHHHHHHHHHHTTC
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHH--HHHCCCCEEEECCCCCCHHHHHHHCCCCCEEEEEEECCCHHHHHHHHHHHHCC
T ss_conf             68999996878389999999986--64328986998887855889998707998868999703335678878987463


No 31 
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli}
Probab=97.65  E-value=0.00018  Score=45.94  Aligned_cols=59  Identities=15%  Similarity=0.180  Sum_probs=49.5

Q ss_pred             CHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHH
Q ss_conf             18999999985289988899868885179999998098169997289999999999963
Q gi|254780466|r  209 PEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIAS  267 (375)
Q Consensus       209 P~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~  267 (375)
                      .+.|.+.++......++-|+|-|||+||-+..-.+...+-+|+|+++..++.|++.++.
T Consensus       199 ~~~l~~~v~~~~~~~~~~vlDLycG~Gt~sl~La~~~~~V~gvE~~~~av~~A~~Na~~  257 (369)
T 3bt7_A          199 NIQMLEWALDVTKGSKGDLLELYCGNGNFSLALARNFDRVLATEIAKPSVAAAQYNIAA  257 (369)
T ss_dssp             HHHHHHHHHHHTTTCCSEEEEESCTTSHHHHHHGGGSSEEEEECCCHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHCCCEEEEEEECHHHHHHHHHHHHH
T ss_conf             99999999987156776488737896588999873085788999702678999999997


No 32 
>2yxd_A Probable cobalt-precorrin-6Y C(15)- methyltransferase [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii DSM2661}
Probab=97.62  E-value=0.00033  Score=44.36  Aligned_cols=65  Identities=18%  Similarity=0.180  Sum_probs=52.0

Q ss_pred             CCCCCCHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             687781899999998528998889986888517999999809816999728999999999996305
Q gi|254780466|r  204 HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       204 HPTqKP~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      +.|+.++-.+. +=.+--.+||.|||-+||||+.++.+-++..+-+|+|++++.++.|+++.++..
T Consensus        17 p~Tk~evR~l~-l~~L~l~~~~~VlDlg~G~G~~si~la~~~~~V~ave~~~~~i~~a~~n~~~~g   81 (183)
T 2yxd_A           17 PITKEEIRAVS-IGKLNLNKDDVVVDVGCGSGGMTVEIAKRCKFVYAIDYLDGAIEVTKQNLAKFN   81 (183)
T ss_dssp             CCCCHHHHHHH-HHHHCCCTTCEEEEESCCCSHHHHHHHTTSSEEEEEECSHHHHHHHHHHHHHTT
T ss_pred             CCCHHHHHHHH-HHHCCCCCCCEEEEEECCCCHHHHHHHHHCCEEEEEECCHHHHHHHHHHHHHCC
T ss_conf             87879999999-997699894999996174769999988738999999798999999999999768


No 33 
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research center for structural genomics, protein structure initiative, PSI-2; 2.20A {Pyrococcus furiosus}
Probab=97.61  E-value=0.00017  Score=46.13  Aligned_cols=54  Identities=17%  Similarity=0.253  Sum_probs=44.0

Q ss_pred             HHHHCCCCCCEEEECCCCCHHHHH-HHH-HHCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             998528998889986888517999-999-809816999728999999999996305
Q gi|254780466|r  216 ILVSSTKPGDIILDPFFGSGTSGA-VAK-KLRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       216 iI~~~S~~gDiVLDPF~GSGTT~~-aA~-~lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      ++....++++.|||+++|||..+. +|+ ..+.+.+|+|+++..++.|++.++...
T Consensus        48 ~~~~~~~~~~~vLDig~G~G~~~~~~a~~~~~~~v~~vDi~~~~~~~a~~n~~~~~  103 (230)
T 3evz_A           48 FLKTFLRGGEVALEIGTGHTAMMALMAEKFFNCKVTATEVDEEFFEYARRNIERNN  103 (230)
T ss_dssp             HHHTTCCSSCEEEEECCTTTCHHHHHHHHHHCCEEEEEECCHHHHHHHHHHHHHTT
T ss_pred             HHHHCCCCCCEEEEEECCHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHCC
T ss_conf             99845789898999407443999999997799879999886311246776688606


No 34 
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A*
Probab=97.57  E-value=0.0004  Score=43.88  Aligned_cols=65  Identities=14%  Similarity=0.153  Sum_probs=51.3

Q ss_pred             CCCCCHHHHHHHHH-HCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             87781899999998-528998889986888517999999809816999728999999999996305
Q gi|254780466|r  205 PTQKPEALLSRILV-SSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       205 PTqKP~~LleriI~-~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      |.+.++++-..++. +--.+|+.|||-.||||..++++.+.+.+.+|+|++++.++.|++++++..
T Consensus        14 ~~~t~~e~~a~il~~l~~~~g~~VLDiGcG~G~~s~~la~~~~~V~avD~~~~~~~~a~~~~~~~g   79 (192)
T 1l3i_A           14 PGPTAMEVRCLIMCLAEPGKNDVAVDVGCGTGGVTLELAGRVRRVYAIDRNPEAISTTEMNLQRHG   79 (192)
T ss_dssp             CCCCCHHHHHHHHHHHCCCTTCEEEEESCTTSHHHHHHHTTSSEEEEEESCHHHHHHHHHHHHHTT
T ss_pred             CCCCHHHHHHHHHHHCCCCCCCEEEEEECCHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHCC
T ss_conf             997869999999986699997999998387049999998439999999906288999999999809


No 35 
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638}
Probab=97.56  E-value=0.00026  Score=45.02  Aligned_cols=66  Identities=11%  Similarity=0.102  Sum_probs=52.2

Q ss_pred             CCCCCCHHHHHHHHHHC---CCCCCEEEECCCCCHH-HHHHHHHHCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             68778189999999852---8998889986888517-999999809816999728999999999996305
Q gi|254780466|r  204 HPTQKPEALLSRILVSS---TKPGDIILDPFFGSGT-SGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       204 HPTqKP~~LleriI~~~---S~~gDiVLDPF~GSGT-T~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      +....|+.+..|+..+.   ..+|.-|||.|+|+|| .+.++...+.+-+|+|+++..++.|++..+...
T Consensus       150 q~~~~~~~~~~r~~~~~~~~~~~g~~vldlg~g~g~~l~~~l~~~~~~V~~vDi~~~~l~~a~~~a~~~g  219 (373)
T 2qm3_A          150 QAYVTPETTVARVILMHTRGDLENKDIFVLGDDDLTSIALMLSGLPKRIAVLDIDERLTKFIEKAANEIG  219 (373)
T ss_dssp             CCCBCHHHHHHHHHHHHHTTCSTTCEEEEESCTTCHHHHHHHHTCCSEEEEECSCHHHHHHHHHHHHHHT
T ss_pred             CCCCCHHHHHHHHHHHHHCCCCCCCEEEEEECCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHC
T ss_conf             0214488999999999863777899799997992499999997699989999797999999999999819


No 36 
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51
Probab=97.53  E-value=0.00038  Score=44.05  Aligned_cols=62  Identities=24%  Similarity=0.246  Sum_probs=48.4

Q ss_pred             CCCCCCHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHC-CEEEEEEECHHHHHHHHHHHHHC
Q ss_conf             687781899999998528998889986888517999999809-81699972899999999999630
Q gi|254780466|r  204 HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLR-RSFIGIEMKQDYIDIATKRIASV  268 (375)
Q Consensus       204 HPTqKP~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~lg-R~~IGiE~~~~Y~~~a~~Rl~~~  268 (375)
                      ++-|.+.   .+.+.....+|+.|||.|+|+|+.+++|...| .+-+++|+++.+++.|++.++.-
T Consensus       201 flDqr~~---R~~~~~~~~~g~~VLDl~~g~G~~si~aa~~ga~~V~~vD~s~~al~~a~~N~~~N  263 (396)
T 2as0_A          201 FLDQREN---RLALEKWVQPGDRVLDVFTYTGGFAIHAAIAGADEVIGIDKSPRAIETAKENAKLN  263 (396)
T ss_dssp             CSTTHHH---HHHHGGGCCTTCEEEETTCTTTHHHHHHHHTTCSEEEEEESCHHHHHHHHHHHHHT
T ss_pred             CHHHHHH---HHHHHHHCCCCCEEEEECCCCCHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHC
T ss_conf             6667888---99999751589769881787788899999779974688718888999999999983


No 37 
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5- methylpyrimidin-2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A*
Probab=97.52  E-value=2.6e-05  Score=51.09  Aligned_cols=77  Identities=29%  Similarity=0.459  Sum_probs=40.7

Q ss_pred             CCCEECCCHHHHHHHCCCCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCC----C-CCHHHHHHHHHHHHHHHHH
Q ss_conf             2708517259989728414711898477876155871333678513001344357----7-8989999988999999998
Q gi|254780466|r   20 KDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDK----F-SSFEAYDAFTRAWLLACRR   94 (375)
Q Consensus        20 ~nkI~~GDcl~~l~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~----~-~s~~~Y~~f~~~wl~e~~R   94 (375)
                      ++.|++||.+.   .-+.+.+|+|++.|||...............  ...+.|.+    . ...+-|.-    ++..+.+
T Consensus        82 ~~~i~~~D~l~---~~~~~~fD~VigNPPy~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~dl~~~----Fi~~~l~  152 (421)
T 2ih2_A           82 WAEGILADFLL---WEPGEAFDLILGNPPYGIVGEASKYPIHVFK--AVKDLYKKAFSTWKGKYNLYGA----FLEKAVR  152 (421)
T ss_dssp             TEEEEESCGGG---CCCSSCEEEEEECCCCCCBSCTTTCSBCCCH--HHHHHHHHHCTTCCTTCCHHHH----HHHHHHH
T ss_pred             HHHHHHCCCCC---CCCCCCCCEEEECCCCCCCCCCCCCCHHHHH--HHHHHHCCCCCCCCCCCHHHHH----HHHHHHH
T ss_conf             74277377333---6854577778725765544545544212333--3222220135678996539999----9999999


Q ss_pred             HCCCCCEEEEE
Q ss_conf             63968729998
Q gi|254780466|r   95 VLKPNGTLWVI  105 (375)
Q Consensus        95 vLK~~Gsi~v~  105 (375)
                      .||++|.+-++
T Consensus       153 ~lk~~G~~~~I  163 (421)
T 2ih2_A          153 LLKPGGVLVFV  163 (421)
T ss_dssp             HEEEEEEEEEE
T ss_pred             HCCCCCCEEEE
T ss_conf             63778818999


No 38 
>1nw3_A Histone methyltransferase DOT1L; HDOT1, histone lysine methyltransferase,; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.31
Probab=97.52  E-value=0.00054  Score=43.12  Aligned_cols=60  Identities=17%  Similarity=0.131  Sum_probs=50.0

Q ss_pred             CHHHHHHHHHHCC-CCCCEEEECCCCCHHHHH-HHHHHC-CEEEEEEECHHHHHHHHHHHHHC
Q ss_conf             1899999998528-998889986888517999-999809-81699972899999999999630
Q gi|254780466|r  209 PEALLSRILVSST-KPGDIILDPFFGSGTSGA-VAKKLR-RSFIGIEMKQDYIDIATKRIASV  268 (375)
Q Consensus       209 P~~LleriI~~~S-~~gDiVLDPF~GSGTT~~-aA~~lg-R~~IGiE~~~~Y~~~a~~Rl~~~  268 (375)
                      ....+.++|...- .++|+|||.-||+|+.+. ||+..| .+++|||++++-+++|+++.+..
T Consensus       140 ~~~~~~~i~~~~~l~~~~~~~DiG~G~G~~~~~~a~~~~~~~~~Giei~~~~~~~A~~~~~~~  202 (416)
T 1nw3_A          140 SFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREF  202 (416)
T ss_dssp             CHHHHHHHHHHSCCCTTCEEEEETCTTSHHHHHHHHHCCCSEEEEEECSHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHCCCCCCEEEECCCCCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHH
T ss_conf             099999999970899998899668888889999999769988999979999999999999999


No 39 
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae}
Probab=97.45  E-value=0.0003  Score=44.68  Aligned_cols=61  Identities=23%  Similarity=0.268  Sum_probs=52.7

Q ss_pred             HHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHCCC
Q ss_conf             8999999985289988899868885179999998098169997289999999999963056
Q gi|254780466|r  210 EALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQP  270 (375)
Q Consensus       210 ~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~~  270 (375)
                      ..-+.++++....++.-|||.-||+|..+.+-.+.|.+.+|+|++++.++.|++|..++.-
T Consensus        27 ~~~~~~~~~~~~~~~~~VLDiGcG~G~~~~~la~~g~~v~giD~S~~~l~~a~~~~~~~~~   87 (239)
T 3bxo_A           27 ASDIADLVRSRTPEASSLLDVACGTGTHLEHFTKEFGDTAGLELSEDMLTHARKRLPDATL   87 (239)
T ss_dssp             HHHHHHHHHHHCTTCCEEEEETCTTSHHHHHHHHHHSEEEEEESCHHHHHHHHHHCTTCEE
T ss_pred             HHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCCCCC
T ss_conf             9999999997489949899981758499999997399699996967887888633654422


No 40 
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36
Probab=97.42  E-value=0.0012  Score=40.97  Aligned_cols=65  Identities=14%  Similarity=0.164  Sum_probs=56.7

Q ss_pred             CCCCCCHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHC
Q ss_conf             68778189999999852899888998688851799999980981699972899999999999630
Q gi|254780466|r  204 HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASV  268 (375)
Q Consensus       204 HPTqKP~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~  268 (375)
                      |-++=+..|-+.+-..-.++|.-|||+=||+|..+....+.|.+.+|+|++++.++.|++|....
T Consensus         3 ~~~~~~~~~~~~~~~l~~~~g~rVLD~GCG~G~~~~~La~~g~~v~gvD~S~~~i~~a~~~~~~~   67 (203)
T 1pjz_A            3 HQSEVNKDLQQYWSSLNVVPGARVLVPLCGKSQDMSWLSGQGYHVVGAELSEAAVERYFTERGEQ   67 (203)
T ss_dssp             CCSSSTHHHHHHHHHHCCCTTCEEEETTTCCSHHHHHHHHHCCEEEEEEECHHHHHHHHHHHCSC
T ss_pred             CHHHHCHHHHHHHHHCCCCCCCEEEEECCCCCHHHHHHHHCCCEEEEECCCHHHHHHHHHHHCCC
T ss_conf             73454889999999649999997999737898889999967987788526599999999972345


No 41 
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46
Probab=97.41  E-value=0.00045  Score=43.60  Aligned_cols=69  Identities=23%  Similarity=0.282  Sum_probs=53.3

Q ss_pred             CCCCCCCC--CHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHC-CEEEEEEECHHHHHHHHHHHHHCCCC
Q ss_conf             53368778--1899999998528998889986888517999999809-81699972899999999999630568
Q gi|254780466|r  201 EKLHPTQK--PEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLR-RSFIGIEMKQDYIDIATKRIASVQPL  271 (375)
Q Consensus       201 ~k~HPTqK--P~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~lg-R~~IGiE~~~~Y~~~a~~Rl~~~~~~  271 (375)
                      ...-||.=  -++|+-.|  ....+|..|||-|+|||+-|.-|..-| ...+.+|.+...+++.++-++++...
T Consensus        31 ~~~RPt~~~vrealFn~l--~~~~~~~~~LDLFaGSG~lglEAlSRGA~~v~fVE~~~~a~~~l~~N~~~l~~~  102 (201)
T 2ift_A           31 EGLRPTGDRVKETLFNWL--MPYIHQSECLDGFAGSGSLGFEALSRQAKKVTFLELDKTVANQLKKNLQTLKCS  102 (201)
T ss_dssp             -------CHHHHHHHHHH--HHHHTTCEEEETTCTTCHHHHHHHHTTCSEEEEECSCHHHHHHHHHHHHHTTCC
T ss_pred             CCCCCCCHHHHHHHHHHH--HHHCCCCEEEECCCCCCHHHHHHHHCCCCEEEEEEECHHHHHHHHHHHHHHCCC
T ss_conf             996878489999999987--764299879987888289899999889939999974055778999999983866


No 42 
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31
Probab=97.40  E-value=0.00083  Score=41.98  Aligned_cols=59  Identities=22%  Similarity=0.245  Sum_probs=49.5

Q ss_pred             HHHHHHHHHHC-CCCCCEEEECCCCCHHHH-HHHHHHC-CEEEEEEECHHHHHHHHHHHHHC
Q ss_conf             89999999852-899888998688851799-9999809-81699972899999999999630
Q gi|254780466|r  210 EALLSRILVSS-TKPGDIILDPFFGSGTSG-AVAKKLR-RSFIGIEMKQDYIDIATKRIASV  268 (375)
Q Consensus       210 ~~LleriI~~~-S~~gDiVLDPF~GSGTT~-~aA~~lg-R~~IGiE~~~~Y~~~a~~Rl~~~  268 (375)
                      ..++..+|... -.+||+|||-=||+|.++ .+|.+.| .+.+|||+++.-++.|+++.+..
T Consensus       228 p~~i~~Il~~l~Lkpgd~fLDLGCG~G~vvl~aA~~~g~~~viGIDis~~~l~~A~~~~~e~  289 (433)
T 1u2z_A          228 PNFLSDVYQQCQLKKGDTFMDLGSGVGNCVVQAALECGCALSFGCEIMDDASDLTILQYEEL  289 (433)
T ss_dssp             HHHHHHHHHHTTCCTTCEEEEESCTTSHHHHHHHHHHCCSEEEEEECCHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHCCCCCCEEEECCCCCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHH
T ss_conf             89999999982899999899748999899999999759987999979999999999999998


No 43 
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A*
Probab=97.35  E-value=0.00062  Score=42.72  Aligned_cols=59  Identities=20%  Similarity=0.282  Sum_probs=49.0

Q ss_pred             CHHHHHHHHHHCC-CCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHH
Q ss_conf             1899999998528-9988899868885179999998098169997289999999999963
Q gi|254780466|r  209 PEALLSRILVSST-KPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIAS  267 (375)
Q Consensus       209 P~~LleriI~~~S-~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~  267 (375)
                      .+.|.+.++.... .+++.|+|-|||+||.+....+...+-+|+|.++..++.|++-.+.
T Consensus       271 ~~~l~~~v~~~l~~~~~~~vlDLYcG~G~fsl~La~~~~~V~gvE~~~~Av~~A~~na~~  330 (433)
T 1uwv_A          271 NQKMVARALEWLDVQPEDRVLDLFCGMGNFTLPLATQAASVVGVEGVPALVEKGQQNARL  330 (433)
T ss_dssp             HHHHHHHHHHHHTCCTTCEEEEESCTTTTTHHHHHTTSSEEEEEESCHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHCCCCCCEEEEECCCCCHHHHHHHHHCCEEEEEECCHHHHHHHHHHHHH
T ss_conf             999999999984456887799956885177787665056245663549999999999998


No 44 
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A*
Probab=97.32  E-value=0.0011  Score=41.13  Aligned_cols=56  Identities=23%  Similarity=0.322  Sum_probs=46.6

Q ss_pred             CHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHH
Q ss_conf             1899999998528998889986888517999999809816999728999999999996
Q gi|254780466|r  209 PEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIA  266 (375)
Q Consensus       209 P~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~  266 (375)
                      .+.|++.+...  .+++.|||-|||+||....-.+.+.+-+|+|.++..++.|++-.+
T Consensus       278 ~~~L~~~v~~~--~~~~~vlDLycG~G~fsl~LA~~~~~V~gvE~~~~av~~A~~na~  333 (425)
T 2jjq_A          278 AVNLVRKVSEL--VEGEKILDMYSGVGTFGIYLAKRGFNVKGFDSNEFAIEMARRNVE  333 (425)
T ss_dssp             HHHHHHHHHHH--CCSSEEEEETCTTTHHHHHHHHTTCEEEEEESCHHHHHHHHHHHH
T ss_pred             HHHHHHHHHCC--CCCCEEEECCCCCCHHHHHHHHCCCEEEEEECCHHHHHHHHHHHH
T ss_conf             75421222203--687778762678668889987428554575046888999999898


No 45 
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus HB8} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A*
Probab=97.30  E-value=0.00045  Score=43.55  Aligned_cols=55  Identities=15%  Similarity=0.120  Sum_probs=45.9

Q ss_pred             HHHHHHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             99998528998889986888517999999809816999728999999999996305
Q gi|254780466|r  214 SRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       214 eriI~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      .|..... .+|+-|||.|+|+|+.+++|...+..-+++|+++..++.|++..+.-.
T Consensus       201 ~r~~~~~-~~g~~VLDl~~g~G~~s~~~a~~~~~V~~vD~s~~al~~a~~n~~~ng  255 (382)
T 1wxx_A          201 NRLYMER-FRGERALDVFSYAGGFALHLALGFREVVAVDSSAEALRRAEENARLNG  255 (382)
T ss_dssp             HHHHGGG-CCEEEEEEETCTTTHHHHHHHHHEEEEEEEESCHHHHHHHHHHHHHTT
T ss_pred             HHHHHHH-HCCCEEEECCCCCCHHHHHHHHCCCCEEECCCCHHHHHHHHHHHHHCC
T ss_conf             5889876-269804104677877999998467726720463999999999999728


No 46 
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis V583} SCOP: c.66.1.46
Probab=97.30  E-value=7.7e-05  Score=48.23  Aligned_cols=58  Identities=22%  Similarity=0.317  Sum_probs=38.3

Q ss_pred             CCEECCCHHHHHHHCC--CCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             7085172599897284--14711898477876155871333678513001344357789899999889999999986396
Q gi|254780466|r   21 DKIIKGNSISVLEKLP--AKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKP   98 (375)
Q Consensus        21 nkI~~GDcl~~l~~Lp--d~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvLK~   98 (375)
                      -.++++|+.+.++.+.  +.++|+||.||||+..                        ...+.+   .. +.+ ..+|++
T Consensus        96 ~~i~~~d~~~~l~~~~~~~~~fDlIflDPPY~~~------------------------~~~~~l---~~-i~~-~~~L~~  146 (187)
T 2fhp_A           96 FEVRKMDANRALEQFYEEKLQFDLVLLDPPYAKQ------------------------EIVSQL---EK-MLE-RQLLTN  146 (187)
T ss_dssp             EEEEESCHHHHHHHHHHTTCCEEEEEECCCGGGC------------------------CHHHHH---HH-HHH-TTCEEE
T ss_pred             CEEEEEEHHHHHHHHHHCCCCCCEEEECCCCCCH------------------------HHHHHH---HH-HHH-CCCCCC
T ss_conf             1788610788877643026765359978987531------------------------799999---99-998-798298


Q ss_pred             CCEEEEECC
Q ss_conf             872999834
Q gi|254780466|r   99 NGTLWVIGS  107 (375)
Q Consensus        99 ~Gsi~v~~~  107 (375)
                      +|.+++-.+
T Consensus       147 ~giIiiE~~  155 (187)
T 2fhp_A          147 EAVIVCETD  155 (187)
T ss_dssp             EEEEEEEEE
T ss_pred             CEEEEEEEC
T ss_conf             909999926


No 47 
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4
Probab=97.28  E-value=0.00023  Score=45.40  Aligned_cols=70  Identities=13%  Similarity=0.383  Sum_probs=46.5

Q ss_pred             CCCEECCCHHHHHHHCCCCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             27085172599897284147118984778761558713336785130013443577898999998899999999863968
Q gi|254780466|r   20 KDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPN   99 (375)
Q Consensus        20 ~nkI~~GDcl~~l~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvLK~~   99 (375)
                      .-+++++|+++   .++++++|+|+++|||..                         . .+   .....+.+++++|||+
T Consensus       103 ~i~~~~~D~~~---~~~~~~fD~Ii~~~~~~~-------------------------~-~~---~~~~~l~~~~~~Lkpg  150 (194)
T 1dus_A          103 DIRVVHSDLYE---NVKDRKYNKIITNPPIRA-------------------------G-KE---VLHRIIEEGKELLKDN  150 (194)
T ss_dssp             CEEEEECSTTT---TCTTSCEEEEEECCCSTT-------------------------C-HH---HHHHHHHHHHHHEEEE
T ss_pred             EEEEEECCHHH---HCCCCCCCEEEECCCHHC-------------------------C-CH---HHHHHHHHHHHHCCCC
T ss_conf             19999873676---335677439999952211-------------------------6-15---6799999999960969


Q ss_pred             CEEEEE-CCHHHHHHHHHHHHHC
Q ss_conf             729998-3468889999876405
Q gi|254780466|r  100 GTLWVI-GSYHNIFRIGTMLQNL  121 (375)
Q Consensus       100 Gsi~v~-~~~~~i~~i~~~l~~~  121 (375)
                      |.+++. ...+....+...+++.
T Consensus       151 G~l~i~~~~~~~~~~~~~~~~~~  173 (194)
T 1dus_A          151 GEIWVVIQTKQGAKSLAKYMKDV  173 (194)
T ss_dssp             EEEEEEEESTHHHHHHHHHHHHH
T ss_pred             CEEEEEEECCCCHHHHHHHHHHH
T ss_conf             79999997766879999999973


No 48 
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxylating); porphyrin metabolism, S-adenosyl-methionine, structural genomics; 1.80A {Geobacter metallireducens gs-15}
Probab=97.23  E-value=0.0022  Score=39.40  Aligned_cols=64  Identities=14%  Similarity=0.157  Sum_probs=49.6

Q ss_pred             CCCCCCHHHHHHHH--HHCCCCCCEEEECCCCCHHHHHHHHHHCC--EEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             68778189999999--85289988899868885179999998098--16999728999999999996305
Q gi|254780466|r  204 HPTQKPEALLSRIL--VSSTKPGDIILDPFFGSGTSGAVAKKLRR--SFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       204 HPTqKP~~LleriI--~~~S~~gDiVLDPF~GSGTT~~aA~~lgR--~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      +|..|.+-  +-++  ..--++||.|||--+|||..++++.+.+.  +-+++|++++.++.|+++++...
T Consensus        21 ~~~tk~ev--ra~~l~~L~l~pg~~VLDiG~GsG~la~~~a~~~~~~~V~aiD~~~~~~~~a~~n~~~~g   88 (204)
T 3e05_A           21 KLITKQEV--RAVTLSKLRLQDDLVMWDIGAGSASVSIEASNLMPNGRIFALERNPQYLGFIRDNLKKFV   88 (204)
T ss_dssp             TTSCCHHH--HHHHHHHTTCCTTCEEEEETCTTCHHHHHHHHHCTTSEEEEEECCHHHHHHHHHHHHHHT
T ss_pred             CCCCHHHH--HHHHHHHCCCCCCCEEEEEEEEHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHCC
T ss_conf             78668999--999998609999399999831078999999997899679999499999999999999819


No 49 
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus HB8} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A*
Probab=97.19  E-value=0.00044  Score=43.65  Aligned_cols=21  Identities=29%  Similarity=0.392  Sum_probs=8.6

Q ss_pred             HHHHHHHHHHCCCCCCEEEEC
Q ss_conf             899999998528998889986
Q gi|254780466|r  210 EALLSRILVSSTKPGDIILDP  230 (375)
Q Consensus       210 ~~LleriI~~~S~~gDiVLDP  230 (375)
                      .+.+.++...-..-+-||+||
T Consensus       267 ~~~l~~~~~~~~~fD~VilDp  287 (382)
T 1wxx_A          267 FDLLRRLEKEGERFDLVVLDP  287 (382)
T ss_dssp             HHHHHHHHHTTCCEEEEEECC
T ss_pred             HHHHHHHHHHCCCCCEEEECC
T ss_conf             777777786267998699827


No 50 
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli}
Probab=97.17  E-value=0.00028  Score=44.86  Aligned_cols=49  Identities=10%  Similarity=0.107  Sum_probs=41.9

Q ss_pred             CCCCCEEEECCCCCHHHHHHHHHHC--CEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             8998889986888517999999809--816999728999999999996305
Q gi|254780466|r  221 TKPGDIILDPFFGSGTSGAVAKKLR--RSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       221 S~~gDiVLDPF~GSGTT~~aA~~lg--R~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      ..+++-|||..||+|..+.++.+.+  .+.+++|+++..++.|++.++.-.
T Consensus       194 ~~~~~~VLDlGcG~G~l~~~la~~~p~~~v~~vD~s~~al~~ar~n~~~n~  244 (343)
T 2pjd_A          194 PHTKGKVLDVGCGAGVLSVAFARHSPKIRLTLCDVSAPAVEASRATLAANG  244 (343)
T ss_dssp             TTCCSBCCBTTCTTSHHHHHHHHHCTTCBCEEEESBHHHHHHHHHHHHHTT
T ss_pred             CCCCCEEEEECCCCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHCC
T ss_conf             058982999325277999999997899789999899999999999999849


No 51 
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI- 2, protein structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51
Probab=97.17  E-value=0.0014  Score=40.63  Aligned_cols=63  Identities=16%  Similarity=0.113  Sum_probs=50.0

Q ss_pred             CCCCCCHH-HHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHH
Q ss_conf             68778189-99999985289988899868885179999998098169997289999999999963
Q gi|254780466|r  204 HPTQKPEA-LLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIAS  267 (375)
Q Consensus       204 HPTqKP~~-LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~  267 (375)
                      ++-|.+.- .+..++...+ +|--|||.|+|||+.+++|..-|-+-+++|.++.+++.|++..+.
T Consensus       134 FlDqr~nr~~l~~~~~~~~-kg~rVLdlF~ytG~~sl~aa~~GA~V~~VD~s~~al~~a~~N~~l  197 (332)
T 2igt_A          134 FPEQIVHWEWLKNAVETAD-RPLKVLNLFGYTGVASLVAAAAGAEVTHVDASKKAIGWAKENQVL  197 (332)
T ss_dssp             CGGGHHHHHHHHHHHHHSS-SCCEEEEETCTTCHHHHHHHHTTCEEEEECSCHHHHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHHCC-CCCEEEECCCCCCHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHH
T ss_conf             5210668999999866315-897588726777778999997898499993879999999999998


No 52 
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12}
Probab=97.16  E-value=0.00045  Score=43.58  Aligned_cols=61  Identities=15%  Similarity=0.111  Sum_probs=47.2

Q ss_pred             CCCCCCHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHC-CEEEEEEECHHHHHHHHHHHHHC
Q ss_conf             687781899999998528998889986888517999999809-81699972899999999999630
Q gi|254780466|r  204 HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLR-RSFIGIEMKQDYIDIATKRIASV  268 (375)
Q Consensus       204 HPTqKP~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~lg-R~~IGiE~~~~Y~~~a~~Rl~~~  268 (375)
                      +.-|.+.   .+.+...+ +|.-|||.|+|||+.+++|...| ..-+++|+++.+++.|++-.+.-
T Consensus       205 flDqR~~---R~~v~~~~-~g~rVLdlf~~tG~~si~Aa~~GA~~V~~vD~s~~al~~a~~N~~~N  266 (396)
T 3c0k_A          205 YLDQRDS---RLATRRYV-ENKRVLNCFSYTGGFAVSALMGGCSQVVSVDTSQEALDIARQNVELN  266 (396)
T ss_dssp             CGGGHHH---HHHHHHHC-TTCEEEEESCTTCSHHHHHHHTTCSEEEEEESCHHHHHHHHHHHHHT
T ss_pred             CHHHHHH---HHHHHHHC-CCCEEEECCCCCCHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHH
T ss_conf             5306899---99999765-99868753886688999999779975999989899999999999982


No 53 
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A*
Probab=97.16  E-value=0.0018  Score=39.91  Aligned_cols=54  Identities=13%  Similarity=0.262  Sum_probs=46.0

Q ss_pred             HHHH-HCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHC
Q ss_conf             9998-52899888998688851799999980981699972899999999999630
Q gi|254780466|r  215 RILV-SSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASV  268 (375)
Q Consensus       215 riI~-~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~  268 (375)
                      .+|. +..+||+-|||-=||+|.++....+.+.+.+|+|++++.++.|++|+...
T Consensus        12 ~l~~~~~~~pg~rVLDiGCGtG~~~~~la~~~~~v~gvD~S~~ml~~A~~~~~~~   66 (239)
T 1xxl_A           12 LMIKTAECRAEHRVLDIGAGAGHTALAFSPYVQECIGVDATKEMVEVASSFAQEK   66 (239)
T ss_dssp             HHHHHHTCCTTCEEEEESCTTSHHHHHHGGGSSEEEEEESCHHHHHHHHHHHHHH
T ss_pred             HHHHHHCCCCCCEEEEECCCCCHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHC
T ss_conf             9999858999898999588685999999970997999979999999999865430


No 54 
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii OT3} SCOP: c.66.1.43
Probab=97.14  E-value=0.0027  Score=38.84  Aligned_cols=58  Identities=12%  Similarity=0.292  Sum_probs=49.0

Q ss_pred             HHHHHHHHH-CCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHC
Q ss_conf             999999985-2899888998688851799999980981699972899999999999630
Q gi|254780466|r  211 ALLSRILVS-STKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASV  268 (375)
Q Consensus       211 ~LleriI~~-~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~  268 (375)
                      ..+++++.. ..+++..|||.-||+|..+....+.|-+.+|+|++++.++.|++|+...
T Consensus        28 ~~~~~~~~~~~~~~~~~ILDiGcGtG~~~~~l~~~g~~v~gvD~s~~ml~~a~~~~~~~   86 (252)
T 1wzn_A           28 DFVEEIFKEDAKREVRRVLDLACGTGIPTLELAERGYEVVGLDLHEEMLRVARRKAKER   86 (252)
T ss_dssp             HHHHHHHHHTCSSCCCEEEEETCTTCHHHHHHHHTTCEEEEEESCHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHCCCCCCEEEEECCCCCHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHC
T ss_conf             99999999735789898999547586999999976998999974688999999977642


No 55 
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protein structure initiative, midwest center for structural genomics; HET: MSE; 2.05A {Escherichia coli K12} SCOP: c.66.1.46
Probab=97.13  E-value=0.00029  Score=44.70  Aligned_cols=56  Identities=16%  Similarity=0.378  Sum_probs=38.5

Q ss_pred             CCCEECCCHHHHHHHCCCCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHH--HHCC
Q ss_conf             27085172599897284147118984778761558713336785130013443577898999998899999999--8639
Q gi|254780466|r   20 KDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACR--RVLK   97 (375)
Q Consensus        20 ~nkI~~GDcl~~l~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~--RvLK   97 (375)
                      ...++++|+++.++.. .+.+|+||.||||..                           ..|.+    .+..+.  .+|+
T Consensus       104 ~~~ii~~d~~~~l~~~-~~~fDlIflDPPY~~---------------------------~~~~~----~l~~l~~~~lL~  151 (202)
T 2fpo_A          104 NARVVNSNAMSFLAQK-GTPHNIVFVDPPFRR---------------------------GLLEE----TINLLEDNGWLA  151 (202)
T ss_dssp             SEEEECSCHHHHHSSC-CCCEEEEEECCSSST---------------------------TTHHH----HHHHHHHTTCEE
T ss_pred             CCEEEECCHHHHHHHC-CCCCCEEEECCCCCC---------------------------CHHHH----HHHHHHHCCCCC
T ss_conf             5359953245655412-776668997699875---------------------------45999----999999888908


Q ss_pred             CCCEEEEECC
Q ss_conf             6872999834
Q gi|254780466|r   98 PNGTLWVIGS  107 (375)
Q Consensus        98 ~~Gsi~v~~~  107 (375)
                      ++|-|++..+
T Consensus       152 ~~~iIiiE~~  161 (202)
T 2fpo_A          152 DEALIYVESE  161 (202)
T ss_dssp             EEEEEEEEEE
T ss_pred             CCCEEEEEEC
T ss_conf             9949999824


No 56 
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research center for structural genomics, protein structure initiative, PSI-2; 2.20A {Pyrococcus furiosus}
Probab=97.11  E-value=7.8e-05  Score=48.19  Aligned_cols=93  Identities=15%  Similarity=0.253  Sum_probs=51.1

Q ss_pred             HHCCCEECCCHHHHHHHCCCCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCC
Q ss_conf             53270851725998972841471189847787615587133367851300134435778989999988999999998639
Q gi|254780466|r   18 EWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLK   97 (375)
Q Consensus        18 ~~~nkI~~GDcl~~l~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvLK   97 (375)
                      ....++...|. +.+..++++++|+|+++|||.-........+...        +...   ..-.++...++.++.++||
T Consensus       103 ~~~~~i~~~~~-~~~~~~~~~~fD~Iv~NPPy~~~~~~~~~~~~~a--------~~~~---~~g~~~~~~~l~~a~~~Lk  170 (230)
T 3evz_A          103 NSNVRLVKSNG-GIIKGVVEGTFDVIFSAPPYYDKPLGRVLTEREA--------IGGG---KYGEEFSVKLLEEAFDHLN  170 (230)
T ss_dssp             TCCCEEEECSS-CSSTTTCCSCEEEEEECCCCC-----------------------CC---SSSCHHHHHHHHHHGGGEE
T ss_pred             CCCCEEEEEEC-CCHHHCCCCCCCEEEECCCCCCCHHHCCCCHHHH--------HHCC---CCHHHHHHHHHHHHHHHCC
T ss_conf             66517998521-1012135765248998999556623213365888--------7458---5478999999999998608


Q ss_pred             CCCEEEEECCHHHHHHHHHHHHHCCCC
Q ss_conf             687299983468889999876405786
Q gi|254780466|r   98 PNGTLWVIGSYHNIFRIGTMLQNLNFW  124 (375)
Q Consensus        98 ~~Gsi~v~~~~~~i~~i~~~l~~~gf~  124 (375)
                      ++|.+++..+...  .+..++.+.||.
T Consensus       171 ~gG~l~l~~~~~~--~~~~~l~~~~~~  195 (230)
T 3evz_A          171 PGGKVALYLPDKE--KLLNVIKERGIK  195 (230)
T ss_dssp             EEEEEEEEEESCH--HHHHHHHHHHHH
T ss_pred             CCCEEEEEECCHH--HHHHHHHHHCCC
T ss_conf             9938999999879--999999982970


No 57 
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae}
Probab=97.09  E-value=0.0032  Score=38.41  Aligned_cols=63  Identities=17%  Similarity=0.211  Sum_probs=52.4

Q ss_pred             CCCHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHH-HC--CEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             7818999999985289988899868885179999998-09--816999728999999999996305
Q gi|254780466|r  207 QKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKK-LR--RSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       207 qKP~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~-lg--R~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      ..|.+|.+.|......+++.|||-=||+|.......+ .+  -+.||+|++++-++.+.+|.++..
T Consensus        20 ~y~~~~~~~l~~~~~~~~~~VLDiGCGtG~~t~~la~~~~~~~~V~gvD~S~~mi~~a~~~~~~~~   85 (299)
T 3g5t_A           20 SYPSDFYKMIDEYHDGERKLLVDVGCGPGTATLQMAQELKPFEQIIGSDLSATMIKTAEVIKEGSP   85 (299)
T ss_dssp             CCCHHHHHHHHHHCCSCCSEEEEETCTTTHHHHHHHHHSSCCSEEEEEESCHHHHHHHHHHHHHCC
T ss_pred             CCHHHHHHHHHHCCCCCCCEEEEECCCCCHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHHCC
T ss_conf             841999999995177899969998260889999999964999879998598899999999998636


No 58 
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A*
Probab=97.08  E-value=0.0016  Score=40.21  Aligned_cols=56  Identities=21%  Similarity=0.258  Sum_probs=46.7

Q ss_pred             HHHHHCCCCCCEEEECCCCCHHHHHHHHHH-CCEEEEEEECHHHHHHHHHHHHHCCC
Q ss_conf             999852899888998688851799999980-98169997289999999999963056
Q gi|254780466|r  215 RILVSSTKPGDIILDPFFGSGTSGAVAKKL-RRSFIGIEMKQDYIDIATKRIASVQP  270 (375)
Q Consensus       215 riI~~~S~~gDiVLDPF~GSGTT~~aA~~l-gR~~IGiE~~~~Y~~~a~~Rl~~~~~  270 (375)
                      .+|....++|+.|||-=||+|..+....+. ..+.+|+|++++.++.|++|.+....
T Consensus        56 ~Li~~~~~~~~~VLDlGCG~G~~~~~~~~~~~~~v~GiD~S~~~l~~a~~r~~~~~~  112 (298)
T 1ri5_A           56 CLIRLYTKRGDSVLDLGCGKGGDLLKYERAGIGEYYGVDIAEVSINDARVRARNMKR  112 (298)
T ss_dssp             HHHHHHCCTTCEEEEETCTTTTTHHHHHHHTCSEEEEEESCHHHHHHHHHHHHTSCC
T ss_pred             HHHHHHCCCCCEEEEECCCCCHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHCCC
T ss_conf             999984899598999637087899999966998588758999999999999875288


No 59 
>3dmg_A Probable ribosomal RNA small subunit methyltransferase; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A*
Probab=97.07  E-value=0.0017  Score=40.06  Aligned_cols=60  Identities=17%  Similarity=0.138  Sum_probs=49.4

Q ss_pred             HHHHHHHHH---HCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             899999998---528998889986888517999999809816999728999999999996305
Q gi|254780466|r  210 EALLSRILV---SSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       210 ~~LleriI~---~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      .-|++.+..   ....+|.-|||..||+|..+..+.+.+-+.+|+|+++..++.|+++++...
T Consensus       217 ~~ll~~l~~~~~~~~~~g~~VLDlGcG~G~~~~~la~~~~~v~~vD~s~~~l~~a~~~~~~~~  279 (381)
T 3dmg_A          217 LLLLEALQERLGPEGVRGRQVLDLGAGYGALTLPLARMGAEVVGVEDDLASVLSLQKGLEANA  279 (381)
T ss_dssp             HHHHHHHHHHHCTTTTTTCEEEEETCTTSTTHHHHHHTTCEEEEEESBHHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHHCCCCCCCCEEEEEEEECCHHHHHHHHCCCEEECCCCCHHHHHHHHHHHHHCC
T ss_conf             999998787526668999989999601048889767519887414699999999999999829


No 60 
>2esr_A Methyltransferase; structural genomics, hypothetical protein, PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes MGAS10394} SCOP: c.66.1.46
Probab=97.07  E-value=0.00044  Score=43.62  Aligned_cols=57  Identities=23%  Similarity=0.297  Sum_probs=38.3

Q ss_pred             CCEECCCHHHHHHHCCCCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             70851725998972841471189847787615587133367851300134435778989999988999999998639687
Q gi|254780466|r   21 DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNG  100 (375)
Q Consensus        21 nkI~~GDcl~~l~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvLK~~G  100 (375)
                      -.++++|+.+.++.+ .+++|+||.||||..                           ..|.+... -+. ..++|+++|
T Consensus        83 v~ii~~D~~~~l~~~-~~~fDiI~~DPPy~~---------------------------~~~~~~l~-~l~-~~~lL~~~g  132 (177)
T 2esr_A           83 FTLLKMEAERAIDCL-TGRFDLVFLDPPYAK---------------------------ETIVATIE-ALA-AKNLLSEQV  132 (177)
T ss_dssp             EEEECSCHHHHHHHB-CSCEEEEEECCSSHH---------------------------HHHHHHHH-HHH-HTTCEEEEE
T ss_pred             EEEEECCHHHHHHCC-CCCCCEEEECCCCCC---------------------------HHHHHHHH-HHH-HCCCCCCCE
T ss_conf             024531155554313-467886887997431---------------------------16999999-999-779989998


Q ss_pred             EEEEECC
Q ss_conf             2999834
Q gi|254780466|r  101 TLWVIGS  107 (375)
Q Consensus       101 si~v~~~  107 (375)
                      -+++..+
T Consensus       133 iiiiE~~  139 (177)
T 2esr_A          133 MVVCETD  139 (177)
T ss_dssp             EEEEEEE
T ss_pred             EEEEEEC
T ss_conf             9999807


No 61 
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A*
Probab=97.06  E-value=0.002  Score=39.59  Aligned_cols=53  Identities=19%  Similarity=0.062  Sum_probs=46.0

Q ss_pred             HHHCCCCCCEEEECCCCCHHHHHHHHHHCC--EEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             985289988899868885179999998098--16999728999999999996305
Q gi|254780466|r  217 LVSSTKPGDIILDPFFGSGTSGAVAKKLRR--SFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       217 I~~~S~~gDiVLDPF~GSGTT~~aA~~lgR--~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      |...-++|+.|||--||+|..+.++.+.|+  +.+++|+++..++.|+++++...
T Consensus         9 i~~~v~~g~~ilDiG~g~G~~~~~l~~~~~~~~v~avDi~~~~l~~a~~n~~~~~   63 (225)
T 3kr9_A            9 VASFVSQGAILLDVGSDHAYLPIELVERGQIKSAIAGEVVEGPYQSAVKNVEAHG   63 (225)
T ss_dssp             HHTTSCTTEEEEEETCSTTHHHHHHHHTTSEEEEEEEESSHHHHHHHHHHHHHTT
T ss_pred             HHHHCCCCCEEEEECCCHHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHHCC
T ss_conf             9955899898999618569999999980999889971099999999999999829


No 62 
>2e58_A MNMC2; tRNA wobble uridine, modification enzyme, genetic CODE, 5- methylaminomethyl-2-thiouridine, methyltransferase, 2-codon SETS; HET: SAM; 2.50A {Aquifex aeolicus VF5}
Probab=97.06  E-value=0.00015  Score=46.55  Aligned_cols=76  Identities=17%  Similarity=0.278  Sum_probs=52.9

Q ss_pred             CCCEECCCHHHHHHHCCCCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             27085172599897284147118984778761558713336785130013443577898999998899999999863968
Q gi|254780466|r   20 KDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPN   99 (375)
Q Consensus        20 ~nkI~~GDcl~~l~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvLK~~   99 (375)
                      .-.++.||..+.++.+++.++|+||-||-=          |.                 ..-.-|+.+++.+++++|+++
T Consensus       167 ~l~l~~GDa~~~l~~l~~~~~D~iflD~FS----------P~-----------------knPeLWs~e~f~~l~~~l~~~  219 (308)
T 2e58_A          167 SLKVLLGDARKRIKEVENFKADAVFHDAFS----------PY-----------------KNPELWTLDFLSLIKERIDEK  219 (308)
T ss_dssp             EEEEEESCHHHHTTTCCSCCEEEEEECCSC----------TT-----------------TSGGGGSHHHHHHHHTTEEEE
T ss_pred             EEEEEECHHHHHHHHHCCCCCCEEEECCCC----------CC-----------------CCCCCCCHHHHHHHHHHCCCC
T ss_conf             899981429998774204568889978999----------76-----------------683307899999999972899


Q ss_pred             CEEEEECCHHHHHHHHHHHHHCCCCE
Q ss_conf             72999834688899998764057860
Q gi|254780466|r  100 GTLWVIGSYHNIFRIGTMLQNLNFWI  125 (375)
Q Consensus       100 Gsi~v~~~~~~i~~i~~~l~~~gf~~  125 (375)
                      |.+.-   |-..-.|...|+++||.+
T Consensus       220 g~L~T---Yssag~VRr~L~~aGF~V  242 (308)
T 2e58_A          220 GYWVS---YSSSLSVRKSLLTLGFKV  242 (308)
T ss_dssp             EEEEE---SCCCHHHHHHHHHTTCEE
T ss_pred             CEEEE---EEEHHHHHHHHHHCCCEE
T ss_conf             28999---800499999999779989


No 63 
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana}
Probab=97.05  E-value=0.00043  Score=43.68  Aligned_cols=60  Identities=18%  Similarity=0.265  Sum_probs=51.5

Q ss_pred             CHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHC
Q ss_conf             189999999852899888998688851799999980981699972899999999999630
Q gi|254780466|r  209 PEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASV  268 (375)
Q Consensus       209 P~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~  268 (375)
                      |-..+..++.....++.-|||+=||+|..+....+.|.+-+|+|+++..++.|+++....
T Consensus        52 ~~~~l~~~~~~~~~~~~rVLdlGCG~G~~~~~la~~g~~V~giD~S~~ai~~a~~~~~~~  111 (235)
T 3lcc_A           52 ATPLIVHLVDTSSLPLGRALVPGCGGGHDVVAMASPERFVVGLDISESALAKANETYGSS  111 (235)
T ss_dssp             CCHHHHHHHHTTCSCCEEEEEETCTTCHHHHHHCBTTEEEEEECSCHHHHHHHHHHHTTS
T ss_pred             CCHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHC
T ss_conf             998999999857999994899438887899999866987999746699999999987641


No 64 
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima MSB8} SCOP: c.66.1.41
Probab=97.03  E-value=0.0024  Score=39.21  Aligned_cols=58  Identities=14%  Similarity=0.139  Sum_probs=51.2

Q ss_pred             HHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHH
Q ss_conf             8999999985289988899868885179999998098169997289999999999963
Q gi|254780466|r  210 EALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIAS  267 (375)
Q Consensus       210 ~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~  267 (375)
                      .+++.++|....++++.|||-=||+|..+....+.|.+.+|+|++++.+++|++|...
T Consensus        41 ~~~~~~~i~~~~~~~~~VLDiGCGtG~~~~~la~~g~~v~giD~S~~ml~~Ak~~~~~   98 (260)
T 2avn_A           41 HRLIGSFLEEYLKNPCRVLDLGGGTGKWSLFLQERGFEVVLVDPSKEMLEVAREKGVK   98 (260)
T ss_dssp             HHHHHHHHHHHCCSCCEEEEETCTTCHHHHHHHTTTCEEEEEESCHHHHHHHHHHTCS
T ss_pred             HHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHCCCEEEEEECHHHHHHHHHHHCCC
T ss_conf             9999999998579969899989999888999986199899993523788999883632


No 65 
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI- 2, protein structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51
Probab=96.98  E-value=0.0007  Score=42.42  Aligned_cols=69  Identities=19%  Similarity=0.292  Sum_probs=46.5

Q ss_pred             HCCCEECCCHHHHHHHCCC--CCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             3270851725998972841--47118984778761558713336785130013443577898999998899999999863
Q gi|254780466|r   19 WKDKIIKGNSISVLEKLPA--KSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVL   96 (375)
Q Consensus        19 ~~nkI~~GDcl~~l~~Lpd--~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvL   96 (375)
                      -.-+.+++|+++.|+.+..  +.+|+|+.|||.......             ...|    ...+|..   .-+..|.++|
T Consensus       203 ~~~~~i~~Da~~~l~~~~~~g~~fD~IilDPP~f~~~~k-------------~~~~----~~~~~~~---~l~~~~~~Ll  262 (332)
T 2igt_A          203 APIRWICEDAMKFIQREERRGSTYDIILTDPPKFGRGTH-------------GEVW----QLFDHLP---LMLDICREIL  262 (332)
T ss_dssp             SCEEEECSCHHHHHHHHHHHTCCBSEEEECCCSEEECTT-------------CCEE----EHHHHHH---HHHHHHHHTB
T ss_pred             CCEEEEECCHHHHHHHHHHHCCCCCEEEECCCCCCCCCC-------------CHHH----HHHHHHH---HHHHHHHHHC
T ss_conf             858999267999999999718997689978964466742-------------2488----9999999---9999999970


Q ss_pred             CCCCEEEEECC
Q ss_conf             96872999834
Q gi|254780466|r   97 KPNGTLWVIGS  107 (375)
Q Consensus        97 K~~Gsi~v~~~  107 (375)
                      +++|.+.+.++
T Consensus       263 ~pgG~~l~~~~  273 (332)
T 2igt_A          263 SPKALGLVLTA  273 (332)
T ss_dssp             CTTCCEEEEEE
T ss_pred             CCCCEEEEEEC
T ss_conf             69965999974


No 66 
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein, transferase; HET: TNA MTA; 1.66A {Methanothermobacterthermautotrophicus} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A*
Probab=96.98  E-value=0.004  Score=37.83  Aligned_cols=61  Identities=15%  Similarity=0.077  Sum_probs=48.2

Q ss_pred             CHHHHHHHHHH-CCCCCCEEEECCCCCH-HHH-HHHHHHCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             18999999985-2899888998688851-799-9999809816999728999999999996305
Q gi|254780466|r  209 PEALLSRILVS-STKPGDIILDPFFGSG-TSG-AVAKKLRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       209 P~~LleriI~~-~S~~gDiVLDPF~GSG-TT~-~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      .++|.+.-... .-++|+.|||-=||+| .|+ .+|+..|-+++|+|++++.++.|+++++...
T Consensus       107 y~~l~~~e~~~~~l~~g~rVLdiGcG~g~~t~~~~a~~~g~~V~gIDisp~~~~~Ar~~~~~~g  170 (298)
T 3fpf_A          107 YLELLKNEAALGRFRRGERAVFIGGGPLPLTGILLSHVYGMRVNVVEIEPDIAELSRKVIEGLG  170 (298)
T ss_dssp             HHHHHHHHHHHTTCCTTCEEEEECCCSSCHHHHHHHHTTCCEEEEEESSHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHCCCCCCCEEEEEECCCHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHCC
T ss_conf             9999999998548999998999606856999999985689989999699999999999798649


No 67 
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI, nysgxrc; 2.50A {Clostridium acetobutylicum atcc 824} SCOP: c.66.1.43
Probab=96.91  E-value=0.0026  Score=38.90  Aligned_cols=59  Identities=15%  Similarity=0.118  Sum_probs=50.8

Q ss_pred             HHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHC
Q ss_conf             89999999852899888998688851799999980981699972899999999999630
Q gi|254780466|r  210 EALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASV  268 (375)
Q Consensus       210 ~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~  268 (375)
                      .+.+..++.....++..|||.=||+|..+....+.|.+.+|+|+++..++.|++|....
T Consensus        24 ~~~~~~~~~~~~~~~~~iLDlGCGtG~~~~~l~~~g~~v~gvD~S~~ml~~a~~~~~~~   82 (246)
T 1y8c_A           24 SDFIIEKCVENNLVFDDYLDLACGTGNLTENLCPKFKNTWAVDLSQEMLSEAENKFRSQ   82 (246)
T ss_dssp             HHHHHHHHHTTTCCTTEEEEETCTTSTTHHHHGGGSSEEEEECSCHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCC
T ss_conf             99999999973899892999807462999999974995999967499999876311223


No 68 
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51
Probab=96.91  E-value=0.00059  Score=42.87  Aligned_cols=53  Identities=8%  Similarity=0.124  Sum_probs=43.1

Q ss_pred             HHHHHCCCCCCEEEECCCCCHHHHHHHHHHC-CEEEEEEECHHHHHHHHHHHHHC
Q ss_conf             9998528998889986888517999999809-81699972899999999999630
Q gi|254780466|r  215 RILVSSTKPGDIILDPFFGSGTSGAVAKKLR-RSFIGIEMKQDYIDIATKRIASV  268 (375)
Q Consensus       215 riI~~~S~~gDiVLDPF~GSGTT~~aA~~lg-R~~IGiE~~~~Y~~~a~~Rl~~~  268 (375)
                      +++.. -.+|.-|||.|+|+|.-+++|...| +.-+++|+++.+++.+++..+.-
T Consensus       205 ~l~~~-~~~g~rVLDlfs~tGgfsl~aa~~gA~~V~~vD~s~~a~~~a~~N~~~N  258 (385)
T 2b78_A          205 ELING-SAAGKTVLNLFSYTAAFSVAAAMGGAMATTSVDLAKRSRALSLAHFEAN  258 (385)
T ss_dssp             HHHHT-TTBTCEEEEETCTTTHHHHHHHHTTBSEEEEEESCTTHHHHHHHHHHHT
T ss_pred             HHHHH-HCCCCCEEEECCCCCHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHH
T ss_conf             99998-5599916863676878999998779958885267699999999989984


No 69 
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli}
Probab=96.90  E-value=0.019  Score=33.67  Aligned_cols=35  Identities=17%  Similarity=0.273  Sum_probs=23.4

Q ss_pred             HHHHHHHHHCCCCCEEEEECCHHH-HHHHHHHHHHC
Q ss_conf             999999986396872999834688-89999876405
Q gi|254780466|r   87 AWLLACRRVLKPNGTLWVIGSYHN-IFRIGTMLQNL  121 (375)
Q Consensus        87 ~wl~e~~RvLK~~Gsi~v~~~~~~-i~~i~~~l~~~  121 (375)
                      ..|..+...|+++|.||+.|.-.. +-.+...+++.
T Consensus        93 ~~l~~~~~~l~~g~~i~~~G~~~~gi~s~~k~l~~~  128 (343)
T 2pjd_A           93 FQLMNLLSLLPVGTDIFVVGENRSGVRSAEQMLADY  128 (343)
T ss_dssp             HHHHHHHTTSCTTCEEEEEEEGGGTGGGHHHHHTTT
T ss_pred             HHHHHHHHHCCCCCEEEEEECCCCCHHHHHHHHHHH
T ss_conf             999999974799977999974562678799999875


No 70 
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43
Probab=96.87  E-value=0.0068  Score=36.43  Aligned_cols=61  Identities=20%  Similarity=0.239  Sum_probs=53.2

Q ss_pred             CHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             1899999998528998889986888517999999809816999728999999999996305
Q gi|254780466|r  209 PEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       209 P~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      ....++.++.-..++++-|||.=||+|..+....+.|.+.+|+|++++.++.|+++.....
T Consensus        24 ~~~~l~~~~~~~~~~~~rVLDiGCG~G~~~~~la~~~~~v~g~D~s~~~l~~ak~~~~~~~   84 (227)
T 1ve3_A           24 RIETLEPLLMKYMKKRGKVLDLACGVGGFSFLLEDYGFEVVGVDISEDMIRKAREYAKSRE   84 (227)
T ss_dssp             HHHHHHHHHHHSCCSCCEEEEETCTTSHHHHHHHHTTCEEEEEESCHHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHCC
T ss_conf             9999999999847998979998688889999999659989999675046899999887527


No 71 
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum}
Probab=96.85  E-value=0.0013  Score=40.77  Aligned_cols=58  Identities=12%  Similarity=0.130  Sum_probs=32.2

Q ss_pred             HHHHHHHHHCC-CCCCEEEECCCCCHHHHH-HHHHHC--CEEEEEEECHHHHHHHHHHHHHC
Q ss_conf             99999998528-998889986888517999-999809--81699972899999999999630
Q gi|254780466|r  211 ALLSRILVSST-KPGDIILDPFFGSGTSGA-VAKKLR--RSFIGIEMKQDYIDIATKRIASV  268 (375)
Q Consensus       211 ~LleriI~~~S-~~gDiVLDPF~GSGTT~~-aA~~lg--R~~IGiE~~~~Y~~~a~~Rl~~~  268 (375)
                      .|+..+....- ...--||+-=.|+|-+.. .|..++  =+-+.||.+++++++|++.++..
T Consensus        43 ~~l~~La~~~~~~~~~~vlEiGt~~G~stl~la~al~~~g~l~tIE~~~e~~~~Ar~~~~~a  104 (221)
T 3dr5_A           43 QLLTTLAATTNGNGSTGAIAITPAAGLVGLYILNGLADNTTLTCIDPESEHQRQAKALFREA  104 (221)
T ss_dssp             HHHHHHHHHSCCTTCCEEEEESTTHHHHHHHHHHHSCTTSEEEEECSCHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHCCCCCCEEEEECCCHHHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHHC
T ss_conf             99999999851238998999728057999999984799978999989999999999999966


No 72 
>3bwc_A Spermidine synthase; SAM, SGPP, structural genomics, PSI, protein structure initiative; HET: MSE SAM; 2.30A {Trypanosoma cruzi strain cl brener} PDB: 3bwb_A*
Probab=96.84  E-value=0.002  Score=39.65  Aligned_cols=83  Identities=18%  Similarity=0.332  Sum_probs=55.7

Q ss_pred             HHHCCCEECCCHHHHHHHCCCCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             55327085172599897284147118984778761558713336785130013443577898999998899999999863
Q gi|254780466|r   17 FEWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVL   96 (375)
Q Consensus        17 ~~~~nkI~~GDcl~~l~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvL   96 (375)
                      .+=+-+++.+|+.+.++..++++.|+|+.|.+-..+                          ...--|+.++++.|+|.|
T Consensus       147 ~dprv~iii~D~~~~l~~~~~~~yDvIi~D~~dp~~--------------------------~~~~L~t~eFy~~~~~~L  200 (304)
T 3bwc_A          147 ADPRATVRVGDGLAFVRQTPDNTYDVVIIDTTDPAG--------------------------PASKLFGEAFYKDVLRIL  200 (304)
T ss_dssp             GCTTEEEEESCHHHHHHSSCTTCEEEEEEECC-----------------------------------CCHHHHHHHHHHE
T ss_pred             CCCCEEEEECHHHHHHHHCCCCCCCEEEEECCCCCC--------------------------CHHHHCCHHHHHHHHHHH
T ss_conf             498648998669999974634687689990899887--------------------------257654299999999983


Q ss_pred             CCCCEEEEECC--H---HHHHHHHHHHHHCCCCE
Q ss_conf             96872999834--6---88899998764057860
Q gi|254780466|r   97 KPNGTLWVIGS--Y---HNIFRIGTMLQNLNFWI  125 (375)
Q Consensus        97 K~~Gsi~v~~~--~---~~i~~i~~~l~~~gf~~  125 (375)
                      +++|.+.+.+.  +   .....+...+++.+|..
T Consensus       201 ~~~Gv~v~q~~s~~~~~~~~~~~~~~l~~~~F~~  234 (304)
T 3bwc_A          201 KPDGICCNQGESIWLDLELIEKMSRFIRETGFAS  234 (304)
T ss_dssp             EEEEEEEEEECCTTTCHHHHHHHHHHHHHHTCSE
T ss_pred             CCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCC
T ss_conf             7898899907885448899999999998736997


No 73 
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032}
Probab=96.81  E-value=0.003  Score=38.55  Aligned_cols=55  Identities=24%  Similarity=0.372  Sum_probs=49.6

Q ss_pred             HHHHHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             9998528998889986888517999999809816999728999999999996305
Q gi|254780466|r  215 RILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       215 riI~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      ++|....++|..|||.=||+|..+....+.|.+.+|+|++++.++.|++|..++.
T Consensus        38 ~ll~~~~~~~~~vLDlGCG~G~~~~~l~~~~~~v~giD~s~~~i~~a~~~~~~~~   92 (195)
T 3cgg_A           38 RLIDAMAPRGAKILDAGCGQGRIGGYLSKQGHDVLGTDLDPILIDYAKQDFPEAR   92 (195)
T ss_dssp             HHHHHHSCTTCEEEEETCTTTHHHHHHHHTTCEEEEEESCHHHHHHHHHHCTTSE
T ss_pred             HHHHHCCCCCCEEEEECCCCCHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCC
T ss_conf             9999658999989997688859999999769989999797277899997302543


No 74 
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans}
Probab=96.80  E-value=0.0031  Score=38.47  Aligned_cols=61  Identities=15%  Similarity=0.221  Sum_probs=51.3

Q ss_pred             CCHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHC
Q ss_conf             8189999999852899888998688851799999980981699972899999999999630
Q gi|254780466|r  208 KPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASV  268 (375)
Q Consensus       208 KP~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~  268 (375)
                      -|+.+.+..+.-.-.||.-|||-=||+|..+..-.+.|.+.+|+|++++.++.|+++..+.
T Consensus        33 ~~~~~~~~~l~~~l~pg~rVLDvGCGtG~~a~~La~~g~~V~giD~S~~mi~~Ar~~~~~~   93 (226)
T 3m33_A           33 DPELTFDLWLSRLLTPQTRVLEAGCGHGPDAARFGPQAARWAAYDFSPELLKLARANAPHA   93 (226)
T ss_dssp             CTTHHHHHHHHHHCCTTCEEEEESCTTSHHHHHHGGGSSEEEEEESCHHHHHHHHHHCTTS
T ss_pred             CHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHCCCCEEEECCCCHHHHHHHHHHCCCC
T ss_conf             8679999999951899997999884658645777516868996579999999999858999


No 75 
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A
Probab=96.76  E-value=0.0051  Score=37.18  Aligned_cols=66  Identities=15%  Similarity=0.204  Sum_probs=49.8

Q ss_pred             CCCCCCHHHHHH----HHHHC-CCCCCEEEECCCCCHHHHHHHHHHC--CEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             687781899999----99852-8998889986888517999999809--816999728999999999996305
Q gi|254780466|r  204 HPTQKPEALLSR----ILVSS-TKPGDIILDPFFGSGTSGAVAKKLR--RSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       204 HPTqKP~~Ller----iI~~~-S~~gDiVLDPF~GSGTT~~aA~~lg--R~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      .-||+|..|-++    ++... ...|.-|||-.||+|..+....+.+  .+.+|+|+++..++.|+++++...
T Consensus         5 ~~~~~~~~l~~~r~~~v~~~l~~~~~~rVLDvGCG~G~~~~~La~~~~~~~v~gvD~s~~~l~~a~~~~~~~~   77 (219)
T 3jwg_A            5 EETEKKLNLNQQRLGTVVAVLKSVNAKKVIDLGCGEGNLLSLLLKDKSFEQITGVDVSYSVLERAKDRLKIDR   77 (219)
T ss_dssp             -------CHHHHHHHHHHHHHHHTTCCEEEEETCTTCHHHHHHHTSTTCCEEEEEESCHHHHHHHHHHHTGGG
T ss_pred             CCCCCCCCHHHHHHHHHHHHCCCCCCCEEEEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHCC
T ss_conf             4545787799999999999641128498999818789999999983897456322599999999999865504


No 76 
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C*
Probab=96.73  E-value=0.0063  Score=36.62  Aligned_cols=130  Identities=15%  Similarity=0.178  Sum_probs=71.3

Q ss_pred             CCCCC--CHHHHHHHHHHCCCCCCEEEECCCCCHHHH-HHHHHHCC--EEEEEEECHHHHHHHHHHHHHCCCCCHHHHCC
Q ss_conf             68778--189999999852899888998688851799-99998098--16999728999999999996305687656302
Q gi|254780466|r  204 HPTQK--PEALLSRILVSSTKPGDIILDPFFGSGTSG-AVAKKLRR--SFIGIEMKQDYIDIATKRIASVQPLGNIELTV  278 (375)
Q Consensus       204 HPTqK--P~~LleriI~~~S~~gDiVLDPF~GSGTT~-~aA~~lgR--~~IGiE~~~~Y~~~a~~Rl~~~~~~~~~~~~~  278 (375)
                      |.||-  |...-.-+..+--.+|+.|||--+|||... ..|...+-  +-+|+|++++.++.|+++++...-.+...+..
T Consensus        72 r~~qiiyp~d~~~Ii~~l~i~pG~rVLd~G~GsG~lt~~lar~~~~~G~V~~~D~~~~~~~~A~~n~~~~gl~~~v~~~~  151 (255)
T 3mb5_A           72 RGPQIVHPKDAALIVAYAGISPGDFIVEAGVGSGALTLFLANIVGPEGRVVSYEIREDFAKLAWENIKWAGFDDRVTIKL  151 (255)
T ss_dssp             CCSCCCCHHHHHHHHHHTTCCTTCEEEEECCTTSHHHHHHHHHHCTTSEEEEECSCHHHHHHHHHHHHHHTCTTTEEEEC
T ss_pred             CCCCCCCHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHHCCCCEEEEEEE
T ss_conf             88746588999999997198989989988866279999999743889779983499999999999999719981499994


Q ss_pred             CCCCCCCCCCCHHHHHHCCCCCCCCEEECCCCCEEEEECCCCCEEECCEECCHHHHHHHHCC
Q ss_conf             44433377552346988286587765766898069998159817869865319999987449
Q gi|254780466|r  279 LTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTLISGTELGSIHRVGAKVSG  340 (375)
Q Consensus       279 ~~~~~~~~rvpfg~lie~g~l~~g~~L~~~~~~~~a~v~~DG~l~~~~~~gsIh~i~a~~~~  340 (375)
                      .+.....+...|.. |.-.+-.|-+.|-    ......+++|.|+.  ..-+|+|+...++.
T Consensus       152 ~D~~~~~~~~~~D~-V~ld~p~p~~~l~----~~~~~LkpGG~lv~--~~p~~~q~~~~~~~  206 (255)
T 3mb5_A          152 KDIYEGIEEENVDH-VILDLPQPERVVE----HAAKALKPGGFFVA--YTPCSNQVMRLHEK  206 (255)
T ss_dssp             SCGGGCCCCCSEEE-EEECSSCGGGGHH----HHHHHEEEEEEEEE--EESSHHHHHHHHHH
T ss_pred             CCHHCCCCCCCCCE-EEEECCCHHHHHH----HHHHHCCCCCEEEE--EECCHHHHHHHHHH
T ss_conf             61103555565657-9996685678999----99985689988999--93998999999999


No 77 
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 1pry_A
Probab=96.72  E-value=0.0029  Score=38.64  Aligned_cols=50  Identities=22%  Similarity=0.296  Sum_probs=42.0

Q ss_pred             CCCCCCEEEECCCCCHHHH-HHHHHHC--CEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             2899888998688851799-9999809--816999728999999999996305
Q gi|254780466|r  220 STKPGDIILDPFFGSGTSG-AVAKKLR--RSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       220 ~S~~gDiVLDPF~GSGTT~-~aA~~lg--R~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      --+||+.|||-.||+|+|. .+|...|  -+-+|+|+++..++.+.++.+...
T Consensus        70 ~i~pG~~VLDlG~G~G~~~~~la~~vg~~G~V~avD~s~~~l~~l~~~~~~~~  122 (227)
T 1g8a_A           70 PIKPGKSVLYLGIASGTTASHVSDIVGWEGKIFGIEFSPRVLRELVPIVEERR  122 (227)
T ss_dssp             CCCTTCEEEEETTTSTTHHHHHHHHHCTTSEEEEEESCHHHHHHHHHHHSSCT
T ss_pred             CCCCCCEEEEEECCCCHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHCC
T ss_conf             98999999997178788999999984899669999899999999998787669


No 78 
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1, methyltransferase domain, structural genomics; HET: PGE GOL; 2.00A {Clostridium acetobutylicum}
Probab=96.68  E-value=0.0054  Score=37.03  Aligned_cols=57  Identities=18%  Similarity=0.076  Sum_probs=46.0

Q ss_pred             HHHHHHH--CCCCCCEEEECCCCCHH-HHHHHHHHCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             9999985--28998889986888517-999999809816999728999999999996305
Q gi|254780466|r  213 LSRILVS--STKPGDIILDPFFGSGT-SGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       213 leriI~~--~S~~gDiVLDPF~GSGT-T~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      ++|.|..  .++.+..|||.=||+|. |...+.+.|.+.+|+|+++..++.|++|.+...
T Consensus        11 l~r~l~~~~~~~~~~~VLDiGcG~G~~~~~~~~~~~~~v~gvD~S~~~i~~a~~~~~~~~   70 (209)
T 2p8j_A           11 LYRFLKYCNESNLDKTVLDCGAGGDLPPLSIFVEDGYKTYGIEISDLQLKKAENFSRENN   70 (209)
T ss_dssp             HHHHHHHHHHSSSCSEEEEESCCSSSCTHHHHHHTTCEEEEEECCHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHCCCCCCCEEEEEECCCCHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHCCC
T ss_conf             999999730106989899972788999999998589989999597999999986220357


No 79 
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural genomics, NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus VF5}
Probab=96.64  E-value=0.0089  Score=35.70  Aligned_cols=135  Identities=17%  Similarity=0.133  Sum_probs=77.4

Q ss_pred             CCCCC--CHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHCCCCCHHHHCCCCC
Q ss_conf             68778--1899999998528998889986888517999999809816999728999999999996305687656302444
Q gi|254780466|r  204 HPTQK--PEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTG  281 (375)
Q Consensus       204 HPTqK--P~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~~~~~~~~~~~~~  281 (375)
                      |-||-  |...-.-+..+--.||+.|||.-+|||...+...+.+-+-+++|++++.++.|++.+++..-.++..+...+.
T Consensus        70 r~~qiiypkD~~~Ii~~l~i~pG~rVLEiGtGsG~lt~~La~~~g~v~t~e~~e~~~~~A~~n~~~~g~~~nv~~~~~D~  149 (248)
T 2yvl_A           70 RKTQIIYPKDSFYIALKLNLNKEKRVLEFGTGSGALLAVLSEVAGEVWTFEAVEEFYKTAQKNLKKFNLGKNVKFFNVDF  149 (248)
T ss_dssp             CSSCCCCHHHHHHHHHHTTCCTTCEEEEECCTTSHHHHHHHHHSSEEEEECSCHHHHHHHHHHHHHTTCCTTEEEECSCT
T ss_pred             CCCCCCCHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHHCCCCCEEEEECCH
T ss_conf             88740678999999998289999979973743119999998607879998288999999999899700577059999122


Q ss_pred             CC-CCCCCCHHHHHHCCCCCCCCEEECCCCCEEEEECCCCCEEECCEECCHHHHHHHHCCCCCCCCE
Q ss_conf             33-3775523469882865877657668980699981598178698653199999874498100671
Q gi|254780466|r  282 KR-TEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTLISGTELGSIHRVGAKVSGSETCNGW  347 (375)
Q Consensus       282 ~~-~~~rvpfg~lie~g~l~~g~~L~~~~~~~~a~v~~DG~l~~~~~~gsIh~i~a~~~~~~~cNGw  347 (375)
                      .. ..+...|.. |.-.+..|-+.|-    ......+++|.|+.  -.-+|.|+...++..+  ++|
T Consensus       150 ~~~~~~~~~fD~-V~ld~p~p~~~l~----~~~~~LKpGG~lv~--~~P~i~Qv~~~~~~l~--~~f  207 (248)
T 2yvl_A          150 KDAEVPEGIFHA-AFVDVREPWHYLE----KVHKSLMEGAPVGF--LLPTANQVIKLLESIE--NYF  207 (248)
T ss_dssp             TTSCCCTTCBSE-EEECSSCGGGGHH----HHHHHBCTTCEEEE--EESSHHHHHHHHHHST--TTE
T ss_pred             HHCCCCCCCCCE-EEEECCCHHHHHH----HHHHHCCCCCEEEE--EECCHHHHHHHHHHHH--HCC
T ss_conf             214324587899-9991787688899----99984288978999--9297999999999997--086


No 80 
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638}
Probab=96.63  E-value=0.0013  Score=40.82  Aligned_cols=53  Identities=25%  Similarity=0.219  Sum_probs=32.5

Q ss_pred             CEECCCHHHHHHHCCCCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCE
Q ss_conf             08517259989728414711898477876155871333678513001344357789899999889999999986396872
Q gi|254780466|r   22 KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGT  101 (375)
Q Consensus        22 kI~~GDcl~~l~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvLK~~Gs  101 (375)
                      .+++||..+.++....+++|+|++||||..                           ..    ...++..+.+.|++.|.
T Consensus       224 ~~~~~d~~~~~~~~~~~~fD~v~~dpp~~~---------------------------~~----~~~~l~r~~~~l~~~g~  272 (373)
T 2qm3_A          224 EIFTFDLRKPLPDYALHKFDTFITDPPETL---------------------------EA----IRAFVGRGIATLKGPRC  272 (373)
T ss_dssp             EEECCCTTSCCCTTTSSCBSEEEECCCSSH---------------------------HH----HHHHHHHHHHTBCSTTC
T ss_pred             EEEECHHHHHHHHHCCCCCCEEEECCCCCC---------------------------CC----HHHHHHHHHHHHCCCCC
T ss_conf             998530866324540788898998999864---------------------------42----77999999998456762


Q ss_pred             EEEE
Q ss_conf             9998
Q gi|254780466|r  102 LWVI  105 (375)
Q Consensus       102 i~v~  105 (375)
                      ..++
T Consensus       273 ~~~~  276 (373)
T 2qm3_A          273 AGYF  276 (373)
T ss_dssp             EEEE
T ss_pred             EEEE
T ss_conf             7999


No 81 
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase, structural genomics; 1.90A {Anabaena variabilis atcc 29413}
Probab=96.59  E-value=0.008  Score=36.00  Aligned_cols=61  Identities=23%  Similarity=0.322  Sum_probs=50.6

Q ss_pred             CCCCHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             7781899999998528998889986888517999999809816999728999999999996305
Q gi|254780466|r  206 TQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       206 TqKP~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      .+....|++++   ...+|+.|||-=||+|..+....+.|-+.+|+|++++.++.|++|+.++.
T Consensus        43 ~~~~~~ll~~l---~~~~g~~VLDiGcG~G~~~~~la~~~~~v~giD~s~~ml~~a~~~~~~~~  103 (279)
T 3ccf_A           43 WQYGEDLLQLL---NPQPGEFILDLGCGTGQLTEKIAQSGAEVLGTDNAATMIEKARQNYPHLH  103 (279)
T ss_dssp             SSSCCHHHHHH---CCCTTCEEEEETCTTSHHHHHHHHTTCEEEEEESCHHHHHHHHHHCTTSC
T ss_pred             HHHHHHHHHCC---CCCCCCEEEEECCCCCHHHHHHHHCCCEEEEEECHHHHHHHHHHHCCCCC
T ss_conf             99999999706---99996999993585859999999649989999163889999986165431


No 82 
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; NP_988299.1, structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis}
Probab=96.57  E-value=0.0057  Score=36.89  Aligned_cols=59  Identities=20%  Similarity=0.201  Sum_probs=49.6

Q ss_pred             HHHHHHHHHCCCCCCEEEECCCCCHHHHHH-HHHHCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             999999985289988899868885179999-99809816999728999999999996305
Q gi|254780466|r  211 ALLSRILVSSTKPGDIILDPFFGSGTSGAV-AKKLRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       211 ~LleriI~~~S~~gDiVLDPF~GSGTT~~a-A~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      .|.++++....-++..|||-=||+|..+.. |++.+.+.+|+|++++.++.|++++....
T Consensus        31 ~~~~~i~~~~~~~~~~VLDiGcG~G~~~~~la~~~~~~v~giD~s~~~l~~a~~~~~~~~   90 (219)
T 3dlc_A           31 IIAENIINRFGITAGTCIDIGSGPGALSIALAKQSDFSIRALDFSKHMNEIALKNIADAN   90 (219)
T ss_dssp             HHHHHHHHHHCCCEEEEEEETCTTSHHHHHHHHHSEEEEEEEESCHHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHHCCCCCCEEEEECCCCCHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCC
T ss_conf             999999997299999399962758599999995369989999797899999987444216


No 83 
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum dsm 1728} SCOP: c.66.1.13
Probab=96.55  E-value=0.0069  Score=36.38  Aligned_cols=55  Identities=24%  Similarity=0.336  Sum_probs=44.0

Q ss_pred             HHCCCCCCEEEECCCCCHH-HHHHHHHHC--CEEEEEEECHHHHHHHHHHHHHCCCCC
Q ss_conf             8528998889986888517-999999809--816999728999999999996305687
Q gi|254780466|r  218 VSSTKPGDIILDPFFGSGT-SGAVAKKLR--RSFIGIEMKQDYIDIATKRIASVQPLG  272 (375)
Q Consensus       218 ~~~S~~gDiVLDPF~GSGT-T~~aA~~lg--R~~IGiE~~~~Y~~~a~~Rl~~~~~~~  272 (375)
                      .+--.||+.|||.=+|||. |...|..++  =+.+++|++++.++.|+++++......
T Consensus       105 ~l~i~PG~rVLEiG~GsG~lt~~LA~~v~~~g~V~~vD~~e~~~~~A~~n~~~~~~~~  162 (275)
T 1yb2_A          105 RCGLRPGMDILEVGVGSGNMSSYILYALNGKGTLTVVERDEDNLKKAMDNLSEFYDIG  162 (275)
T ss_dssp             -CCCCTTCEEEEECCTTSHHHHHHHHHHTTSSEEEEECSCHHHHHHHHHHHHTTSCCT
T ss_pred             HCCCCCCCEEEEECCCCCHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHHHCCCC
T ss_conf             7199997989995771878999999860899589999088999999998677631567


No 84 
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15}
Probab=96.52  E-value=0.011  Score=35.15  Aligned_cols=58  Identities=19%  Similarity=0.403  Sum_probs=45.3

Q ss_pred             HHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             899999998528998889986888517999999809816999728999999999996305
Q gi|254780466|r  210 EALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       210 ~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      ..+++++. ..-++|+.|||.=||+|..+....+ |-+.+|+|++++.++.|++|.....
T Consensus        21 ~~~~~~i~-~~~~~~~~VLD~GCG~G~~~~~la~-~~~v~giD~s~~~l~~a~~~~~~~~   78 (243)
T 3d2l_A           21 PEWVAWVL-EQVEPGKRIADIGCGTGTATLLLAD-HYEVTGVDLSEEMLEIAQEKAMETN   78 (243)
T ss_dssp             HHHHHHHH-HHSCTTCEEEEESCTTCHHHHHHTT-TSEEEEEESCHHHHHHHHHHHHHTT
T ss_pred             HHHHHHHH-HHCCCCCEEEEECCCCCHHHHHHHH-CCEEEEEECCHHHHHHHHHHHHHCC
T ss_conf             99999999-8689999999968878799999861-8579999885188999887653012


No 85 
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae}
Probab=96.52  E-value=0.0078  Score=36.04  Aligned_cols=51  Identities=14%  Similarity=0.121  Sum_probs=44.1

Q ss_pred             HCCCCCCEEEECCCCCHHHHHHHHHHC--CEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             528998889986888517999999809--816999728999999999996305
Q gi|254780466|r  219 SSTKPGDIILDPFFGSGTSGAVAKKLR--RSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       219 ~~S~~gDiVLDPF~GSGTT~~aA~~lg--R~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      ..-.||+.|||-.||||..+..|.+++  -+-+|+|++++.++.++++..+..
T Consensus        21 L~~~pg~~vLDiGcG~G~~a~~~a~~~~~~~V~avD~~~~~~~~a~~~~~~~~   73 (178)
T 3hm2_A           21 LAPKPHETLWDIGGGSGSIAIEWLRSTPQTTAVCFEISEERRERILSNAINLG   73 (178)
T ss_dssp             HCCCTTEEEEEESTTTTHHHHHHHTTSSSEEEEEECSCHHHHHHHHHHHHTTT
T ss_pred             CCCCCCCEEEEECCCCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHC
T ss_conf             59999799999766888899999996897769885089999999999999819


No 86 
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes}
Probab=96.50  E-value=0.0048  Score=37.34  Aligned_cols=47  Identities=19%  Similarity=0.360  Sum_probs=39.5

Q ss_pred             CCCCEEEECCCCCHHHHHH-HHHHCCEEEEEEECHHHHHHHHHHHHHC
Q ss_conf             9988899868885179999-9980981699972899999999999630
Q gi|254780466|r  222 KPGDIILDPFFGSGTSGAV-AKKLRRSFIGIEMKQDYIDIATKRIASV  268 (375)
Q Consensus       222 ~~gDiVLDPF~GSGTT~~a-A~~lgR~~IGiE~~~~Y~~~a~~Rl~~~  268 (375)
                      .++..|||.-+|||..+.+ |++.+.+.+|+|++++++++|++.++.-
T Consensus        48 ~~~~~vLDlG~G~G~~~l~la~~~~~~v~~vDi~~~~~~~A~~N~~~n   95 (259)
T 3lpm_A           48 IRKGKIIDLCSGNGIIPLLLSTRTKAKIVGVEIQERLADMAKRSVAYN   95 (259)
T ss_dssp             SSCCEEEETTCTTTHHHHHHHTTCCCEEEEECCSHHHHHHHHHHHHHT
T ss_pred             CCCCEEEEEECCCCHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHC
T ss_conf             679979997258589999998678988999999899999999999860


No 87 
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1
Probab=96.46  E-value=0.019  Score=33.75  Aligned_cols=112  Identities=13%  Similarity=0.128  Sum_probs=71.3

Q ss_pred             CHHHHHHHHHHC-CCCCCEEEECCCCCHH-HHHHHHHHCC--EEEEEEECHHHHHHHHHHHHHCCCCCHHHH------C-
Q ss_conf             189999999852-8998889986888517-9999998098--169997289999999999963056876563------0-
Q gi|254780466|r  209 PEALLSRILVSS-TKPGDIILDPFFGSGT-SGAVAKKLRR--SFIGIEMKQDYIDIATKRIASVQPLGNIEL------T-  277 (375)
Q Consensus       209 P~~LleriI~~~-S~~gDiVLDPF~GSGT-T~~aA~~lgR--~~IGiE~~~~Y~~~a~~Rl~~~~~~~~~~~------~-  277 (375)
                      ...+..+++... -++|+.|||-=+|||- |+..|+.+|.  +-+++|++++-++.|++++++..- .+..+      . 
T Consensus        60 ~P~~~A~ml~~L~l~~g~~VLeIGtGtGy~aa~la~~~~~~~~V~~iE~~~~l~~~A~~~l~~~g~-~nv~~~~gD~~~g  138 (317)
T 1dl5_A           60 QPSLMALFMEWVGLDKGMRVLEIGGGTGYNAAVMSRVVGEKGLVVSVEYSRKICEIAKRNVERLGI-ENVIFVCGDGYYG  138 (317)
T ss_dssp             CHHHHHHHHHHTTCCTTCEEEEECCTTSHHHHHHHHHHCTTCEEEEEESCHHHHHHHHHHHHHTTC-CSEEEEESCGGGC
T ss_pred             HHHHHHHHHHHCCCCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCC-CCEEEEECCHHHC
T ss_conf             799999999971899999899917976476899988618886799995781789999998997357-8739998955758


Q ss_pred             --------CCCCCCCCCCCCHHHHHHCCCCCCCCEEECC-------CCCEEEEECCCCCEEE
Q ss_conf             --------2444333775523469882865877657668-------9806999815981786
Q gi|254780466|r  278 --------VLTGKRTEPRVAFNLLVERGLIQPGQILTNA-------QGNISATVCADGTLIS  324 (375)
Q Consensus       278 --------~~~~~~~~~rvpfg~lie~g~l~~g~~L~~~-------~~~~~a~v~~DG~l~~  324 (375)
                              ..-..-..+.+|- .|++.  |+||-.|.-.       ........+.||++..
T Consensus       139 ~~~~~~fD~Iiv~~~~~~ip~-~l~~q--LkpGG~lV~pvg~~~~~~~~~~~~~~~~~~~~~  197 (317)
T 1dl5_A          139 VPEFSPYDVIFVTVGVDEVPE-TWFTQ--LKEGGRVIVPINLKLSRRQPAFLFKKKDPYLVG  197 (317)
T ss_dssp             CGGGCCEEEEEECSBBSCCCH-HHHHH--EEEEEEEEEEBCBGGGTBCEEEEEEEETTEEEE
T ss_pred             CCCCCCCCEEEECCCHHHHHH-HHHHH--CCCCCEEEEEECCCCCCEEEEEEEEEECCEEEE
T ss_conf             877899419999687688589-99984--388939999983367867899999982991899


No 88 
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46
Probab=96.43  E-value=0.0013  Score=40.71  Aligned_cols=58  Identities=24%  Similarity=0.500  Sum_probs=37.1

Q ss_pred             CCEECCCHHHHHHHCCCC-CCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             708517259989728414-7118984778761558713336785130013443577898999998899999999863968
Q gi|254780466|r   21 DKIIKGNSISVLEKLPAK-SVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPN   99 (375)
Q Consensus        21 nkI~~GDcl~~l~~Lpd~-sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvLK~~   99 (375)
                      -.+...|++..++....+ .+|+||.||||..                           ..|.. ..+.+.+ ..+|+++
T Consensus       106 ~~~~~~d~~~~l~~~~~~~~fDlIFlDPPY~~---------------------------~~~~~-~l~~L~~-~~~L~~~  156 (201)
T 2ift_A          106 AEVINQSSLDFLKQPQNQPHFDVVFLDPPFHF---------------------------NLAEQ-AISLLCE-NNWLKPN  156 (201)
T ss_dssp             EEEECSCHHHHTTSCCSSCCEEEEEECCCSSS---------------------------CHHHH-HHHHHHH-TTCEEEE
T ss_pred             HEEEEHHHHHHHHHCCCCCCCCEEEECCCCCC---------------------------CHHHH-HHHHHHH-CCCCCCC
T ss_conf             02320345655430024676655885797555---------------------------27999-9999998-7993988


Q ss_pred             CEEEEECC
Q ss_conf             72999834
Q gi|254780466|r  100 GTLWVIGS  107 (375)
Q Consensus       100 Gsi~v~~~  107 (375)
                      |-+++-.+
T Consensus       157 ~liilE~~  164 (201)
T 2ift_A          157 ALIYVETE  164 (201)
T ss_dssp             EEEEEEEE
T ss_pred             EEEEEEEC
T ss_conf             19999965


No 89 
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae}
Probab=96.42  E-value=0.012  Score=34.98  Aligned_cols=53  Identities=13%  Similarity=-0.009  Sum_probs=46.4

Q ss_pred             HHHCCCCCCEEEECCCCCHHHHHHHHHHCC--EEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             985289988899868885179999998098--16999728999999999996305
Q gi|254780466|r  217 LVSSTKPGDIILDPFFGSGTSGAVAKKLRR--SFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       217 I~~~S~~gDiVLDPF~GSGTT~~aA~~lgR--~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      |...-++|+.|+|-=+|+|..++++.+.|+  +.|++|+++..++.|+++++.-.
T Consensus        15 ia~~v~~g~~vlDIG~g~G~l~i~l~~~~~~~~viavDi~~~~l~~A~~n~~~~g   69 (230)
T 3lec_A           15 VANYVPKGARLLDVGSDHAYLPIFLLQMGYCDFAIAGEVVNGPYQSALKNVSEHG   69 (230)
T ss_dssp             HHTTSCTTEEEEEETCSTTHHHHHHHHTTCEEEEEEEESSHHHHHHHHHHHHHTT
T ss_pred             HHHHCCCCCEEEEECCCHHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHHCC
T ss_conf             9965899899999528649999999983999879993099999999999999839


No 90 
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; NP_988299.1, structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis}
Probab=96.40  E-value=0.0027  Score=38.87  Aligned_cols=20  Identities=25%  Similarity=0.408  Sum_probs=13.6

Q ss_pred             HHHHHHHHHCCCCCEEEEEC
Q ss_conf             99999998639687299983
Q gi|254780466|r   87 AWLLACRRVLKPNGTLWVIG  106 (375)
Q Consensus        87 ~wl~e~~RvLK~~Gsi~v~~  106 (375)
                      ..|.+++|+|||+|.+++..
T Consensus       129 ~~l~~~~r~LkpgG~l~i~~  148 (219)
T 3dlc_A          129 TAFREIYRILKSGGKTYIGG  148 (219)
T ss_dssp             HHHHHHHHHEEEEEEEEEEE
T ss_pred             HHHHHHHHHCCCCCEEEEEE
T ss_conf             99999999858083899996


No 91 
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomics, JCSG, PSI, protein structure initiative; 1.65A {Thermotoga maritima} SCOP: c.66.1.13
Probab=96.40  E-value=0.02  Score=33.63  Aligned_cols=132  Identities=13%  Similarity=0.163  Sum_probs=73.6

Q ss_pred             CHHHHHHHHHHCCCCCCEEEECCCCCHHHHH-HHHHHC--CEEEEEEECHHHHHHHHHHHHHCCCCCHHHHCCCCCCCCC
Q ss_conf             1899999998528998889986888517999-999809--8169997289999999999963056876563024443337
Q gi|254780466|r  209 PEALLSRILVSSTKPGDIILDPFFGSGTSGA-VAKKLR--RSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRTE  285 (375)
Q Consensus       209 P~~LleriI~~~S~~gDiVLDPF~GSGTT~~-aA~~lg--R~~IGiE~~~~Y~~~a~~Rl~~~~~~~~~~~~~~~~~~~~  285 (375)
                      |...-.-+-++--.||+.|||.-+|||.... .|..++  -+.+++|++++.++.|++++++..-.+...+...+.....
T Consensus        98 pkD~~~Ii~~ldi~pG~~VLDiG~GsG~lt~~lA~~v~~~g~V~~~D~~~~~~~~A~~n~~~~gl~~~v~~~~~D~~~~~  177 (277)
T 1o54_A           98 PKDSSFIAMMLDVKEGDRIIDTGVGSGAMCAVLARAVGSSGKVFAYEKREEFAKLAESNLTKWGLIERVTIKVRDISEGF  177 (277)
T ss_dssp             HHHHHHHHHHTTCCTTCEEEEECCTTSHHHHHHHHHTTTTCEEEEECCCHHHHHHHHHHHHHTTCGGGEEEECCCGGGCC
T ss_pred             HHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHCCCCEEEEEEECCHHHHHHHHHHHHHCCCCCCEEEEECCCCCCC
T ss_conf             89999999980899999899768882799999998518980999996889999999998997499876799968622444


Q ss_pred             CCCCHHHHHHCCCCCCCCEEECCCCCEEEEECCCCCEEECCEECCHHHHHHHHCCCCCCCCEE
Q ss_conf             755234698828658776576689806999815981786986531999998744981006711
Q gi|254780466|r  286 PRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTLISGTELGSIHRVGAKVSGSETCNGWN  348 (375)
Q Consensus       286 ~rvpfg~lie~g~l~~g~~L~~~~~~~~a~v~~DG~l~~~~~~gsIh~i~a~~~~~~~cNGw~  348 (375)
                      +..+|.. |...+-.|-+.|    ......+++.|.|+.  -.-+|.|+...++-... +||.
T Consensus       178 ~~~~~D~-V~ld~p~p~~~l----~~~~~~LKpGG~lv~--~~P~i~Qv~~~~~~L~~-~gF~  232 (277)
T 1o54_A          178 DEKDVDA-LFLDVPDPWNYI----DKCWEALKGGGRFAT--VCPTTNQVQETLKKLQE-LPFI  232 (277)
T ss_dssp             SCCSEEE-EEECCSCGGGTH----HHHHHHEEEEEEEEE--EESSHHHHHHHHHHHHH-SSEE
T ss_pred             CCCCCCE-EECCCCCHHHHH----HHHHHHCCCCCEEEE--EECCHHHHHHHHHHHHH-CCCE
T ss_conf             4445410-221789989999----999973589989999--95978999999999998-7981


No 92 
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus HB27}
Probab=96.39  E-value=0.019  Score=33.75  Aligned_cols=128  Identities=18%  Similarity=0.226  Sum_probs=70.9

Q ss_pred             HHHHHH-HCCCCCCEEEECCCCCHHHHHH-HHHHC--CEEEEEEECHHHHHHHHHHHHHCCCCCHHHHCCCCCCC-CCCC
Q ss_conf             999998-5289988899868885179999-99809--81699972899999999999630568765630244433-3775
Q gi|254780466|r  213 LSRILV-SSTKPGDIILDPFFGSGTSGAV-AKKLR--RSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKR-TEPR  287 (375)
Q Consensus       213 leriI~-~~S~~gDiVLDPF~GSGTT~~a-A~~lg--R~~IGiE~~~~Y~~~a~~Rl~~~~~~~~~~~~~~~~~~-~~~r  287 (375)
                      +..++. +--.||+.|||.-+|||....+ |...+  -+.+|+|++++.++.|+++++...-.....+...+... ..+-
T Consensus        85 ~~~Ii~~l~i~pG~~VLEiG~GsG~lt~~lA~~v~~~g~V~~~d~~~~~~~~A~~n~~~~~~~~~v~~~~~d~~~~~~~~  164 (258)
T 2pwy_A           85 ASAMVTLLDLAPGMRVLEAGTGSGGLTLFLARAVGEKGLVESYEARPHHLAQAERNVRAFWQVENVRFHLGKLEEAELEE  164 (258)
T ss_dssp             HHHHHHHTTCCTTCEEEEECCTTSHHHHHHHHHHCTTSEEEEEESCHHHHHHHHHHHHHHCCCCCEEEEESCGGGCCCCT
T ss_pred             HHHHHHHCCCCCCCEEEECCCCHHHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHHCCCCCCEEEEECCHHHCCCCC
T ss_conf             99999971989999999877706799999999728873899984899999999999998089985568836578855556


Q ss_pred             CCHHHHHHCCCCCCCCEEECCCCCEEEEECCCCCEEECCEECCHHHHHHHHCCCCCCCCEE
Q ss_conf             5234698828658776576689806999815981786986531999998744981006711
Q gi|254780466|r  288 VAFNLLVERGLIQPGQILTNAQGNISATVCADGTLISGTELGSIHRVGAKVSGSETCNGWN  348 (375)
Q Consensus       288 vpfg~lie~g~l~~g~~L~~~~~~~~a~v~~DG~l~~~~~~gsIh~i~a~~~~~~~cNGw~  348 (375)
                      ..|.. |.-.+..|-+.|-    ...-..+++|.|+.  ...+|.|+...++..+. +||.
T Consensus       165 ~~~d~-v~ld~p~p~~~l~----~~~~~LKpGG~lv~--~~p~~~Q~~~~~~~l~~-~gf~  217 (258)
T 2pwy_A          165 AAYDG-VALDLMEPWKVLE----KAALALKPDRFLVA--YLPNITQVLELVRAAEA-HPFR  217 (258)
T ss_dssp             TCEEE-EEEESSCGGGGHH----HHHHHEEEEEEEEE--EESCHHHHHHHHHHHTT-TTEE
T ss_pred             CCCCE-EEECCCCHHHHHH----HHHHHCCCCCEEEE--EECCHHHHHHHHHHHHH-CCCE
T ss_conf             43238-9964889999999----99986678959999--93988999999999998-8983


No 93 
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} PDB: 1kpi_A*
Probab=96.39  E-value=0.033  Score=32.27  Aligned_cols=64  Identities=19%  Similarity=0.182  Sum_probs=53.0

Q ss_pred             CCCCCCHHHHHHHHHHC-CCCCCEEEECCCCCHHHH-HHHHHHCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             68778189999999852-899888998688851799-9999809816999728999999999996305
Q gi|254780466|r  204 HPTQKPEALLSRILVSS-TKPGDIILDPFFGSGTSG-AVAKKLRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       204 HPTqKP~~LleriI~~~-S~~gDiVLDPF~GSGTT~-~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      .-+|  ...+++++... -++|+-|||-=||-|..+ .+|++.|-+.+|+.++++-++.|++|++...
T Consensus        54 ~~AQ--~~k~~~~~~~l~l~~g~rVLDiGCGwG~~a~~~a~~~g~~v~gitlS~~Q~~~a~~~~~~~g  119 (302)
T 3hem_A           54 EEAQ--YAKRKLALDKLNLEPGMTLLDIGCGWGSTMRHAVAEYDVNVIGLTLSENQYAHDKAMFDEVD  119 (302)
T ss_dssp             HHHH--HHHHHHHHHTTCCCTTCEEEEETCTTSHHHHHHHHHHCCEEEEEECCHHHHHHHHHHHHHSC
T ss_pred             HHHH--HHHHHHHHHHHCCCCCCEEEEECCCCCHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHH
T ss_conf             9999--99999999970899989898857885399999999869838998377889999999998740


No 94 
>1im8_A YECO; methyltransferase, adenosylhomocysteine, structural genomics, hypothetical protein, structure 2 function project, S2F; HET: SAI; 2.20A {Haemophilus influenzae rd KW20} SCOP: c.66.1.14
Probab=96.37  E-value=0.018  Score=33.87  Aligned_cols=59  Identities=14%  Similarity=0.210  Sum_probs=46.2

Q ss_pred             HHHHHHHHCCCCCCEEEECCCCCHHHHH-HHHHH---CCEEEEEEECHHHHHHHHHHHHHCCC
Q ss_conf             9999998528998889986888517999-99980---98169997289999999999963056
Q gi|254780466|r  212 LLSRILVSSTKPGDIILDPFFGSGTSGA-VAKKL---RRSFIGIEMKQDYIDIATKRIASVQP  270 (375)
Q Consensus       212 LleriI~~~S~~gDiVLDPF~GSGTT~~-aA~~l---gR~~IGiE~~~~Y~~~a~~Rl~~~~~  270 (375)
                      ++-.++...-.+|..|||-=||+|.+.. .|+++   +-+.+|+|+++..++.|+++++....
T Consensus        47 ~i~~~~~~~~~~~~~vLDlGcGtG~~~~~l~~~~~~~~~~v~giD~S~~ml~~A~~k~~~~~~  109 (244)
T 1im8_A           47 AIGMLAERFVTADSNVYDLGCSRGAATLSARRNINQPNVKIIGIDNSQPMVERCRQHIAAYHS  109 (244)
T ss_dssp             HHHHHHHHHCCTTCEEEEESCTTCHHHHHHHHTCCCSSCEEEEECSCHHHHHHHHHHHHTSCC
T ss_pred             HHHHHHHHHCCCCCEEEEEEECCCHHHHHHHHHCCCCCCEEEEECCCHHHHHHHHHHHHHCCC
T ss_conf             999999986799798999200222889998863369980899976978999999864431065


No 95 
>3dmg_A Probable ribosomal RNA small subunit methyltransferase; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A*
Probab=96.36  E-value=0.002  Score=39.65  Aligned_cols=23  Identities=30%  Similarity=0.534  Sum_probs=18.1

Q ss_pred             HHHHHHHHCCCCCEEEEECCHHH
Q ss_conf             99999986396872999834688
Q gi|254780466|r   88 WLLACRRVLKPNGTLWVIGSYHN  110 (375)
Q Consensus        88 wl~e~~RvLK~~Gsi~v~~~~~~  110 (375)
                      -|.++...|+++|.+|+.|.-..
T Consensus       121 ~L~~~~~~l~~gg~l~~~g~~~~  143 (381)
T 3dmg_A          121 SLVAAARALRMGGRLYLAGDKNK  143 (381)
T ss_dssp             HHHHHHHHEEEEEEEEEEEEGGG
T ss_pred             HHHHHHHHCCCCCEEEEECCCCH
T ss_conf             99999974799978995056332


No 96 
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A*
Probab=96.28  E-value=0.012  Score=34.88  Aligned_cols=56  Identities=14%  Similarity=0.125  Sum_probs=46.5

Q ss_pred             HHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHC
Q ss_conf             99999852899888998688851799999980981699972899999999999630
Q gi|254780466|r  213 LSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASV  268 (375)
Q Consensus       213 leriI~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~  268 (375)
                      ...++....+.+.-|||.=||+|..+....+.|.+.+|+|++++.++.|++|+...
T Consensus        72 ~~~~~~~~~p~~g~vLDlGcG~G~~~~~la~~g~~v~gvD~s~~ml~~a~~~~~~~  127 (299)
T 3g2m_A           72 AREFATRTGPVSGPVLELAAGMGRLTFPFLDLGWEVTALELSTSVLAAFRKRLAEA  127 (299)
T ss_dssp             HHHHHHHHCCCCSCEEEETCTTTTTHHHHHTTTCCEEEEESCHHHHHHHHHHHHTS
T ss_pred             HHHHHHHCCCCCCCEEEEECCCCHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHC
T ss_conf             99999834999997999916677899999977997999969999999999999864


No 97 
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian}
Probab=96.27  E-value=0.011  Score=35.05  Aligned_cols=55  Identities=22%  Similarity=0.253  Sum_probs=45.1

Q ss_pred             HHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHH
Q ss_conf             8999999985289988899868885179999998098169997289999999999963
Q gi|254780466|r  210 EALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIAS  267 (375)
Q Consensus       210 ~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~  267 (375)
                      ..+++.+..   ++++.|||-=||+|..+....+.|.+.+|+|+++..++.|++|+..
T Consensus        35 ~~~l~~~~~---~~~~~vLDiGcG~G~~~~~l~~~~~~v~gvD~S~~mi~~a~~k~~~   89 (220)
T 3hnr_A           35 EDILEDVVN---KSFGNVLEFGVGTGNLTNKLLLAGRTVYGIEPSREMRMIAKEKLPK   89 (220)
T ss_dssp             HHHHHHHHH---TCCSEEEEECCTTSHHHHHHHHTTCEEEEECSCHHHHHHHHHHSCT
T ss_pred             HHHHHHHHC---CCCCEEEEECCCCCHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCC
T ss_conf             999998426---6979399972878599999997799899995835778998742565


No 98 
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus}
Probab=96.27  E-value=0.042  Score=31.61  Aligned_cols=25  Identities=28%  Similarity=0.486  Sum_probs=14.6

Q ss_pred             CCEECCCHHHHHHHCCCCCCCEEEE
Q ss_conf             7085172599897284147118984
Q gi|254780466|r   21 DKIIKGNSISVLEKLPAKSVDLIFA   45 (375)
Q Consensus        21 nkI~~GDcl~~l~~Lpd~sVDlI~t   45 (375)
                      ...++.|+.+.+..++++++|+|+.
T Consensus        83 ~~~~~~~~~~~~~~~~~~~fD~V~~  107 (240)
T 3dli_A           83 FNVVKSDAIEYLKSLPDKYLDGVMI  107 (240)
T ss_dssp             SEEECSCHHHHHHTSCTTCBSEEEE
T ss_pred             CCCCHHHHHHHHCCCCCCCCCEEEE
T ss_conf             1100100666402354347658876


No 99 
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold; HET: SAM; 2.00A {Mycobacterium tuberculosis H37RV} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A*
Probab=96.26  E-value=0.022  Score=33.28  Aligned_cols=64  Identities=23%  Similarity=0.271  Sum_probs=53.9

Q ss_pred             CCCCCCHHHHHHHHHHC-CCCCCEEEECCCCCHHHH-HHHHHHCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             68778189999999852-899888998688851799-9999809816999728999999999996305
Q gi|254780466|r  204 HPTQKPEALLSRILVSS-TKPGDIILDPFFGSGTSG-AVAKKLRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       204 HPTqKP~~LleriI~~~-S~~gDiVLDPF~GSGTT~-~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      ..+|  ...++++|... -++|+-|||-=||.|+.+ .+|++.|.+.+|++++++-++.|++|++...
T Consensus        72 ~~AQ--~~k~~~i~~~l~l~~g~rVLDIGCG~G~~a~~~a~~~g~~v~gi~is~~q~~~a~~~~~~~g  137 (318)
T 2fk8_A           72 EEAQ--YAKVDLNLDKLDLKPGMTLLDIGCGWGTTMRRAVERFDVNVIGLTLSKNQHARCEQVLASID  137 (318)
T ss_dssp             HHHH--HHHHHHHHTTSCCCTTCEEEEESCTTSHHHHHHHHHHCCEEEEEESCHHHHHHHHHHHHTSC
T ss_pred             HHHH--HHHHHHHHHHCCCCCCCEEEEECCCCCHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCC
T ss_conf             9999--99999999963999999898978873699999998369638999899999999999987638


No 100
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural genomics consortium, SGC; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13
Probab=96.25  E-value=0.026  Score=32.83  Aligned_cols=143  Identities=20%  Similarity=0.242  Sum_probs=78.5

Q ss_pred             CCCCC--CHHHHHHHHHHCCCCCCEEEECCCCCHHHHHH-HHHHCC--EEEEEEECHHHHHHHHHHHHHCCCC-------
Q ss_conf             68778--18999999985289988899868885179999-998098--1699972899999999999630568-------
Q gi|254780466|r  204 HPTQK--PEALLSRILVSSTKPGDIILDPFFGSGTSGAV-AKKLRR--SFIGIEMKQDYIDIATKRIASVQPL-------  271 (375)
Q Consensus       204 HPTqK--P~~LleriI~~~S~~gDiVLDPF~GSGTT~~a-A~~lgR--~~IGiE~~~~Y~~~a~~Rl~~~~~~-------  271 (375)
                      |-||-  |...-.-+..+--.||+.|||.=+|||....+ |..+|-  +-+++|++++.++.|++++++....       
T Consensus        84 r~tqiiypkD~a~Il~~l~I~PG~rVLE~GtGsG~lt~~LAr~vgp~G~V~~~D~~~~~~~~Ar~n~~~~~~~~~~~~~~  163 (336)
T 2b25_A           84 RGTAITFPKDINMILSMMDINPGDTVLEAGSGSGGMSLFLSKAVGSQGRVISFEVRKDHHDLAKKNYKHWRDSWKLSHVE  163 (336)
T ss_dssp             CSSCCCCHHHHHHHHHHHTCCTTCEEEEECCTTSHHHHHHHHHHCTTCEEEEEESSHHHHHHHHHHHHHHHHHHTTTCSS
T ss_pred             CCCCCCCHHHHHHHHHHHCCCCCCEEEECCCCCCHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             88775571689999998589999889983537779999999962898489984399999999999999743200012211


Q ss_pred             ---CHHHHCCCCCCC---CCCCCCHHHHHHCCCCCCCCEEECCCCCEEEEECCCCCEEECCEECCHHHHHHHHCCCCCCC
Q ss_conf             ---765630244433---37755234698828658776576689806999815981786986531999998744981006
Q gi|254780466|r  272 ---GNIELTVLTGKR---TEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTLISGTELGSIHRVGAKVSGSETCN  345 (375)
Q Consensus       272 ---~~~~~~~~~~~~---~~~rvpfg~lie~g~l~~g~~L~~~~~~~~a~v~~DG~l~~~~~~gsIh~i~a~~~~~~~cN  345 (375)
                         +...+...+...   ..+-.+|.. |.-.+..|-+.|-.    ....++++|.|+.  -.-+|.||...++..+.|.
T Consensus       164 ~~~~~v~~~~~di~~~~~~~~~~~~D~-VfLDlp~P~~~l~~----~~r~LKPGG~lvv--y~P~i~Qv~~~~~~L~~~~  236 (336)
T 2b25_A          164 EWPDNVDFIHKDISGATEDIKSLTFDA-VALDMLNPHVTLPV----FYPHLKHGGVCAV--YVVNITQVIELLDGIRTCE  236 (336)
T ss_dssp             CCCCCEEEEESCTTCCC-------EEE-EEECSSSTTTTHHH----HGGGEEEEEEEEE--EESSHHHHHHHHHHHHHHT
T ss_pred             CCCCEEEEEECCHHHCCCCCCCCCCCE-EECCCCCHHHHHHH----HHHHCCCCCEEEE--ECCCHHHHHHHHHHHHHCC
T ss_conf             367707999776665235568875333-10467698999999----9984667979999--9398999999999999728


Q ss_pred             -CEE-EEEEE
Q ss_conf             -711-46797
Q gi|254780466|r  346 -GWN-FWYFE  353 (375)
Q Consensus       346 -Gw~-fw~~~  353 (375)
                       ||. -+.+|
T Consensus       237 ~~f~~~~~~E  246 (336)
T 2b25_A          237 LALSCEKISE  246 (336)
T ss_dssp             CCEEEEEEEC
T ss_pred             CCCEEEEEEE
T ss_conf             9943678999


No 101
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A*
Probab=96.25  E-value=0.0044  Score=37.55  Aligned_cols=55  Identities=15%  Similarity=0.070  Sum_probs=43.6

Q ss_pred             HHHHHCCCCCCEEEECCCCCHHHHHHHHHHC--CEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             9998528998889986888517999999809--816999728999999999996305
Q gi|254780466|r  215 RILVSSTKPGDIILDPFFGSGTSGAVAKKLR--RSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       215 riI~~~S~~gDiVLDPF~GSGTT~~aA~~lg--R~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      .+......++.+|||--||+|.++..-.+.+  -+++|+|++++.++.|..|+....
T Consensus        16 ~l~~~~~~~~~~vLDvGcG~G~~~~~la~~~p~~~vvGvD~s~~~l~~a~~~~~~~~   72 (225)
T 3p2e_A           16 ELTEIIGQFDRVHIDLGTGDGRNIYKLAINDQNTFYIGIDPVKENLFDISKKIIKKP   72 (225)
T ss_dssp             HHHHHHTTCSEEEEEETCTTSHHHHHHHHTCTTEEEEEECSCCGGGHHHHHHHTSCG
T ss_pred             HHHHHHCCCCCEEEEEEEECCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHH
T ss_conf             999864889998999227673999999986899789998678899999998888754


No 102
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A*
Probab=96.23  E-value=0.019  Score=33.71  Aligned_cols=59  Identities=20%  Similarity=0.244  Sum_probs=47.2

Q ss_pred             HHHHHHHHHC---CCCCCEEEECCCCCH-HHHHHHHHHC--CEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             9999999852---899888998688851-7999999809--816999728999999999996305
Q gi|254780466|r  211 ALLSRILVSS---TKPGDIILDPFFGSG-TSGAVAKKLR--RSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       211 ~LleriI~~~---S~~gDiVLDPF~GSG-TT~~aA~~lg--R~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      .+..+++++.   -+|||.|||-=+||| .|++.|+..|  .+-+|+|++++.++.|++++.+..
T Consensus        62 ~~~a~~le~L~~~~~pg~~VLdiG~GsGy~ta~la~lvg~~g~V~~iE~~~~l~~~a~~~l~~~~  126 (226)
T 1i1n_A           62 HMHAYALELLFDQLHEGAKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSVNNVRKDD  126 (226)
T ss_dssp             HHHHHHHHHTTTTSCTTCEEEEETCTTSHHHHHHHHHHCTTCEEEEEESCHHHHHHHHHHHHHHC
T ss_pred             HHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHHCC
T ss_conf             99999999725308999989997788899999999970888649998688999999999986548


No 103
>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferase; tRNA modification enzyme, guanine 26, N(2),N(2)- dimethyltransferase; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A*
Probab=96.22  E-value=0.012  Score=34.92  Aligned_cols=50  Identities=22%  Similarity=0.242  Sum_probs=37.2

Q ss_pred             CEECCCHHHHHHHCCCCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCE
Q ss_conf             08517259989728414711898477876155871333678513001344357789899999889999999986396872
Q gi|254780466|r   22 KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGT  101 (375)
Q Consensus        22 kI~~GDcl~~l~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvLK~~Gs  101 (375)
                      .+.++|+...|... .+..|.|..|| |+                          +..       .++..+.+.++++|-
T Consensus       115 ~~~~~Da~~~~~~~-~~~~DvIDiDP-fG--------------------------sp~-------pfldsA~~a~~~gGl  159 (378)
T 2dul_A          115 VINHDDANRLMAER-HRYFHFIDLDP-FG--------------------------SPM-------EFLDTALRSAKRRGI  159 (378)
T ss_dssp             EEEESCHHHHHHHS-TTCEEEEEECC-SS--------------------------CCH-------HHHHHHHHHEEEEEE
T ss_pred             EEECCCHHHHHHHC-CCCCCEECCCC-CC--------------------------CHH-------HHHHHHHHHHCCCCE
T ss_conf             75211278898744-78774331389-99--------------------------818-------999999997055888


Q ss_pred             EEEEC
Q ss_conf             99983
Q gi|254780466|r  102 LWVIG  106 (375)
Q Consensus       102 i~v~~  106 (375)
                      ++|-+
T Consensus       160 l~vTa  164 (378)
T 2dul_A          160 LGVTA  164 (378)
T ss_dssp             EEEEE
T ss_pred             EEEEE
T ss_conf             99980


No 104
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli}
Probab=96.22  E-value=0.015  Score=34.26  Aligned_cols=60  Identities=12%  Similarity=0.099  Sum_probs=47.1

Q ss_pred             HHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHH--CCEEEEEEECHHHHHHHHHHHHHCCC
Q ss_conf             89999999852899888998688851799999980--98169997289999999999963056
Q gi|254780466|r  210 EALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKL--RRSFIGIEMKQDYIDIATKRIASVQP  270 (375)
Q Consensus       210 ~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~l--gR~~IGiE~~~~Y~~~a~~Rl~~~~~  270 (375)
                      .++..++ .....++..|||-=||+|..+..-.+.  +-.++|+|+++..++.|++++.....
T Consensus        37 ~~~~~~i-~~~~~~~~~VLDiGCG~G~~~~~la~~~p~~~v~gvD~s~~~l~~a~~~~~~~~~   98 (200)
T 3fzg_A           37 NDFYTYV-FGNIKHVSSILDFGCGFNPLALYQWNENEKIIYHAYDIDRAEIAFLSSIIGKLKT   98 (200)
T ss_dssp             HHHHHHH-HHHSCCCSEEEEETCTTHHHHHHHHCSSCCCEEEEECSCHHHHHHHHHHHHHSCC
T ss_pred             HHHHHHH-HHHCCCCCEEEEECCCCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHCCC
T ss_conf             9999999-9528999879995886787799999878997899985999999999851023288


No 105
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A*
Probab=96.17  E-value=0.031  Score=32.39  Aligned_cols=90  Identities=14%  Similarity=0.193  Sum_probs=61.7

Q ss_pred             CEECCCHHHHHHHCCCCCCCEEEECCCCCCCCCCC------EECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             08517259989728414711898477876155871------333678513001344357789899999889999999986
Q gi|254780466|r   22 KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQ------LYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRV   95 (375)
Q Consensus        22 kI~~GDcl~~l~~Lpd~sVDlI~tDPPYni~~~~~------~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~Rv   95 (375)
                      ++++||.++   .++++++|+|++.|||--.-+..      .+.|...           ....++=+.+.+..+.++.++
T Consensus       162 ~~~~~D~~~---~~~~~~fDlIvsNPPYi~~~~~~~~~~~v~~EP~~A-----------L~gg~dGl~~~~~ii~~a~~~  227 (276)
T 2b3t_A          162 HILQSDWFS---ALAGQQFAMIVSNPPYIDEQDPHLQQGDVRFEPLTA-----------LVAADSGMADIVHIIEQSRNA  227 (276)
T ss_dssp             EEECCSTTG---GGTTCCEEEEEECCCCBCTTCHHHHSSGGGSSCSTT-----------TBCHHHHTHHHHHHHHHHGGG
T ss_pred             EEEECCCCC---CCCCCCEEEEEECCCCCCHHHHHCCCCCCCCCHHHH-----------HHCCCCHHHHHHHHHHHHHHH
T ss_conf             999757643---367884157885698677134540775212337888-----------617864789999999999985


Q ss_pred             CCCCCEEEEECCHHHHHHHHHHHHHCCCCE
Q ss_conf             396872999834688899998764057860
Q gi|254780466|r   96 LKPNGTLWVIGSYHNIFRIGTMLQNLNFWI  125 (375)
Q Consensus        96 LK~~Gsi~v~~~~~~i~~i~~~l~~~gf~~  125 (375)
                      |+++|.+++-.++.....+..++++.||..
T Consensus       228 L~~~G~l~lEig~~q~~~v~~~~~~~gf~~  257 (276)
T 2b3t_A          228 LVSGGFLLLEHGWQQGEAVRQAFILAGYHD  257 (276)
T ss_dssp             EEEEEEEEEECCSSCHHHHHHHHHHTTCTT
T ss_pred             CCCCCEEEEEECCHHHHHHHHHHHHCCCCE
T ss_conf             167988999989069999999999779964


No 106
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus HB8} SCOP: c.66.1.46
Probab=96.17  E-value=0.0019  Score=39.73  Aligned_cols=34  Identities=15%  Similarity=0.277  Sum_probs=26.1

Q ss_pred             HHHCCCEECCCHHHHHHH--CCCCCCCEEEECCCCC
Q ss_conf             553270851725998972--8414711898477876
Q gi|254780466|r   17 FEWKDKIIKGNSISVLEK--LPAKSVDLIFADPPYN   50 (375)
Q Consensus        17 ~~~~nkI~~GDcl~~l~~--Lpd~sVDlI~tDPPYn   50 (375)
                      ....+++.+.|+...+..  .+.+++|+||+||||.
T Consensus        86 ~g~~~~v~~~~~d~~~~~~~~~~~~fDlI~~DPPY~  121 (171)
T 1ws6_A           86 TGLGARVVALPVEVFLPEAKAQGERFTVAFMAPPYA  121 (171)
T ss_dssp             HTCCCEEECSCHHHHHHHHHHTTCCEEEEEECCCTT
T ss_pred             CCCCCEEEEEEHHHHHHHHHHCCCCEEEEEECCCCC
T ss_conf             066555999778987555553388557999879988


No 107
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A*
Probab=96.16  E-value=0.025  Score=32.96  Aligned_cols=60  Identities=20%  Similarity=0.315  Sum_probs=48.8

Q ss_pred             HHHHHHHHHHC-CCCCCEEEECCCCCHHHH-HHHHHHCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             89999999852-899888998688851799-9999809816999728999999999996305
Q gi|254780466|r  210 EALLSRILVSS-TKPGDIILDPFFGSGTSG-AVAKKLRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       210 ~~LleriI~~~-S~~gDiVLDPF~GSGTT~-~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      ..+..+++.+. -.+|+.|||-=+|||-.. +.|+..|.+-+++|++++-++.|+++|++..
T Consensus        77 P~~~A~ml~~L~l~~g~~VLeIGsGtGy~ta~la~l~g~~V~~IE~~~~l~~~a~~~l~~~g  138 (235)
T 1jg1_A           77 PHMVAIMLEIANLKPGMNILEVGTGSGWNAALISEIVKTDVYTIERIPELVEFAKRNLERAG  138 (235)
T ss_dssp             HHHHHHHHHHHTCCTTCCEEEECCTTSHHHHHHHHHHCSCEEEEESCHHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHCCCCCCCEEEEECCCCCHHHHHHHHHCCCEEEEEEECHHHHHHHHHHHHHCC
T ss_conf             89999999970489998799947887678999998649739999628899999999999809


No 108
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A*
Probab=96.15  E-value=0.018  Score=33.83  Aligned_cols=90  Identities=18%  Similarity=0.282  Sum_probs=54.5

Q ss_pred             CCCEECCCHHHHHHHCCCCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             27085172599897284147118984778761558713336785130013443577898999998899999999863968
Q gi|254780466|r   20 KDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPN   99 (375)
Q Consensus        20 ~nkI~~GDcl~~l~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvLK~~   99 (375)
                      +-+|+.+|+.+.|+.  +++.|+|+.|++-..+.                          ...-|+.+.+..|+|.|+++
T Consensus       135 rv~v~~~Da~~~l~~--~~~yDvIi~D~~~p~~~--------------------------~~~L~t~eF~~~~~~~L~~~  186 (281)
T 1mjf_A          135 KAKLTIGDGFEFIKN--NRGFDVIIADSTDPVGP--------------------------AKVLFSEEFYRYVYDALNNP  186 (281)
T ss_dssp             SEEEEESCHHHHHHH--CCCEEEEEEECCCCC-------------------------------TTSHHHHHHHHHHEEEE
T ss_pred             CEEEEECHHHHHHHC--CCCCCEEEEECCCCCCC--------------------------CCCCCCHHHHHHHHHHHCCC
T ss_conf             669996218999730--78878899918998886--------------------------53236799999998741798


Q ss_pred             CEEEEECC--H---HHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCC
Q ss_conf             72999834--6---8889999876405786012468731567777577
Q gi|254780466|r  100 GTLWVIGS--Y---HNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG  142 (375)
Q Consensus       100 Gsi~v~~~--~---~~i~~i~~~l~~~gf~~~n~IIW~K~n~~pn~~g  142 (375)
                      |.+.+.+.  +   .....+...++++ |.  +  ++....++|.+.+
T Consensus       187 Gilv~q~~~~~~~~~~~~~i~~tl~~~-F~--~--V~~~~~~vp~y~~  229 (281)
T 1mjf_A          187 GIYVTQAGSVYLFTDELISAYKEMKKV-FD--R--VYYYSFPVIGYAS  229 (281)
T ss_dssp             EEEEEEEEETTTSHHHHHHHHHHHHHH-CS--E--EEEEEECCTTSSS
T ss_pred             CEEEECCCCCHHCCHHHHHHHHHHHHH-CC--C--EEEEEEEECCCCC
T ss_conf             099990788000526789999999987-89--3--3999878568886


No 109
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A
Probab=96.14  E-value=0.018  Score=33.78  Aligned_cols=59  Identities=17%  Similarity=0.241  Sum_probs=45.9

Q ss_pred             HHHHHHHHHHC--CCCCCEEEECCCCCHHHHH-HHHHHCCEEEEEEECHHHHHHHHHHHHHC
Q ss_conf             89999999852--8998889986888517999-99980981699972899999999999630
Q gi|254780466|r  210 EALLSRILVSS--TKPGDIILDPFFGSGTSGA-VAKKLRRSFIGIEMKQDYIDIATKRIASV  268 (375)
Q Consensus       210 ~~LleriI~~~--S~~gDiVLDPF~GSGTT~~-aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~  268 (375)
                      .++..+++...  .+++..|||-=||+|.++. .|+..|-+.+|+|++++.++.|++|+...
T Consensus        31 ~e~~~~~l~~l~~l~~~~~VLDIGCG~G~~~~~lA~~~~~~V~giD~s~~~l~~a~~~~~~~   92 (267)
T 3kkz_A           31 PEVTLKALSFIDNLTEKSLIADIGCGTGGQTMVLAGHVTGQVTGLDFLSGFIDIFNRNARQS   92 (267)
T ss_dssp             HHHHHHHHTTCCCCCTTCEEEEETCTTCHHHHHHHTTCSSEEEEEESCHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHCCCCCCCCEEEEECCCCCHHHHHHHHHCCCEEEEEECCCHHHHHHHHHCCCC
T ss_conf             99999999817279999989996278979999999747998999979731658988732323


No 110
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53
Probab=96.14  E-value=0.025  Score=32.98  Aligned_cols=77  Identities=10%  Similarity=0.185  Sum_probs=38.1

Q ss_pred             CEECCCHHHHHHHCCCCCCCEEEEC---CCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             0851725998972841471189847---7876155871333678513001344357789899999889999999986396
Q gi|254780466|r   22 KIIKGNSISVLEKLPAKSVDLIFAD---PPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKP   98 (375)
Q Consensus        22 kI~~GDcl~~l~~Lpd~sVDlI~tD---PPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvLK~   98 (375)
                      ++++||..+++..++++|+|.|+.-   |..  +......|               .        ...+.|.+++|+|||
T Consensus        91 ~~~~~da~~l~~~~~~~~~d~v~i~fpdPw~--k~~h~krR---------------l--------~~~~~l~~i~r~Lkp  145 (213)
T 2fca_A           91 KLLNIDADTLTDVFEPGEVKRVYLNFSDPWP--KKRHEKRR---------------L--------TYSHFLKKYEEVMGK  145 (213)
T ss_dssp             EEECCCGGGHHHHCCTTSCCEEEEESCCCCC--SGGGGGGS---------------T--------TSHHHHHHHHHHHTT
T ss_pred             EEEECCHHHHHHHCCCCCEEEEEEECCCCCC--CCCCHHHH---------------H--------HHHHHHHHHHHHCCC
T ss_conf             6784365887751377643588871356553--10000365---------------4--------218999999983799


Q ss_pred             CCEEEEECCHHHHHH-HHHHHHHCCC
Q ss_conf             872999834688899-9987640578
Q gi|254780466|r   99 NGTLWVIGSYHNIFR-IGTMLQNLNF  123 (375)
Q Consensus        99 ~Gsi~v~~~~~~i~~-i~~~l~~~gf  123 (375)
                      +|.+++.+|....+. +...+++.++
T Consensus       146 gG~l~i~TD~~~y~~~~~~~~~~~~~  171 (213)
T 2fca_A          146 GGSIHFKTDNRGLFEYSLKSFSEYGL  171 (213)
T ss_dssp             SCEEEEEESCHHHHHHHHHHHHHHTC
T ss_pred             CCEEEEEECCHHHHHHHHHHHHHCCC
T ss_conf             98899997999999999999997877


No 111
>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae}
Probab=96.14  E-value=0.012  Score=35.00  Aligned_cols=47  Identities=15%  Similarity=0.135  Sum_probs=39.6

Q ss_pred             CCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHC
Q ss_conf             99888998688851799999980981699972899999999999630
Q gi|254780466|r  222 KPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASV  268 (375)
Q Consensus       222 ~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~  268 (375)
                      .++..|||.|+|.|+-+..+-.+|-+-+++|.++--+.+..+-|+..
T Consensus        82 ~~~~~VLD~taGlG~Da~~lA~~G~~V~~vE~sp~~~~Ll~~~l~~a  128 (258)
T 2r6z_A           82 TAHPTVWDATAGLGRDSFVLASLGLTVTAFEQHPAVACLLSDGIRRA  128 (258)
T ss_dssp             GGCCCEEETTCTTCHHHHHHHHTTCCEEEEECCHHHHHHHHHHHHHH
T ss_pred             CCCCEEEEECCCCHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHH
T ss_conf             78981999078735999999976998999968889999999999999


No 112
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A*
Probab=96.13  E-value=0.023  Score=33.21  Aligned_cols=57  Identities=12%  Similarity=0.065  Sum_probs=46.8

Q ss_pred             HHHHHHHH-HCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHH
Q ss_conf             99999998-5289988899868885179999998098169997289999999999963
Q gi|254780466|r  211 ALLSRILV-SSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIAS  267 (375)
Q Consensus       211 ~LleriI~-~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~  267 (375)
                      .|.+.+-. ...++|.-||||-||+|-.++-..+.|-+-+|+|+++..++.+.++...
T Consensus        55 ~L~~~~~~~~~~~~~~rvL~pgCG~G~da~~LA~~G~~V~gvD~S~~Ai~~a~~~~~~  112 (252)
T 2gb4_A           55 LLKKHLDTFLKGQSGLRVFFPLCGKAIEMKWFADRGHTVVGVEISEIGIREFFAEQNL  112 (252)
T ss_dssp             HHHHHHHHHHTTCCSCEEEETTCTTCTHHHHHHHTTCEEEEECSCHHHHHHHHHHTTC
T ss_pred             HHHHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHCCCEEEEECCCHHHHHHHHHHCCC
T ss_conf             9999999860889999899989878088999984898489981629999999987545


No 113
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A*
Probab=96.13  E-value=0.0058  Score=36.82  Aligned_cols=55  Identities=13%  Similarity=0.169  Sum_probs=44.9

Q ss_pred             HHHHHCCCCCCEEEECCCCCHHHHHHHHHH--CCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             999852899888998688851799999980--9816999728999999999996305
Q gi|254780466|r  215 RILVSSTKPGDIILDPFFGSGTSGAVAKKL--RRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       215 riI~~~S~~gDiVLDPF~GSGTT~~aA~~l--gR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      ..|.....++..|||-=||+|..+....+.  +.+++|+|+++.+++.|++|+....
T Consensus       124 ~~~~~~~~~~~~vlD~GcG~G~~~~~l~~~~~~~~v~g~D~s~~~i~~a~~~~~~~~  180 (281)
T 3lcv_B          124 RELFRHLPRPNTLRDLACGLNPLAAPWMGLPAETVYIASDIDARLVGFVDEALTRLN  180 (281)
T ss_dssp             HHHGGGSCCCSEEEETTCTTGGGCCTTTTCCTTCEEEEEESBHHHHHHHHHHHHHTT
T ss_pred             HHHHHHCCCCCEEEEECCCCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHCC
T ss_conf             999964899986998389888899999974997749996599999999999998668


No 114
>1vl5_A Unknown conserved protein BH2331; 10174951, hypothetical protein, structural genomics, JCSG, protein structure initiative, PSI; HET: MSE; 1.95A {Bacillus halodurans c-125} SCOP: c.66.1.41
Probab=96.12  E-value=0.02  Score=33.54  Aligned_cols=56  Identities=14%  Similarity=0.285  Sum_probs=45.7

Q ss_pred             HHHHHHC-CCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             9999852-8998889986888517999999809816999728999999999996305
Q gi|254780466|r  214 SRILVSS-TKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       214 eriI~~~-S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      .|++... .++|+-|||-=||+|..+....+.+.+.+|+|++++.++.|++|++...
T Consensus        27 ~~l~~~~~l~~~~~VLDiGcG~G~~~~~la~~~~~v~g~D~s~~~~~~a~~~~~~~g   83 (260)
T 1vl5_A           27 AKLMQIAALKGNEEVLDVATGGGHVANAFAPFVKKVVAFDLTEDILKVARAFIEGNG   83 (260)
T ss_dssp             HHHHHHHTCCSCCEEEEETCTTCHHHHHHGGGSSEEEEEESCHHHHHHHHHHHHHTT
T ss_pred             HHHHHHCCCCCCCEEEEECCCCCHHHHHHHHHCCEEEEEECCHHHHHHHHHCCCCCC
T ss_conf             999996089992999995464719999999729969999899999998661222245


No 115
>1xva_A Glycine N-methyltransferase; HET: SAM; 2.20A {Escherichia coli} SCOP: c.66.1.5 PDB: 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A*
Probab=96.11  E-value=0.018  Score=33.83  Aligned_cols=48  Identities=15%  Similarity=0.140  Sum_probs=42.4

Q ss_pred             CCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             998889986888517999999809816999728999999999996305
Q gi|254780466|r  222 KPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       222 ~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      ..+.-|||.-||+|..+....+.|.+-+|+|++++.++.|+++.....
T Consensus        55 ~~~~~vLDiGcG~G~~~~~la~~g~~v~gvD~s~~ml~~a~~~~~~~~  102 (292)
T 1xva_A           55 HGCHRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRR  102 (292)
T ss_dssp             TTCCEEEESSCTTSHHHHHHHHTTCEEEEEESCHHHHHHHHHHHHHTT
T ss_pred             CCCCEEEEECCCCCHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCC
T ss_conf             184999990478849999999779969999899999999999998644


No 116
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus}
Probab=96.11  E-value=0.025  Score=33.00  Aligned_cols=61  Identities=20%  Similarity=0.317  Sum_probs=47.3

Q ss_pred             CCCCHHHHHHHHHHCCCCCCEEEECCCCCHHHHH-HHHHHC--CEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             7781899999998528998889986888517999-999809--816999728999999999996305
Q gi|254780466|r  206 TQKPEALLSRILVSSTKPGDIILDPFFGSGTSGA-VAKKLR--RSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       206 TqKP~~LleriI~~~S~~gDiVLDPF~GSGTT~~-aA~~lg--R~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      ...|..++.++   --++|+.|||-=||+|..+. .|+..+  -+.+|+|+++..++.|++|++...
T Consensus        23 ~~~~~~~l~~~---~l~~g~~VLDiGcG~G~~~~~la~~~~~~~~v~giD~s~~~i~~a~~~~~~~~   86 (219)
T 3dh0_A           23 LFDPEKVLKEF---GLKEGMTVLDVGTGAGFYLPYLSKMVGEKGKVYAIDVQEEMVNYAWEKVNKLG   86 (219)
T ss_dssp             TCCHHHHHHHH---TCCTTCEEEESSCTTCTTHHHHHHHHTTTCEEEEEESCHHHHHHHHHHHHHHT
T ss_pred             CCCHHHHHHHC---CCCCCCEEEEECCCCCHHHHHHHHHCCCCEEEEEEEEHHHHHHHHHHHHHHHH
T ss_conf             35999999865---98993999998788887799999750898399998500377889999767640


No 117
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18
Probab=96.09  E-value=0.036  Score=32.05  Aligned_cols=61  Identities=15%  Similarity=0.047  Sum_probs=50.1

Q ss_pred             CCHHHHHHHHHHC-CCCCCEEEECCCCCHHHHH-HHHHHCCEEEEEEECHHHHHHHHHHHHHC
Q ss_conf             8189999999852-8998889986888517999-99980981699972899999999999630
Q gi|254780466|r  208 KPEALLSRILVSS-TKPGDIILDPFFGSGTSGA-VAKKLRRSFIGIEMKQDYIDIATKRIASV  268 (375)
Q Consensus       208 KP~~LleriI~~~-S~~gDiVLDPF~GSGTT~~-aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~  268 (375)
                      ....|++++.... -.+|..|||-=||+|..+. .|++.|.+.+|+|+++..++.|+++....
T Consensus        66 ~~~~~~~~l~~~~~l~~~~~VLDiGCG~G~~~~~la~~~g~~v~gvD~s~~~i~~a~~~~~~~  128 (297)
T 2o57_A           66 TDEWLASELAMTGVLQRQAKGLDLGAGYGGAARFLVRKFGVSIDCLNIAPVQNKRNEEYNNQA  128 (297)
T ss_dssp             HHHHHHHHHHHTTCCCTTCEEEEETCTTSHHHHHHHHHHCCEEEEEESCHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHCCCCCCCEEEEECCCCCHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHC
T ss_conf             999999999984698999989998899998999999963985999967427788887644320


No 118
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A
Probab=96.09  E-value=0.0052  Score=37.11  Aligned_cols=52  Identities=17%  Similarity=0.171  Sum_probs=43.7

Q ss_pred             HHHHHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHH
Q ss_conf             99985289988899868885179999998098169997289999999999963
Q gi|254780466|r  215 RILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIAS  267 (375)
Q Consensus       215 riI~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~  267 (375)
                      +.+....+++ -|||.=||+|.++....+.|.+.+|+|++++.++.|++|+..
T Consensus        35 ~~~~~~~~~~-~VLDiGCG~G~~~~~l~~~~~~v~giD~s~~~l~~a~~~~~~   86 (250)
T 2p7i_A           35 RAFTPFFRPG-NLLELGSFKGDFTSRLQEHFNDITCVEASEEAISHAQGRLKD   86 (250)
T ss_dssp             HHHGGGCCSS-CEEEESCTTSHHHHHHTTTCSCEEEEESCHHHHHHHHHHSCS
T ss_pred             HHHHCCCCCC-CEEEEECCCCHHHHHHHHHCCEEEEEECCHHHHHHHHHHHHC
T ss_conf             9853107999-399992898799999995099799996716888899986303


No 119
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A*
Probab=96.08  E-value=0.0046  Score=37.45  Aligned_cols=67  Identities=21%  Similarity=0.153  Sum_probs=51.6

Q ss_pred             CCCCCCHHHHHHHHHHCC-CCCCEEEECCCCCHHHHHH-HHHHCCEEEEEEECHHHHHHHHHHHHHCCC
Q ss_conf             687781899999998528-9988899868885179999-998098169997289999999999963056
Q gi|254780466|r  204 HPTQKPEALLSRILVSST-KPGDIILDPFFGSGTSGAV-AKKLRRSFIGIEMKQDYIDIATKRIASVQP  270 (375)
Q Consensus       204 HPTqKP~~LleriI~~~S-~~gDiVLDPF~GSGTT~~a-A~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~~  270 (375)
                      =|-+=-+.|.+.++.... ++...|+|..+|||..+++ |+.-+.+.+|+|++++.+++|++-.++...
T Consensus       103 IPRpeTE~Lve~~~~~~~~~~~~~vlDlgtGSG~I~isla~~p~~~V~avDiS~~Al~vA~~Na~~~~~  171 (284)
T 1nv8_A          103 VPRPETEELVELALELIRKYGIKTVADIGTGSGAIGVSVAKFSDAIVFATDVSSKAVEIARKNAERHGV  171 (284)
T ss_dssp             CCCTTHHHHHHHHHHHHHHHTCCEEEEESCTTSHHHHHHHHHSSCEEEEEESCHHHHHHHHHHHHHTTC
T ss_pred             CCCCHHHHHHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHCCCEEEECCCHHHHHHHHHHHHHCCC
T ss_conf             288758999998887650378867998604605988767652014516763979999999999984489


No 120
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis}
Probab=96.08  E-value=0.011  Score=35.23  Aligned_cols=59  Identities=19%  Similarity=0.193  Sum_probs=46.3

Q ss_pred             HHHHHHHHHCCCCCCEEEECCCCCHHHHHHH-HHH--CCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             9999999852899888998688851799999-980--9816999728999999999996305
Q gi|254780466|r  211 ALLSRILVSSTKPGDIILDPFFGSGTSGAVA-KKL--RRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       211 ~LleriI~~~S~~gDiVLDPF~GSGTT~~aA-~~l--gR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      +++.+.+...-.+|..|||-=||||..+.+. ...  +-+.+|+|++++.++.|++++.+..
T Consensus       106 ~~~~~~~~~~l~~g~~vLDvGcG~G~~~~~l~~~~~p~~~v~gvD~S~~~l~~A~~~~~~~~  167 (305)
T 3ocj_A          106 GHFRRALQRHLRPGCVVASVPCGWMSELLALDYSACPGVQLVGIDYDPEALDGATRLAAGHA  167 (305)
T ss_dssp             HHHHHHHHHHCCTTCEEEETTCTTCHHHHTSCCTTCTTCEEEEEESCHHHHHHHHHHHTTST
T ss_pred             HHHHHHHHHCCCCCCEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHC
T ss_conf             99999999409995999994474769999999971899589999798889999975302201


No 121
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus}
Probab=96.00  E-value=0.003  Score=38.58  Aligned_cols=61  Identities=18%  Similarity=0.236  Sum_probs=47.1

Q ss_pred             CCCHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHCCC
Q ss_conf             7818999999985289988899868885179999998098169997289999999999963056
Q gi|254780466|r  207 QKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQP  270 (375)
Q Consensus       207 qKP~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~~  270 (375)
                      ++|+.++..++.   .+.+.|||.=||+|..+..-.+.+.+.+|+|+++..++.|++|++++..
T Consensus         4 e~~~~~~~~l~~---~~~~~VLDiGcG~G~~~~~l~~~~~~v~gvD~s~~~i~~a~~~~~~~~~   64 (170)
T 3i9f_A            4 ERPEEYLPNIFE---GKKGVIVDYGCGNGFYCKYLLEFATKLYCIDINVIALKEVKEKFDSVIT   64 (170)
T ss_dssp             --CTTTHHHHHS---SCCEEEEEETCTTCTTHHHHHTTEEEEEEECSCHHHHHHHHHHCTTSEE
T ss_pred             CCHHHHHHHHHC---CCCCEEEEEECCCCHHHHHHHHCCCEEEEEECCCCCCCEECCCCEEEEE
T ss_conf             059999987557---8969799980899799999996299899994564201000122103553


No 122
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str}
Probab=95.97  E-value=0.027  Score=32.78  Aligned_cols=53  Identities=19%  Similarity=0.018  Sum_probs=45.1

Q ss_pred             HHHCCCCCCEEEECCCCCHHHHHHHHHHCC--EEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             985289988899868885179999998098--16999728999999999996305
Q gi|254780466|r  217 LVSSTKPGDIILDPFFGSGTSGAVAKKLRR--SFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       217 I~~~S~~gDiVLDPF~GSGTT~~aA~~lgR--~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      |...-++|+.|||--||+|.-++.+.+.|+  +.+|+|+++..++.|+++++...
T Consensus        15 ia~~v~~g~~vlDiGcg~G~l~~~l~~~~~~~~V~avDi~~~~l~~A~~n~~~~g   69 (244)
T 3gnl_A           15 VASYITKNERIADIGSDHAYLPCFAVKNQTASFAIAGEVVDGPFQSAQKQVRSSG   69 (244)
T ss_dssp             HHTTCCSSEEEEEETCSTTHHHHHHHHTTSEEEEEEEESSHHHHHHHHHHHHHTT
T ss_pred             HHHHCCCCCEEEEECCCHHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHHCC
T ss_conf             9965899998999718648999999980999889996388999999999999829


No 123
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, nucleus, phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens}
Probab=95.94  E-value=0.0039  Score=37.86  Aligned_cols=40  Identities=30%  Similarity=0.456  Sum_probs=26.7

Q ss_pred             HHHHHHHHHCCCCCEEEEECC---HHHHHHHHHHHHHCCCCEE
Q ss_conf             999999986396872999834---6888999987640578601
Q gi|254780466|r   87 AWLLACRRVLKPNGTLWVIGS---YHNIFRIGTMLQNLNFWIL  126 (375)
Q Consensus        87 ~wl~e~~RvLK~~Gsi~v~~~---~~~i~~i~~~l~~~gf~~~  126 (375)
                      ..+.|++|||||+|.+++.--   +...-.....++.+||.+.
T Consensus       132 ~~l~E~~RvLkpgG~l~i~e~~~r~~~~~~f~~~~~~~GF~~~  174 (215)
T 2zfu_A          132 DFLEEANRVLKPGGLLKVAEVSSRFEDVRTFLRAVTKLGFKIV  174 (215)
T ss_dssp             HHHHHHHHHEEEEEEEEEEECGGGCSCHHHHHHHHHHTTEEEE
T ss_pred             HHHHHHHHHCCCCEEEEEEEECCCCCCHHHHHHHHHHCCCEEE
T ss_conf             9999999853898399999941001678999999997898897


No 124
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} SCOP: c.66.1.16 PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A*
Probab=95.94  E-value=0.014  Score=34.52  Aligned_cols=60  Identities=12%  Similarity=0.135  Sum_probs=48.3

Q ss_pred             HHHHHHHHHHCCCCCCEEEECCCCCHHHHH-HHHHHCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             899999998528998889986888517999-999809816999728999999999996305
Q gi|254780466|r  210 EALLSRILVSSTKPGDIILDPFFGSGTSGA-VAKKLRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       210 ~~LleriI~~~S~~gDiVLDPF~GSGTT~~-aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      ..+++.+-...+.+|+-|||-=||+|.++. .|++.+.+.+|+|++++.++.|+++.+...
T Consensus        47 ~~~~~~l~~~~~~~g~rVLeiG~G~G~~a~~la~~~~~~vt~id~s~~~l~~a~~~~~~~~  107 (236)
T 1zx0_A           47 TPYMHALAAAASSKGGRVLEVGFGMAIAASKVQEAPIDEHWIIECNDGVFQRLRDWAPRQT  107 (236)
T ss_dssp             HHHHHHHHHHHTTTCEEEEEECCTTSHHHHHHHTSCEEEEEEEECCHHHHHHHHHHGGGCS
T ss_pred             HHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHCC
T ss_conf             9999999975344898499988885099999997299779998089899999999887558


No 125
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A
Probab=95.94  E-value=0.017  Score=34.05  Aligned_cols=58  Identities=16%  Similarity=0.146  Sum_probs=46.1

Q ss_pred             CHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHC
Q ss_conf             189999999852899888998688851799999980981699972899999999999630
Q gi|254780466|r  209 PEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASV  268 (375)
Q Consensus       209 P~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~  268 (375)
                      |.+.+.+.+...  ++.-|||.=||+|..+..-.+.|.+-+|+|+++..++.|+++.+..
T Consensus        17 p~~~l~~~~~~~--~~~~vLDlGcG~G~~~~~la~~G~~V~~vD~s~~~l~~a~~~~~~~   74 (202)
T 2kw5_A           17 PNDFLVSVANQI--PQGKILCLAEGEGRNACFLASLGYEVTAVDQSSVGLAKAKQLAQEK   74 (202)
T ss_dssp             CCSSHHHHHHHS--CSSEEEECCCSCTHHHHHHHTTTCEEEEECSSHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHCC--CCCCEEEECCCCCHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHH
T ss_conf             789999974138--9893999837789999999986991467777899999999988871


No 126
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} SCOP: c.66.1.16 PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A*
Probab=95.92  E-value=0.0039  Score=37.88  Aligned_cols=61  Identities=25%  Similarity=0.085  Sum_probs=43.2

Q ss_pred             CCCEECCCHHHHHHHCCCCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             27085172599897284147118984778761558713336785130013443577898999998899999999863968
Q gi|254780466|r   20 KDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPN   99 (375)
Q Consensus        20 ~nkI~~GDcl~~l~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvLK~~   99 (375)
                      ..+++.+|+.+.+..++++++|.|+.|+.......                     ....+    ....+.+++|+|||+
T Consensus       109 ~~~~~~~~~~~~~~~~~~~~fD~i~~D~~~~~~~~---------------------~~~~~----~~~~~~~~~RvLkPG  163 (236)
T 1zx0_A          109 KVIPLKGLWEDVAPTLPDGHFDGILYDTYPLSEET---------------------WHTHQ----FNFIKNHAFRLLKPG  163 (236)
T ss_dssp             EEEEEESCHHHHGGGSCTTCEEEEEECCCCCBGGG---------------------TTTHH----HHHHHHTHHHHEEEE
T ss_pred             CCCEEECHHHHHHCCCCCCCCCCEEECCEEECCCE---------------------ECCCC----HHHHHHHHHHEECCC
T ss_conf             62023200887620122356674452116201220---------------------10234----688889986206788


Q ss_pred             CEEEEE
Q ss_conf             729998
Q gi|254780466|r  100 GTLWVI  105 (375)
Q Consensus       100 Gsi~v~  105 (375)
                      |.+.++
T Consensus       164 G~l~~~  169 (236)
T 1zx0_A          164 GVLTYC  169 (236)
T ss_dssp             EEEEEC
T ss_pred             CEEEEE
T ss_conf             279995


No 127
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A
Probab=95.92  E-value=0.011  Score=35.27  Aligned_cols=64  Identities=17%  Similarity=0.353  Sum_probs=41.9

Q ss_pred             HHHCCCEECCCHHHHHHHCCCCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             55327085172599897284147118984778761558713336785130013443577898999998899999999863
Q gi|254780466|r   17 FEWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVL   96 (375)
Q Consensus        17 ~~~~nkI~~GDcl~~l~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvL   96 (375)
                      .+=+-+++.+|+.+.|+..++++.|+|+.|.+-..+.                          ...-|+.+++..|++.|
T Consensus       172 ~dprv~iii~Dg~~~l~~~~~~~yDvIIvD~~dp~~~--------------------------~~~L~t~eFy~~~~~~L  225 (334)
T 1xj5_A          172 EDPRVNLVIGDGVAFLKNAAEGSYDAVIVDSSDPIGP--------------------------AKELFEKPFFQSVARAL  225 (334)
T ss_dssp             GSTTEEEEESCHHHHHHTSCTTCEEEEEECCCCTTSG--------------------------GGGGGSHHHHHHHHHHE
T ss_pred             CCCCEEEEECCHHHHHHHCCCCCCCEEEEECCCCCCC--------------------------CHHHCCHHHHHHHHHHC
T ss_conf             7998799986279997515335667799978998873--------------------------14336899999999756


Q ss_pred             CCCCEEEEEC
Q ss_conf             9687299983
Q gi|254780466|r   97 KPNGTLWVIG  106 (375)
Q Consensus        97 K~~Gsi~v~~  106 (375)
                      +++|.+.+.+
T Consensus       226 ~p~Gv~v~q~  235 (334)
T 1xj5_A          226 RPGGVVCTQA  235 (334)
T ss_dssp             EEEEEEEEEC
T ss_pred             CCCCEEEEEC
T ss_conf             9998999927


No 128
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 1f3l_A*
Probab=95.91  E-value=0.017  Score=33.99  Aligned_cols=53  Identities=17%  Similarity=0.233  Sum_probs=38.7

Q ss_pred             HHHHHH--CCCCCCEEEECCCCCHHHHHHHHHHC-CEEEEEEECHHHHHHHHHHHHH
Q ss_conf             999985--28998889986888517999999809-8169997289999999999963
Q gi|254780466|r  214 SRILVS--STKPGDIILDPFFGSGTSGAVAKKLR-RSFIGIEMKQDYIDIATKRIAS  267 (375)
Q Consensus       214 eriI~~--~S~~gDiVLDPF~GSGTT~~aA~~lg-R~~IGiE~~~~Y~~~a~~Rl~~  267 (375)
                      ++-|..  ...+|.+|||--||+|..+..|.+.| ++.+|+|.++.... +.+++..
T Consensus        53 ~~ai~~~~~~~~~k~VLDlGcGtG~ls~~aA~~Ga~~V~avd~s~~~~~-a~~~~~~  108 (340)
T 2fyt_A           53 RDFIYQNPHIFKDKVVLDVGCGTGILSMFAAKAGAKKVLGVDQSEILYQ-AMDIIRL  108 (340)
T ss_dssp             HHHHHHCGGGTTTCEEEEETCTTSHHHHHHHHTTCSEEEEEESSTHHHH-HHHHHHH
T ss_pred             HHHHHHCCCCCCCCEEEEECCCCCHHHHHHHHCCCCEEEEEECCHHHHH-HHHHHHH
T ss_conf             9999857210596989993277479999999759988999809899999-9999997


No 129
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175, PSI-2; HET: MSE; 1.70A {Agrobacterium tumefaciens str}
Probab=95.88  E-value=0.014  Score=34.45  Aligned_cols=46  Identities=24%  Similarity=0.295  Sum_probs=38.4

Q ss_pred             CCCCCEEEECCCCCHHHHH-HHHHH-CCEEEEEEECHHHHHHHHHHHH
Q ss_conf             8998889986888517999-99980-9816999728999999999996
Q gi|254780466|r  221 TKPGDIILDPFFGSGTSGA-VAKKL-RRSFIGIEMKQDYIDIATKRIA  266 (375)
Q Consensus       221 S~~gDiVLDPF~GSGTT~~-aA~~l-gR~~IGiE~~~~Y~~~a~~Rl~  266 (375)
                      .++|.-|||+-+|||..+. .|.+. +.+.+|+|++++.+++|++.++
T Consensus        34 ~~~~~rVLDlG~G~G~i~l~La~r~~~~~v~gvEi~~~~~~lAr~N~~   81 (260)
T 2ozv_A           34 DDRACRIADLGAGAGAAGMAVAARLEKAEVTLYERSQEMAEFARRSLE   81 (260)
T ss_dssp             CCSCEEEEECCSSSSHHHHHHHHHCTTEEEEEEESSHHHHHHHHHHTT
T ss_pred             CCCCCEEEECCHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHH
T ss_conf             889899999543676999999985899889999899999999999999


No 130
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032}
Probab=95.85  E-value=0.012  Score=35.00  Aligned_cols=62  Identities=23%  Similarity=0.166  Sum_probs=45.0

Q ss_pred             HCCCEECCCHHHHHHHCCCCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             32708517259989728414711898477876155871333678513001344357789899999889999999986396
Q gi|254780466|r   19 WKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKP   98 (375)
Q Consensus        19 ~~nkI~~GDcl~~l~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvLK~   98 (375)
                      -+-+|+.||..+.+...++.+.|+|+.|..-....                       ..   --++.+++.+|+|+|++
T Consensus       139 ~rv~v~~~Da~~~l~~~~~~~~D~Iv~D~f~~~~~-----------------------p~---~l~t~ef~~~~~~~L~p  192 (317)
T 3gjy_A          139 PRVKIRVDDARMVAESFTPASRDVIIRDVFAGAIT-----------------------PQ---NFTTVEFFEHCHRGLAP  192 (317)
T ss_dssp             TTEEEEESCHHHHHHTCCTTCEEEEEECCSTTSCC-----------------------CG---GGSBHHHHHHHHHHEEE
T ss_pred             CCEEEEECCHHHHHHHCCCCCCCEEEEECCCCCCC-----------------------CC---CCCCHHHHHHHHHHCCC
T ss_conf             97689978499999750557887799957887667-----------------------63---21679999999974189


Q ss_pred             CCEEEEEC
Q ss_conf             87299983
Q gi|254780466|r   99 NGTLWVIG  106 (375)
Q Consensus        99 ~Gsi~v~~  106 (375)
                      +|.+.+..
T Consensus       193 gG~lvvN~  200 (317)
T 3gjy_A          193 GGLYVANC  200 (317)
T ss_dssp             EEEEEEEE
T ss_pred             CCEEEEEC
T ss_conf             83899987


No 131
>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae}
Probab=95.84  E-value=0.0047  Score=37.37  Aligned_cols=26  Identities=19%  Similarity=0.461  Sum_probs=17.8

Q ss_pred             CHHHHHHHHHHCCCCCCEEEECCCCC
Q ss_conf             18999999985289988899868885
Q gi|254780466|r  209 PEALLSRILVSSTKPGDIILDPFFGS  234 (375)
Q Consensus       209 P~~LleriI~~~S~~gDiVLDPF~GS  234 (375)
                      -.+++..+.......+-|+|||+.-.
T Consensus       148 a~~~l~~l~~~~~~~DvIylDPMf~~  173 (258)
T 2r6z_A          148 AAEQMPALVKTQGKPDIVYLDPMYPE  173 (258)
T ss_dssp             HHHHHHHHHHHHCCCSEEEECCCC--
T ss_pred             HHHHHHHHHHCCCCCCEEEECCCCCC
T ss_conf             99999999963899888998899975


No 132
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein structure initiative; HET: MSE; 1.80A {Porphyromonas gingivalis}
Probab=95.82  E-value=0.024  Score=33.10  Aligned_cols=29  Identities=24%  Similarity=0.399  Sum_probs=25.8

Q ss_pred             CEECCCHHHHHHHCCCCCCCEEEECCCCC
Q ss_conf             08517259989728414711898477876
Q gi|254780466|r   22 KIIKGNSISVLEKLPAKSVDLIFADPPYN   50 (375)
Q Consensus        22 kI~~GDcl~~l~~Lpd~sVDlI~tDPPYn   50 (375)
                      .+++||..+.|+.+++.++|.||.|||.-
T Consensus       146 ~~~~~D~~~~l~~~~~~~~d~v~~DPaRR  174 (410)
T 3ll7_A          146 NILTGDFKEYLPLIKTFHPDYIYVDPARR  174 (410)
T ss_dssp             EEEESCGGGSHHHHHHHCCSEEEECCEEC
T ss_pred             EEEECCHHHHHHHCCCCCCCEEEECCCCC
T ss_conf             99966688887534677788899766233


No 133
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes}
Probab=95.81  E-value=0.067  Score=30.37  Aligned_cols=62  Identities=19%  Similarity=0.287  Sum_probs=51.3

Q ss_pred             HHHHHHHHHHC-CCCCCEEEECCCCCHHHH-HHHHHHCCEEEEEEECHHHHHHHHHHHHHCCCC
Q ss_conf             89999999852-899888998688851799-999980981699972899999999999630568
Q gi|254780466|r  210 EALLSRILVSS-TKPGDIILDPFFGSGTSG-AVAKKLRRSFIGIEMKQDYIDIATKRIASVQPL  271 (375)
Q Consensus       210 ~~LleriI~~~-S~~gDiVLDPF~GSGTT~-~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~~~  271 (375)
                      ..++++++... -++|+.|||-=||+|.++ ..++..|-+.+|+|+++..++.++++.......
T Consensus        47 ~~~~~~l~~~~~l~~g~~VLDiGcG~G~~~~~~~~~~~~~v~gvD~s~~~~~~~~~~~~~~~~~  110 (273)
T 3bus_A           47 DRLTDEMIALLDVRSGDRVLDVGCGIGKPAVRLATARDVRVTGISISRPQVNQANARATAAGLA  110 (273)
T ss_dssp             HHHHHHHHHHSCCCTTCEEEEESCTTSHHHHHHHHHSCCEEEEEESCHHHHHHHHHHHHHTTCT
T ss_pred             HHHHHHHHHHCCCCCCCEEEEECCCCCHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCC
T ss_conf             9999999986698997989997897998899999845988999978488899999999871777


No 134
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae}
Probab=95.79  E-value=0.064  Score=30.49  Aligned_cols=64  Identities=11%  Similarity=0.061  Sum_probs=48.3

Q ss_pred             CCCCCCCHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             3687781899999998528998889986888517999999809816999728999999999996305
Q gi|254780466|r  203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       203 ~HPTqKP~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      .|++.-...+++.+  ...+ +.-|||-=||+|..+....+.|.+.+|+|+++..++.|++|.....
T Consensus       103 ~~~~~~~~~~~~~~--~~~~-~~~vLDiGcG~G~~~~~la~~g~~v~gvD~s~~~i~~a~~~~~~~~  166 (286)
T 3m70_A          103 YNTTAIHGDVVDAA--KIIS-PCKVLDLGCGQGRNSLYLSLLGYDVTSWDHNENSIAFLNETKEKEN  166 (286)
T ss_dssp             HCCCCCCHHHHHHH--HHSC-SCEEEEESCTTCHHHHHHHHTTCEEEEEESCHHHHHHHHHHHHHTT
T ss_pred             CCCCCHHHHHHHHC--CCCC-CCEEEEECCCCCHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCC
T ss_conf             36631489999858--8899-6979998377989999998589979999898899999998654226


No 135
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S- adenosylmethionine-dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53
Probab=95.78  E-value=0.0049  Score=37.27  Aligned_cols=49  Identities=18%  Similarity=0.245  Sum_probs=29.2

Q ss_pred             CCCCCCEEEECCCCCHHHHHHHHH--HCCEEEEEEECHHHHHHHHHHHHHC
Q ss_conf             289988899868885179999998--0981699972899999999999630
Q gi|254780466|r  220 STKPGDIILDPFFGSGTSGAVAKK--LRRSFIGIEMKQDYIDIATKRIASV  268 (375)
Q Consensus       220 ~S~~gDiVLDPF~GSGTT~~aA~~--lgR~~IGiE~~~~Y~~~a~~Rl~~~  268 (375)
                      +.+.+.+|||-=||+|..++...+  -+.++||+|+++..+..|.+++.+.
T Consensus        38 F~~~~p~iLEIGcG~G~~~~~lA~~~P~~~~igiD~~~~~v~~a~~~~~~~   88 (214)
T 1yzh_A           38 FGNDNPIHVEVGSGKGAFVSGMAKQNPDINYIGIDIQKSVLSYALDKVLEV   88 (214)
T ss_dssp             HTSCCCEEEEESCTTSHHHHHHHHHCTTSEEEEEESCHHHHHHHHHHHHHH
T ss_pred             CCCCCCCEEEEEEECCHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHH
T ss_conf             499997189994108699999999789997797407788899999999983


No 136
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, protein structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides 2}
Probab=95.78  E-value=0.029  Score=32.62  Aligned_cols=55  Identities=15%  Similarity=0.045  Sum_probs=47.9

Q ss_pred             HHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHH
Q ss_conf             9999985289988899868885179999998098169997289999999999963
Q gi|254780466|r  213 LSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIAS  267 (375)
Q Consensus       213 leriI~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~  267 (375)
                      ...+++..-.+|.-|||-=||+|..+......|.+.+|+|++++-++.|++|+..
T Consensus        35 ~~~~~l~~~~pg~~vLdvGcG~G~~~~~l~~~g~~v~g~D~S~~ml~~a~~~~~~   89 (261)
T 3iv6_A           35 ENDIFLENIVPGSTVAVIGASTRFLIEKALERGASVTVFDFSQRMCDDLAEALAD   89 (261)
T ss_dssp             HHHHHTTTCCTTCEEEEECTTCHHHHHHHHHTTCEEEEEESCHHHHHHHHHHTSS
T ss_pred             HHHHHHHCCCCCCEEEEECCCCCHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHH
T ss_conf             9999971799999799988978889999996799899977789999999997464


No 137
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A
Probab=95.76  E-value=0.018  Score=33.79  Aligned_cols=49  Identities=16%  Similarity=0.057  Sum_probs=40.3

Q ss_pred             CCCCCCEEEECCCCCHHHHHHHHHHCC--EEEEEEECHHHHHHHHHHHHHC
Q ss_conf             289988899868885179999998098--1699972899999999999630
Q gi|254780466|r  220 STKPGDIILDPFFGSGTSGAVAKKLRR--SFIGIEMKQDYIDIATKRIASV  268 (375)
Q Consensus       220 ~S~~gDiVLDPF~GSGTT~~aA~~lgR--~~IGiE~~~~Y~~~a~~Rl~~~  268 (375)
                      .-+||+.|||-=||||||+........  +.+|+|+++..++.+.+|.+..
T Consensus        71 ~ikpg~~VLDlGcGtG~~~~~la~~~~~G~V~aVDiSp~mi~~a~~~a~~~  121 (230)
T 1fbn_A           71 PIKRDSKILYLGASAGTTPSHVADIADKGIVYAIEYAPRIMRELLDACAER  121 (230)
T ss_dssp             CCCTTCEEEEESCCSSHHHHHHHHHTTTSEEEEEESCHHHHHHHHHHTTTC
T ss_pred             CCCCCCEEEEECCCCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHC
T ss_conf             879999999967977989999997589965999979989999999877644


No 138
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A*
Probab=95.74  E-value=0.049  Score=31.23  Aligned_cols=47  Identities=15%  Similarity=0.116  Sum_probs=19.8

Q ss_pred             CCCCCEEEECCCCCHHHH-HHHHHHCCEEEEEEECHHHHHHHHHHHHH
Q ss_conf             899888998688851799-99998098169997289999999999963
Q gi|254780466|r  221 TKPGDIILDPFFGSGTSG-AVAKKLRRSFIGIEMKQDYIDIATKRIAS  267 (375)
Q Consensus       221 S~~gDiVLDPF~GSGTT~-~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~  267 (375)
                      ..++..|||-=||.|--+ ..++.-..+++|+|++++.++.|++|+..
T Consensus        32 ~~~~~~VLDlGCG~G~dl~k~~~~~~~~v~GiDis~~~i~~A~~r~~~   79 (313)
T 3bgv_A           32 KKRDITVLDLGCGKGGDLLKWKKGRINKLVCTDIADVSVKQCQQRYED   79 (313)
T ss_dssp             C--CCEEEEETCTTTTTHHHHHHTTCSEEEEEESCHHHHHHHHHHHHH
T ss_pred             CCCCCEEEEEECCCCHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHH
T ss_conf             789797999734776889999965999799995999999999999885


No 139
>2qfm_A Spermine synthase; spermidine aminopropyltransferase, SPMSY, structural genomics, structural genomics consortium, SGC; HET: SPD MTA; 1.80A {Homo sapiens} PDB: 3c6k_A* 3c6m_A*
Probab=95.71  E-value=0.024  Score=33.10  Aligned_cols=45  Identities=24%  Similarity=0.152  Sum_probs=33.2

Q ss_pred             CCCEEEECCCCCHHHHHHHHHHC-CEEEEEEECHHHHHHHHHHHHH
Q ss_conf             98889986888517999999809-8169997289999999999963
Q gi|254780466|r  223 PGDIILDPFFGSGTSGAVAKKLR-RSFIGIEMKQDYIDIATKRIAS  267 (375)
Q Consensus       223 ~gDiVLDPF~GSGTT~~aA~~lg-R~~IGiE~~~~Y~~~a~~Rl~~  267 (375)
                      +..-||--=+|.|.++..+.+.+ .+-..+|+|++-++++++-+..
T Consensus       188 ~pk~VLIIGGGdG~~~revlk~~~~~V~~VEID~~Vve~akk~~~~  233 (364)
T 2qfm_A          188 TGKDVLILGGGDGGILCEIVKLKPKMVTMVEIDQMVIDGCKKYMRK  233 (364)
T ss_dssp             TTCEEEEEECTTCHHHHHHHTTCCSEEEEEESCHHHHHHHHHHCCC
T ss_pred             CCCEEEEEECCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHH
T ss_conf             9885999969943999999861784289971038999999986565


No 140
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, coiled coil, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus dsm 4304} SCOP: c.66.1.3
Probab=95.67  E-value=0.028  Score=32.66  Aligned_cols=51  Identities=10%  Similarity=0.036  Sum_probs=41.4

Q ss_pred             HCCCCCCEEEECCCCCHHHHHHHHHH--CCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             52899888998688851799999980--9816999728999999999996305
Q gi|254780466|r  219 SSTKPGDIILDPFFGSGTSGAVAKKL--RRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       219 ~~S~~gDiVLDPF~GSGTT~~aA~~l--gR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      ..-+||+.|||-=||||+|+...-+.  +-+-+|+|+++..++.+.++.+...
T Consensus        53 l~ikpg~~VLDlG~GtG~~~~~la~~~~~g~V~avD~s~~~i~~a~~~a~~~~  105 (210)
T 1nt2_A           53 LKLRGDERVLYLGAASGTTVSHLADIVDEGIIYAVEYSAKPFEKLLELVRERN  105 (210)
T ss_dssp             CCCCSSCEEEEETCTTSHHHHHHHHHTTTSEEEEECCCHHHHHHHHHHHHHCS
T ss_pred             CCCCCCCEEEEECCCCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHCC
T ss_conf             68899899999568888889999974369859999699999999997786489


No 141
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032}
Probab=95.62  E-value=0.043  Score=31.57  Aligned_cols=66  Identities=18%  Similarity=0.228  Sum_probs=54.0

Q ss_pred             CCCCCCCCCHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             533687781899999998528998889986888517999999809816999728999999999996305
Q gi|254780466|r  201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       201 ~k~HPTqKP~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      ...++++..-+|+.+.-...   +..|||-=||+|.-+......|.+.+|+|++++.++.|++|..++.
T Consensus        22 ~~~~~~~~~r~~i~~~~~~~---~grVLDiGcG~G~~~~~la~~g~~v~gvD~S~~~l~~ar~~~~~~~   87 (203)
T 3h2b_A           22 TVISAEDPDRVLIEPWATGV---DGVILDVGSGTGRWTGHLASLGHQIEGLEPATRLVELARQTHPSVT   87 (203)
T ss_dssp             SSCCTTCTTHHHHHHHHHHC---CSCEEEETCTTCHHHHHHHHTTCCEEEECCCHHHHHHHHHHCTTSE
T ss_pred             CCCCCCCCCHHHHHHHCCCC---CCCEEEECCCCCHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCCCE
T ss_conf             52488864399999851589---9849997378879999999779969999697889999974488734


No 142
>2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein structure initiative; 2.00A {Escherichia coli O157}
Probab=95.59  E-value=0.0029  Score=38.62  Aligned_cols=34  Identities=15%  Similarity=0.097  Sum_probs=17.1

Q ss_pred             HHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHCC
Q ss_conf             999999985289988899868885179999998098
Q gi|254780466|r  211 ALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRR  246 (375)
Q Consensus       211 ~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~lgR  246 (375)
                      +++.+|-..+.+ | -+|=.|+-+|..=.+-.+.|-
T Consensus       194 e~f~~l~~~~~~-~-g~l~TYssa~~VR~~L~~aGF  227 (257)
T 2qy6_A          194 NLFNAMARLARP-G-GTLATFTSAGFVRRGLQEAGF  227 (257)
T ss_dssp             HHHHHHHHHEEE-E-EEEEESCCBHHHHHHHHHHTE
T ss_pred             HHHHHHHHHCCC-C-CEEEEEECHHHHHHHHHHCCC
T ss_conf             999999997579-9-789998763999999998799


No 143
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A*
Probab=95.55  E-value=0.062  Score=30.57  Aligned_cols=63  Identities=19%  Similarity=0.253  Sum_probs=53.1

Q ss_pred             HHHHHHHHHHCC-CCCCEEEECCCCCHHHHH-HHHHHCCEEEEEEECHHHHHHHHHHHHHCCCCC
Q ss_conf             899999998528-998889986888517999-999809816999728999999999996305687
Q gi|254780466|r  210 EALLSRILVSST-KPGDIILDPFFGSGTSGA-VAKKLRRSFIGIEMKQDYIDIATKRIASVQPLG  272 (375)
Q Consensus       210 ~~LleriI~~~S-~~gDiVLDPF~GSGTT~~-aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~~~~  272 (375)
                      ..++++++.... .+|+-|||-=||.|..+. +|++.|-+.+|+.++++-++.|++|+.+..-.+
T Consensus        50 ~~k~~~l~~~l~l~~G~~VLDiGCG~G~~a~~~A~~~g~~v~git~s~~q~~~a~~~~~~~~~~~  114 (287)
T 1kpg_A           50 IAKIDLALGKLGLQPGMTLLDVGCGWGATMMRAVEKYDVNVVGLTLSKNQANHVQQLVANSENLR  114 (287)
T ss_dssp             HHHHHHHHTTTTCCTTCEEEEETCTTSHHHHHHHHHHCCEEEEEESCHHHHHHHHHHHHTCCCCS
T ss_pred             HHHHHHHHHHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHCCCC
T ss_conf             99999999971999999899968852599999999679846999689999999999987614540


No 144
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly, inter-subunit disulfide bridge; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7
Probab=95.51  E-value=0.073  Score=30.15  Aligned_cols=59  Identities=17%  Similarity=0.194  Sum_probs=49.7

Q ss_pred             HHHHHHHHHC-CCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             9999999852-8998889986888517999999809816999728999999999996305
Q gi|254780466|r  211 ALLSRILVSS-TKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       211 ~LleriI~~~-S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      .+.-+++... -.+|+-|||-=+|||-.++..-+++.+-+++|++++.++.|++++....
T Consensus        57 ~~~a~~l~~L~l~~g~~VLeIG~GsGy~ta~La~l~~~V~~vE~~~~~~~~A~~~~~~~~  116 (231)
T 1vbf_A           57 NLGIFMLDELDLHKGQKVLEIGTGIGYYTALIAEIVDKVVSVEINEKMYNYASKLLSYYN  116 (231)
T ss_dssp             HHHHHHHHHTTCCTTCEEEEECCTTSHHHHHHHHHSSEEEEEESCHHHHHHHHHHHTTCS
T ss_pred             HHHHHHHHHCCCCCCCEEEEECCCCCHHHHHHHHHCCEEEEECCCHHHHHHHHHHHCCCC
T ss_conf             999999997189997989997798778899999856787676289999999998740686


No 145
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A*
Probab=95.45  E-value=0.056  Score=30.87  Aligned_cols=86  Identities=16%  Similarity=0.347  Sum_probs=46.9

Q ss_pred             CEECCCHHHHHHHCCCCCCCEEEECCCCCCCCCCCE-----ECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             085172599897284147118984778761558713-----336785130013443577898999998899999999863
Q gi|254780466|r   22 KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQL-----YRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVL   96 (375)
Q Consensus        22 kI~~GDcl~~l~~Lpd~sVDlI~tDPPYni~~~~~~-----~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvL   96 (375)
                      .+++||-++.+... .+++|+|++.|||=- .+..+     +.|...-+.|       -+..+-|    +..+   .+.|
T Consensus       176 ~~~~~d~~~~~~~~-~~~fDlIVSNPPYI~-~~~~l~~~~~~EP~~AL~gg-------~dGl~~~----r~i~---~~~L  239 (284)
T 1nv8_A          176 FVRKGEFLEPFKEK-FASIEMILSNPPYVK-SSAHLPKDVLFEPPEALFGG-------EDGLDFY----REFF---GRYD  239 (284)
T ss_dssp             EEEESSTTGGGGGG-TTTCCEEEECCCCBC-GGGSCTTSCCCSCHHHHBCT-------TTSCHHH----HHHH---HHCC
T ss_pred             EEEECCCCCCCCCC-CCCEEEEEECCCCCC-CHHHHHHHHHCCCHHHHHCC-------CCHHHHH----HHHH---HHHC
T ss_conf             99963210014112-675308996788888-63332235424863987189-------6389999----9999---9956


Q ss_pred             CCCCEEEEECCHHHHHHHHHHHHHCCC
Q ss_conf             968729998346888999987640578
Q gi|254780466|r   97 KPNGTLWVIGSYHNIFRIGTMLQNLNF  123 (375)
Q Consensus        97 K~~Gsi~v~~~~~~i~~i~~~l~~~gf  123 (375)
                      +++|.+++-.++.....+..++.+.||
T Consensus       240 ~~~G~l~~E~g~~Q~~~v~~l~~~~~~  266 (284)
T 1nv8_A          240 TSGKIVLMEIGEDQVEELKKIVSDTVF  266 (284)
T ss_dssp             CTTCEEEEECCTTCHHHHTTTSTTCEE
T ss_pred             CCCCEEEEEECHHHHHHHHHHHHHCCE
T ss_conf             689999999897699999999985898


No 146
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17
Probab=95.39  E-value=0.023  Score=33.21  Aligned_cols=62  Identities=23%  Similarity=0.300  Sum_probs=34.4

Q ss_pred             HHCCCEECCCHHHHHHHCCCCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCC
Q ss_conf             53270851725998972841471189847787615587133367851300134435778989999988999999998639
Q gi|254780466|r   18 EWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLK   97 (375)
Q Consensus        18 ~~~nkI~~GDcl~~l~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvLK   97 (375)
                      +-+-+|+.+|+.+.|+.- +++.|+|++|++-..+                          ....-|+.+++..|+|.|+
T Consensus       161 dprv~i~~~Da~~~l~~~-~~~yDvII~D~~dp~~--------------------------~~~~L~t~eFy~~~~~~L~  213 (314)
T 2b2c_A          161 HPKLDLFCGDGFEFLKNH-KNEFDVIITDSSDPVG--------------------------PAESLFGQSYYELLRDALK  213 (314)
T ss_dssp             CTTEEEECSCHHHHHHHC-TTCEEEEEECCC---------------------------------------HHHHHHHHEE
T ss_pred             CCCEEEEECHHHHHHHCC-CCCCCEEEEECCCCCC--------------------------CCHHHCCHHHHHHHHHHCC
T ss_conf             665279971089997417-8888889996899877--------------------------2155501999999997649


Q ss_pred             CCCEEEEEC
Q ss_conf             687299983
Q gi|254780466|r   98 PNGTLWVIG  106 (375)
Q Consensus        98 ~~Gsi~v~~  106 (375)
                      ++|.+...+
T Consensus       214 ~~Gv~v~q~  222 (314)
T 2b2c_A          214 EDGILSSQG  222 (314)
T ss_dssp             EEEEEEEEC
T ss_pred             CCCEEEECC
T ss_conf             982999868


No 147
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta- aspartate methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum 3D7}
Probab=95.39  E-value=0.091  Score=29.58  Aligned_cols=50  Identities=28%  Similarity=0.387  Sum_probs=41.6

Q ss_pred             CCCCCCEEEECCCCCHH-HHHHHHHH------CCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             28998889986888517-99999980------9816999728999999999996305
Q gi|254780466|r  220 STKPGDIILDPFFGSGT-SGAVAKKL------RRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       220 ~S~~gDiVLDPF~GSGT-T~~aA~~l------gR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      .-++|+-|||-=+|||- |++.|+..      +.+-+|+|++++-++.|+++|++..
T Consensus        77 ~l~~g~~VLeIGtGsGY~ta~la~~~~~l~~~~g~V~~iE~~~~l~~~a~~~l~~~~  133 (227)
T 2pbf_A           77 VLKPGSRAIDVGSGSGYLTVCMAIKMNVLENKNSYVIGLERVKDLVNFSLENIKRDK  133 (227)
T ss_dssp             TSCTTCEEEEESCTTSHHHHHHHHHTTTTTCTTCEEEEEESCHHHHHHHHHHHHHHC
T ss_pred             HCCCCCEEEEECCCCCHHHHHHHHHHHHHCCCCCEEEEEEECHHHHHHHHHHHHHCC
T ss_conf             479988699837997399999999976522456538999705999999999998510


No 148
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.70A {Bacillus thuringiensis}
Probab=95.38  E-value=0.036  Score=32.05  Aligned_cols=51  Identities=16%  Similarity=0.169  Sum_probs=44.1

Q ss_pred             HHHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHH
Q ss_conf             985289988899868885179999998098169997289999999999963
Q gi|254780466|r  217 LVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIAS  267 (375)
Q Consensus       217 I~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~  267 (375)
                      +....+++..|||-=||+|..+..-.+.|-+.+|+|.++..++.|++|...
T Consensus        47 ~~~~l~~~~~VLDiGcG~G~~~~~l~~~~~~v~giD~s~~~l~~a~~~~~~   97 (242)
T 3l8d_A           47 FEQYVKKEAEVLDVGCGDGYGTYKLSRTGYKAVGVDISEVMIQKGKERGEG   97 (242)
T ss_dssp             HHHHSCTTCEEEEETCTTSHHHHHHHHTTCEEEEEESCHHHHHHHHTTTCB
T ss_pred             HHHHCCCCCEEEEECCCCCHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCC
T ss_conf             998589969799965888599999996499899997974667998750344


No 149
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O- methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, RNA-binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} PDB: 3id5_B*
Probab=95.38  E-value=0.048  Score=31.26  Aligned_cols=50  Identities=16%  Similarity=0.100  Sum_probs=41.1

Q ss_pred             CCCCCCEEEECCCCCHHHH-HHHHHHC--CEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             2899888998688851799-9999809--816999728999999999996305
Q gi|254780466|r  220 STKPGDIILDPFFGSGTSG-AVAKKLR--RSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       220 ~S~~gDiVLDPF~GSGTT~-~aA~~lg--R~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      .-+||+.|||-=||||||. .+|...|  =+-+|+|+++..++.+.++.++..
T Consensus        73 ~lkpG~~VLdLG~G~G~~~~~la~~Vg~~G~V~aVD~s~~~l~~a~~~a~~~~  125 (232)
T 3id6_C           73 PIRKGTKVLYLGAASGTTISHVSDIIELNGKAYGVEFSPRVVRELLLVAQRRP  125 (232)
T ss_dssp             SCCTTCEEEEETCTTSHHHHHHHHHHTTTSEEEEEECCHHHHHHHHHHHHHCT
T ss_pred             CCCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHCC
T ss_conf             88999999996771889999999971568769999799999999997656546


No 150
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris}
Probab=95.35  E-value=0.079  Score=29.94  Aligned_cols=57  Identities=18%  Similarity=0.178  Sum_probs=47.3

Q ss_pred             HHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHH
Q ss_conf             8999999985289988899868885179999998098169997289999999999963
Q gi|254780466|r  210 EALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIAS  267 (375)
Q Consensus       210 ~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~  267 (375)
                      ...+.+++.. -++|.-|||-=||+|..+......|.+.+|+|+++..++.|++|...
T Consensus        31 ~~~l~~~~~~-l~~~~~VLDvGCG~G~~~~~l~~~g~~v~gvD~s~~~i~~a~~~~~~   87 (211)
T 3e23_A           31 SATLTKFLGE-LPAGAKILELGCGAGYQAEAMLAAGFDVDATDGSPELAAEASRRLGR   87 (211)
T ss_dssp             CHHHHHHHTT-SCTTCEEEESSCTTSHHHHHHHHTTCEEEEEESCHHHHHHHHHHHTS
T ss_pred             HHHHHHHHHH-CCCCCEEEEECCCCCHHHHHHHHCCCCEEEEECCHHHHHHHHHHCCC
T ss_conf             6999999961-89989899986888699999997599232341469999999986088


No 151
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens}
Probab=95.31  E-value=0.064  Score=30.49  Aligned_cols=61  Identities=13%  Similarity=0.026  Sum_probs=48.3

Q ss_pred             CHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHC-CEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             1899999998528998889986888517999999809-816999728999999999996305
Q gi|254780466|r  209 PEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLR-RSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       209 P~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~lg-R~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      +.+-+..++...-++++-|||.=||+|..+..-.+.| .+.+|+|+++..++.+++|.....
T Consensus        28 ~~~~l~~~~~~~l~~~~~iLDiGCG~G~~~~~L~~~g~~~v~giD~s~~~i~~~~~~~~~~~   89 (215)
T 2pxx_A           28 DFSSFRALLEPELRPEDRILVLGCGNSALSYELFLGGFPNVTSVDYSSVVVAAMQACYAHVP   89 (215)
T ss_dssp             CHHHHHHHHGGGCCTTCCEEEETCTTCSHHHHHHHTTCCCEEEEESCHHHHHHHHHHTTTCT
T ss_pred             CHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHCCCC
T ss_conf             87899999996389999899963777799999998489839998276256679999834786


No 152
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, structural genomics; 2.00A {Methanocaldococcus jannaschii DSM2661}
Probab=95.30  E-value=0.072  Score=30.17  Aligned_cols=61  Identities=20%  Similarity=0.210  Sum_probs=48.1

Q ss_pred             HHHHHHHHHHC-CCCCCEEEECCCCCHHHHHH-HHHHCC--EEEEEEECHHHHHHHHHHHHHCCC
Q ss_conf             89999999852-89988899868885179999-998098--169997289999999999963056
Q gi|254780466|r  210 EALLSRILVSS-TKPGDIILDPFFGSGTSGAV-AKKLRR--SFIGIEMKQDYIDIATKRIASVQP  270 (375)
Q Consensus       210 ~~LleriI~~~-S~~gDiVLDPF~GSGTT~~a-A~~lgR--~~IGiE~~~~Y~~~a~~Rl~~~~~  270 (375)
                      ..+.-+++.+. -++|+.|||-=+|||-..+. |+-.|.  +-+++|++++.++.|++++.....
T Consensus        63 P~~~a~~l~~l~l~~g~~VLeIGtGsGY~ta~la~l~g~~g~V~~iE~~~~l~~~a~~~l~~~~~  127 (215)
T 2yxe_A           63 IHMVGMMCELLDLKPGMKVLEIGTGCGYHAAVTAEIVGEDGLVVSIERIPELAEKAERTLRKLGY  127 (215)
T ss_dssp             HHHHHHHHHHTTCCTTCEEEEECCTTSHHHHHHHHHHCTTSEEEEEESCHHHHHHHHHHHHHHTC
T ss_pred             HHHHHHHHHHHCCCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHCCC
T ss_conf             79999999863589998899827884199999999848887189995288999999999986156


No 153
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genomics, JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440}
Probab=95.19  E-value=0.035  Score=32.13  Aligned_cols=48  Identities=17%  Similarity=0.115  Sum_probs=42.3

Q ss_pred             CCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHC
Q ss_conf             899888998688851799999980981699972899999999999630
Q gi|254780466|r  221 TKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASV  268 (375)
Q Consensus       221 S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~  268 (375)
                      ...++.|||.=||+|..+....+.|-+.+|+|+++..++.|+++....
T Consensus        50 ~~~~~~vLDiGcG~G~~~~~l~~~g~~v~gvD~S~~~i~~A~~~~~~~   97 (227)
T 3e8s_A           50 GRQPERVLDLGCGEGWLLRALADRGIEAVGVDGDRTLVDAARAAGAGE   97 (227)
T ss_dssp             HTCCSEEEEETCTTCHHHHHHHTTTCEEEEEESCHHHHHHHHHTCSSC
T ss_pred             CCCCCEEEEECCCCCHHHHHHHHCCCEEEEECCCHHHHHHHHHHCCCC
T ss_conf             589598999768983999999976996999868178899999860146


No 154
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum dsm 1728} SCOP: c.66.1.13
Probab=95.15  E-value=0.017  Score=34.07  Aligned_cols=66  Identities=12%  Similarity=0.179  Sum_probs=46.8

Q ss_pred             CEECCCHHHHHHHCCCCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCE
Q ss_conf             08517259989728414711898477876155871333678513001344357789899999889999999986396872
Q gi|254780466|r   22 KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGT  101 (375)
Q Consensus        22 kI~~GDcl~~l~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvLK~~Gs  101 (375)
                      .++++|..+   .++++++|+||.|.|=                     .|              +.+.+++++||++|.
T Consensus       165 ~~~~~Di~e---~~~~~~fD~V~ld~p~---------------------p~--------------~~l~~~~~~LKpGG~  206 (275)
T 1yb2_A          165 RTSRSDIAD---FISDQMYDAVIADIPD---------------------PW--------------NHVQKIASMMKPGSV  206 (275)
T ss_dssp             EEECSCTTT---CCCSCCEEEEEECCSC---------------------GG--------------GSHHHHHHTEEEEEE
T ss_pred             HHEEHHHHH---CCCCCCCCCEEEECCC---------------------HH--------------HHHHHHHHHCCCCCE
T ss_conf             111011221---0244423305870568---------------------99--------------999999975688828


Q ss_pred             EEEEC-CHHHHHHHHHHHHHCCCCE
Q ss_conf             99983-4688899998764057860
Q gi|254780466|r  102 LWVIG-SYHNIFRIGTMLQNLNFWI  125 (375)
Q Consensus       102 i~v~~-~~~~i~~i~~~l~~~gf~~  125 (375)
                      +.+.. ....+.++...|.+.||+.
T Consensus       207 lv~~~P~i~Qv~k~~~~L~~~Gf~~  231 (275)
T 1yb2_A          207 ATFYLPNFDQSEKTVLSLSASGMHH  231 (275)
T ss_dssp             EEEEESSHHHHHHHHHHSGGGTEEE
T ss_pred             EEEEECCHHHHHHHHHHHHHCCCEE
T ss_conf             9999899999999999999879857


No 155
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA; HET: SAH; 2.60A {Thermus thermophilus HB8}
Probab=95.14  E-value=0.044  Score=31.46  Aligned_cols=53  Identities=19%  Similarity=0.250  Sum_probs=42.8

Q ss_pred             HHHHHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             9998528998889986888517999999809816999728999999999996305
Q gi|254780466|r  215 RILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       215 riI~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      +++...-.+|+.|||.=||+|..+...  -+++.+|+|+++..++.|++|..++.
T Consensus        28 ~~~~~~l~~g~~iLDiGCG~G~~~~~l--~~~~v~g~D~s~~~l~~A~~~~~~~~   80 (211)
T 2gs9_A           28 RALKGLLPPGESLLEVGAGTGYWLRRL--PYPQKVGVEPSEAMLAVGRRRAPEAT   80 (211)
T ss_dssp             HHHHTTCCCCSEEEEETCTTCHHHHHC--CCSEEEEECCCHHHHHHHHHHCTTSE
T ss_pred             HHHHHHCCCCCEEEEECCCCHHHHHHC--CCCCEEEEECCHHHHHHHHHCCCCCE
T ss_conf             999985799998999899860999973--76868998389999998763366520


No 156
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans}
Probab=95.09  E-value=0.019  Score=33.76  Aligned_cols=59  Identities=12%  Similarity=0.104  Sum_probs=40.6

Q ss_pred             HHHHHHHHHCCCCCCEEEECCCCCHHHHHHH-HHHCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             9999999852899888998688851799999-9809816999728999999999996305
Q gi|254780466|r  211 ALLSRILVSSTKPGDIILDPFFGSGTSGAVA-KKLRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       211 ~LleriI~~~S~~gDiVLDPF~GSGTT~~aA-~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      .|+..++.+.-.+.=+-+=.|.|-.|...|. ..-+-+.+.+|.+++++++|++-+++.-
T Consensus        50 ~~L~~L~~~~~ak~iLEiGT~~GySal~lA~al~~~g~v~tie~~~~~~~~A~~~~~~ag  109 (239)
T 2hnk_A           50 QFLNILTKISGAKRIIEIGTFTGYSSLCFASALPEDGKILCCDVSEEWTNVARKYWKENG  109 (239)
T ss_dssp             HHHHHHHHHHTCSEEEEECCTTCHHHHHHHHHSCTTCEEEEEESCHHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHCCCCCCEEEEECCHHHHHHHHHHHHHCC
T ss_conf             999999997299779997254588999999717878868999453888999999999879


No 157
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A
Probab=95.07  E-value=0.088  Score=29.65  Aligned_cols=68  Identities=15%  Similarity=0.139  Sum_probs=53.4

Q ss_pred             HHHHHHHHHHCC-CCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHH---CCCCCHHHHC
Q ss_conf             899999998528-9988899868885179999998098169997289999999999963---0568765630
Q gi|254780466|r  210 EALLSRILVSST-KPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIAS---VQPLGNIELT  277 (375)
Q Consensus       210 ~~LleriI~~~S-~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~---~~~~~~~~~~  277 (375)
                      ..++++|+.... .++|.||+-=+|.|+-..+..+.+.+.+++|+|+.+++..++|...   ++-+..+.+.
T Consensus        16 ~~i~~~Iv~~~~~~~~d~VlEIGpG~G~LT~~L~~~~~~v~avEiD~~l~~~L~~~~~~~~n~~ii~~D~l~   87 (244)
T 1qam_A           16 KHNIDKIMTNIRLNEHDNIFEIGSGKGHFTLELVQRCNFVTAIEIDHKLCKTTENKLVDHDNFQVLNKDILQ   87 (244)
T ss_dssp             HHHHHHHHTTCCCCTTCEEEEECCTTSHHHHHHHHHSSEEEEECSCHHHHHHHHHHTTTCCSEEEECCCGGG
T ss_pred             HHHHHHHHHHCCCCCCCEEEEECCCCCHHHHHHHHCCCCEEEEEECHHHHHHHHHHHCCCCCEEEEECHHHC
T ss_conf             999999999567899997999738871999999855583069985301779999741447765773001222


No 158
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus}
Probab=95.06  E-value=0.022  Score=33.34  Aligned_cols=49  Identities=22%  Similarity=0.270  Sum_probs=38.4

Q ss_pred             CCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             8998889986888517999999809816999728999999999996305
Q gi|254780466|r  221 TKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       221 S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      -+++..|||-=||+|..+..+.+.|.+.+|+|+++..++.|++|+....
T Consensus        39 ~~~~~~vLDiGCG~G~~~~~l~~~g~~v~GiD~s~~~i~~a~~~~~~~~   87 (240)
T 3dli_A           39 FKGCRRVLDIGCGRGEFLELCKEEGIESIGVDINEDMIKFCEGKFNVVK   87 (240)
T ss_dssp             TTTCSCEEEETCTTTHHHHHHHHHTCCEEEECSCHHHHHHHHTTSEEEC
T ss_pred             CCCCCEEEEECCCCCHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCH
T ss_conf             6899969997387859999999779959999677078788765111001


No 159
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33
Probab=95.04  E-value=0.07  Score=30.28  Aligned_cols=60  Identities=18%  Similarity=0.236  Sum_probs=47.6

Q ss_pred             HHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHH--CCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             89999999852899888998688851799999980--9816999728999999999996305
Q gi|254780466|r  210 EALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKL--RRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       210 ~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~l--gR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      ..+...+......+++.|||-=||+|..+....+.  +-..+|+|+++..++.|.+|..++.
T Consensus        72 ~~~~~~l~~~~~~~~~~vLDiGcG~G~~~~~l~~~~~~~~~~gvD~s~~~l~~a~~~~~~~~  133 (269)
T 1p91_A           72 DAIVAQLRERLDDKATAVLDIGCGEGYYTHAFADALPEITTFGLDVSKVAIKAAAKRYPQVT  133 (269)
T ss_dssp             HHHHHHHHHHSCTTCCEEEEETCTTSTTHHHHHHTCTTSEEEEEESCHHHHHHHHHHCTTSE
T ss_pred             HHHHHHHHHHCCCCCCEEEEECCCCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHCCCCCC
T ss_conf             99999998547888996999689896999999986899689999795889999985177543


No 160
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, tRNA processing; HET: SAM; 1.50A {Escherichia coli K12} PDB: 3dxx_A* 3dxz_A*
Probab=94.99  E-value=0.056  Score=30.86  Aligned_cols=80  Identities=10%  Similarity=0.183  Sum_probs=48.6

Q ss_pred             HCC-CEECCCHHHHHHH-CCCCCCCEEEECCCC-CCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             327-0851725998972-841471189847787-6155871333678513001344357789899999889999999986
Q gi|254780466|r   19 WKD-KIIKGNSISVLEK-LPAKSVDLIFADPPY-NLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRV   95 (375)
Q Consensus        19 ~~n-kI~~GDcl~~l~~-Lpd~sVDlI~tDPPY-ni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~Rv   95 (375)
                      ..| +++++|..+.+.. +|++|+|.|+.=-|= |-+.+....            .   .-        ..+.+.++.|+
T Consensus        83 l~Ni~~~~~da~~~l~~~~~~~s~d~I~i~FPDPWpKkkh~Kr------------R---lv--------~~~fl~~l~~~  139 (218)
T 3dxy_A           83 LSNLRVMCHDAVEVLHKMIPDNSLRMVQLFFPDPWHKARHNKR------------R---IV--------QVPFAELVKSK  139 (218)
T ss_dssp             CSSEEEECSCHHHHHHHHSCTTCEEEEEEESCCCCCSGGGGGG------------S---SC--------SHHHHHHHHHH
T ss_pred             HCCCCEECCCHHHHHHHHCCCCCCCCCEECCCCCCCCCCCCCC------------C---CC--------CHHHHHHHHHH
T ss_conf             0455056453899998752456454432316887777432462------------5---56--------15589999986


Q ss_pred             CCCCCEEEEECCHHHHH-HHHHHHHHC
Q ss_conf             39687299983468889-999876405
Q gi|254780466|r   96 LKPNGTLWVIGSYHNIF-RIGTMLQNL  121 (375)
Q Consensus        96 LK~~Gsi~v~~~~~~i~-~i~~~l~~~  121 (375)
                      ||++|.+++.+|+...+ .+...+...
T Consensus       140 Lk~gG~l~l~TD~~~Y~~~~~~~~~~~  166 (218)
T 3dxy_A          140 LQLGGVFHMATDWEPYAEHMLEVMSSI  166 (218)
T ss_dssp             EEEEEEEEEEESCHHHHHHHHHHHHTS
T ss_pred             CCCCCEEEEEECCHHHHHHHHHHHHHC
T ss_conf             288989999979799999999999868


No 161
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A*
Probab=94.93  E-value=0.033  Score=32.22  Aligned_cols=60  Identities=10%  Similarity=0.162  Sum_probs=43.0

Q ss_pred             HHHHHHHHHHCCCCCCEEEECCCCCHHHHHH-HHHHCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             8999999985289988899868885179999-99809816999728999999999996305
Q gi|254780466|r  210 EALLSRILVSSTKPGDIILDPFFGSGTSGAV-AKKLRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       210 ~~LleriI~~~S~~gDiVLDPF~GSGTT~~a-A~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      -.|+..++...-.+.=+-+-.|.|-.|...| |..-+-+.+.||++++++++|++-+++.-
T Consensus        68 g~~L~~L~~~~~ak~iLEIGT~~GySal~~a~al~~~g~l~tie~~~~~~~~Ar~~~~~ag  128 (247)
T 1sui_A           68 GQFLSMLLKLINAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINKENYELGLPVIKKAG  128 (247)
T ss_dssp             HHHHHHHHHHTTCCEEEEECCGGGHHHHHHHHHSCTTCEEEEEESCCHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHHHH
T ss_conf             9999999986499779996321589999999858546369998517787899999998620


No 162
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron}
Probab=94.93  E-value=0.15  Score=28.33  Aligned_cols=59  Identities=17%  Similarity=0.229  Sum_probs=46.6

Q ss_pred             HHHHHHHHHHCC--CCCCEEEECCCCCHHHHHH-HHHHCCEEEEEEECHHHHHHHHHHHHHC
Q ss_conf             899999998528--9988899868885179999-9980981699972899999999999630
Q gi|254780466|r  210 EALLSRILVSST--KPGDIILDPFFGSGTSGAV-AKKLRRSFIGIEMKQDYIDIATKRIASV  268 (375)
Q Consensus       210 ~~LleriI~~~S--~~gDiVLDPF~GSGTT~~a-A~~lgR~~IGiE~~~~Y~~~a~~Rl~~~  268 (375)
                      .+..++.+....  +++.-|||-=||+|.+... |++.+-+.+|+|+++..++.|++|....
T Consensus        31 ~~~~~~~l~~l~~l~~~~rVLDlGCG~G~~~~~La~~~~~~v~gvD~S~~ml~~a~~~~~~~   92 (257)
T 3f4k_A           31 PEATRKAVSFINELTDDAKIADIGCGTGGQTLFLADYVKGQITGIDLFPDFIEIFNENAVKA   92 (257)
T ss_dssp             HHHHHHHHTTSCCCCTTCEEEEETCTTSHHHHHHHHHCCSEEEEEESCHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHCCCCCCCCEEEEECCCCCHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHH
T ss_conf             99999999836079997979997177979999999866997999968456778889877643


No 163
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S- adenosylmethionine-dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53
Probab=94.92  E-value=0.086  Score=29.71  Aligned_cols=91  Identities=11%  Similarity=0.144  Sum_probs=55.0

Q ss_pred             HCC-CEECCCHHHHHHHCCCCCCCEEEECCCC-CCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             327-0851725998972841471189847787-61558713336785130013443577898999998899999999863
Q gi|254780466|r   19 WKD-KIIKGNSISVLEKLPAKSVDLIFADPPY-NLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVL   96 (375)
Q Consensus        19 ~~n-kI~~GDcl~~l~~Lpd~sVDlI~tDPPY-ni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvL   96 (375)
                      ..| .+++||..+++..++++|+|.|+.-.|- +.+.+....            .           -+..+.|.++.|+|
T Consensus        90 l~Nv~~~~~da~~l~~~~~~~~~d~v~~~fPdPwpK~rh~kr------------R-----------li~~~fl~~~~r~L  146 (214)
T 1yzh_A           90 VPNIKLLWVDGSDLTDYFEDGEIDRLYLNFSDPWPKKRHEKR------------R-----------LTYKTFLDTFKRIL  146 (214)
T ss_dssp             CSSEEEEECCSSCGGGTSCTTCCSEEEEESCCCCCSGGGGGG------------S-----------TTSHHHHHHHHHHS
T ss_pred             CCCEEEEECCHHHHHHHCCCCEEEEEECCCCCCCCHHHHHHH------------H-----------HCCHHHHHHHHHHC
T ss_conf             986445523698874212577431111246786620111315------------5-----------31078999999974


Q ss_pred             CCCCEEEEECCHHHHHH-HHHHHHHCCCCEEEEEEEECC
Q ss_conf             96872999834688899-998764057860124687315
Q gi|254780466|r   97 KPNGTLWVIGSYHNIFR-IGTMLQNLNFWILNDIVWRKS  134 (375)
Q Consensus        97 K~~Gsi~v~~~~~~i~~-i~~~l~~~gf~~~n~IIW~K~  134 (375)
                      |++|.+++.+|....+. +...+.+.++.  ....|...
T Consensus       147 kpgG~l~i~TD~~~y~~~~~~~~~~~~~~--~~~~~~~~  183 (214)
T 1yzh_A          147 PENGEIHFKTDNRGLFEYSLVSFSQYGMK--LNGVWLDL  183 (214)
T ss_dssp             CTTCEEEEEESCHHHHHHHHHHHHHHTCE--EEEEESSG
T ss_pred             CCCCEEEEEECCHHHHHHHHHHHHHCCCC--CCCCCCCC
T ss_conf             88988999968989999999999976873--23454222


No 164
>2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A
Probab=94.90  E-value=0.057  Score=30.79  Aligned_cols=57  Identities=14%  Similarity=0.052  Sum_probs=42.6

Q ss_pred             HHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHH
Q ss_conf             8999999985289988899868885179999998098169997289999999999963
Q gi|254780466|r  210 EALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIAS  267 (375)
Q Consensus       210 ~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~  267 (375)
                      +.|. +-+-.....+..|||.++|.|+-+.+.-.+|.+-++||.++.-+.+...-|++
T Consensus        76 e~l~-kAvGlk~~~~~~VlDaTaGlG~Da~vlA~~G~~V~~iEr~p~l~~ll~d~l~r  132 (258)
T 2oyr_A           76 EAVA-KAVGIKGDYLPDVVDATAGLGRDAFVLASVGCRVRMLERNPVVAALLDDGLAR  132 (258)
T ss_dssp             SHHH-HHTTCBTTBCCCEEETTCTTCHHHHHHHHHTCCEEEEECCHHHHHHHHHHHHH
T ss_pred             HHHH-HHHCCCCCCCCEEEECCCCCHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHH
T ss_conf             5899-99676578998489878774299999997799689984799999999999999


No 165
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus HB8} PDB: 2yr0_A
Probab=94.85  E-value=0.058  Score=30.77  Aligned_cols=66  Identities=14%  Similarity=0.268  Sum_probs=45.1

Q ss_pred             CCCCCCHHHHHHHHHHCC--CCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             687781899999998528--998889986888517999999809816999728999999999996305
Q gi|254780466|r  204 HPTQKPEALLSRILVSST--KPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       204 HPTqKP~~LleriI~~~S--~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      ||.+--..+...++...-  .+|..|||-=||+|.........|-+.+|+|+++..++.|++|+....
T Consensus        18 ~~~~~~~~~~~~l~~~~~~~~~~~~vLDiGcG~G~~t~~la~~~~~V~gvD~S~~~l~~a~~r~~~~~   85 (263)
T 2yqz_A           18 HPPEVAGQIATAMASAVHPKGEEPVFLELGVGTGRIALPLIARGYRYIALDADAAMLEVFRQKIAGVD   85 (263)
T ss_dssp             CCHHHHHHHHHHHHHHCCCSSSCCEEEEETCTTSTTHHHHHTTTCEEEEEESCHHHHHHHHHHTTTSC
T ss_pred             CCHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCC
T ss_conf             67899999999999861235899989995178869999999669989999898999999874021011


No 166
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA processing, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens}
Probab=94.85  E-value=0.02  Score=33.57  Aligned_cols=24  Identities=21%  Similarity=0.293  Sum_probs=14.9

Q ss_pred             HHHHHHHHHCCCCCEEEEECCHHH
Q ss_conf             999999986396872999834688
Q gi|254780466|r   87 AWLLACRRVLKPNGTLWVIGSYHN  110 (375)
Q Consensus        87 ~wl~e~~RvLK~~Gsi~v~~~~~~  110 (375)
                      +.+.++.|+||++|.+++.+|+..
T Consensus       149 ~fl~~~~r~LkpgG~l~i~TD~~~  172 (235)
T 3ckk_A          149 TLLAEYAYVLRVGGLVYTITDVLE  172 (235)
T ss_dssp             HHHHHHHHHEEEEEEEEEEESCHH
T ss_pred             HHHHHHHHHCCCCCEEEEEECCHH
T ss_conf             799999985688988999989989


No 167
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens}
Probab=94.84  E-value=0.073  Score=30.15  Aligned_cols=49  Identities=18%  Similarity=0.078  Sum_probs=40.6

Q ss_pred             CCCCCEEEECCCCCHHHH-HHHHHHC--CEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             899888998688851799-9999809--816999728999999999996305
Q gi|254780466|r  221 TKPGDIILDPFFGSGTSG-AVAKKLR--RSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       221 S~~gDiVLDPF~GSGTT~-~aA~~lg--R~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      -+||+.|||-=||||+|. .+|...|  -+-+|+|+++..++.++++.++..
T Consensus        75 lkpG~~VLDlG~G~G~~~~~la~~vg~~G~V~aVD~s~~~l~~a~~~a~~~~  126 (233)
T 2ipx_A           75 IKPGAKVLYLGAASGTTVSHVSDIVGPDGLVYAVEFSHRSGRDLINLAKKRT  126 (233)
T ss_dssp             CCTTCEEEEECCTTSHHHHHHHHHHCTTCEEEEECCCHHHHHHHHHHHHHCT
T ss_pred             CCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHCC
T ss_conf             9999999996576898999999985999679999799999999999755146


No 168
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer, dimer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6
Probab=94.79  E-value=0.063  Score=30.54  Aligned_cols=53  Identities=25%  Similarity=0.332  Sum_probs=31.6

Q ss_pred             CEECCCHHHHHHHCCCCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCE
Q ss_conf             08517259989728414711898477876155871333678513001344357789899999889999999986396872
Q gi|254780466|r   22 KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGT  101 (375)
Q Consensus        22 kI~~GDcl~~l~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvLK~~Gs  101 (375)
                      .+++||..+.  .++++++|+|++++.......                     ..      .....+..+.|+|||+|.
T Consensus        90 ~~i~~~~~~~--~~~~~~~D~vvse~~~~~~~~---------------------e~------~~~~~~~a~~~~LkpgG~  140 (328)
T 1g6q_1           90 TLLRGKLEDV--HLPFPKVDIIISEWMGYFLLY---------------------ES------MMDTVLYARDHYLVEGGL  140 (328)
T ss_dssp             EEEESCTTTS--CCSSSCEEEEEECCCBTTBST---------------------TC------CHHHHHHHHHHHEEEEEE
T ss_pred             EEEEEEEECC--CCCCCCCCEEEEEECCEECCC---------------------CC------HHHHHHHHHHHCCCCCEE
T ss_conf             9997121005--577666429999733203046---------------------52------106789998713488808


Q ss_pred             EE
Q ss_conf             99
Q gi|254780466|r  102 LW  103 (375)
Q Consensus       102 i~  103 (375)
                      ++
T Consensus       141 ii  142 (328)
T 1g6q_1          141 IF  142 (328)
T ss_dssp             EE
T ss_pred             EC
T ss_conf             90


No 169
>2yui_A Anamorsin; cytokine-induced apoptosis inhibitor 1, ciapin1, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=94.68  E-value=0.055  Score=30.88  Aligned_cols=72  Identities=17%  Similarity=0.180  Sum_probs=41.6

Q ss_pred             EECCCHHHHHHHCCCCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCEE
Q ss_conf             85172599897284147118984778761558713336785130013443577898999998899999999863968729
Q gi|254780466|r   23 IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTL  102 (375)
Q Consensus        23 I~~GDcl~~l~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvLK~~Gsi  102 (375)
                      +.+.|.++. ..++++|+|+|+..=-..           .     ..+     ..        .+.|.|++|||||+|.+
T Consensus        51 v~~~~~l~~-~~~~~~sfD~v~s~~~~~-----------~-----~~~-----~~--------~~~l~e~~rvLKPgG~~  100 (182)
T 2yui_A           51 VENIKQLLQ-SAHKESSFDIILSGLVPG-----------S-----TTL-----HS--------AEILAEIARILRPGGCL  100 (182)
T ss_dssp             EEETTHHHH-SCCCTTCBSEEEESCSSS-----------C-----CCC-----CC--------HHHHHHHHHHBCTTSCC
T ss_pred             EEEHHHCCC-CCCCCCCCCEEEECCEEC-----------C-----CCC-----CH--------HHHHHHHHHHHCCCEEE
T ss_conf             987000034-787545763899823233-----------6-----762-----28--------99999999970688699


Q ss_pred             EEECC----------HHHHHHHHHHHHHCCCC
Q ss_conf             99834----------68889999876405786
Q gi|254780466|r  103 WVIGS----------YHNIFRIGTMLQNLNFW  124 (375)
Q Consensus       103 ~v~~~----------~~~i~~i~~~l~~~gf~  124 (375)
                      ++.-.          ......+...+...||.
T Consensus       101 ~~~~~~~~~~~~~~~~~~~~~l~~~L~laGf~  132 (182)
T 2yui_A          101 FLKEPVETAVDNNSKVKTASKLCSALTLSGLV  132 (182)
T ss_dssp             EEEEEECCCCCSSCCSCCHHHHHHHHHHHTCE
T ss_pred             EEEECCCCCCCCCCCCCCHHHHHHHHHHCCCC
T ss_conf             99832655556652010499999999876582


No 170
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A*
Probab=94.65  E-value=0.026  Score=32.83  Aligned_cols=107  Identities=18%  Similarity=0.277  Sum_probs=61.9

Q ss_pred             HHHHCCCEECCCHHHHHHHCCCCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             35532708517259989728414711898477876155871333678513001344357789899999889999999986
Q gi|254780466|r   16 IFEWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRV   95 (375)
Q Consensus        16 ~~~~~nkI~~GDcl~~l~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~Rv   95 (375)
                      ..+-+-+|+.+|+.+.|+.- +++.|+|+.|++-..+                          ....-|+.+++..|+|.
T Consensus       146 ~~dpRv~i~~~Da~~~l~~~-~~~yDvIi~D~~dp~~--------------------------~~~~L~t~eFy~~~~~~  198 (304)
T 2o07_A          146 YSSSKLTLHVGDGFEFMKQN-QDAFDVIITDSSDPMG--------------------------PAESLFKESYYQLMKTA  198 (304)
T ss_dssp             GGCTTEEEEESCHHHHHHTC-SSCEEEEEEECC-------------------------------------CHHHHHHHHH
T ss_pred             CCCCCEEEEEHHHHHHHHHC-CCCCCEEEECCCCCCC--------------------------HHHHHCCHHHHHHHHHH
T ss_conf             35772489960799999747-7778889990899886--------------------------35765379999999997


Q ss_pred             CCCCCEEEEECC-H----HHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHCCC
Q ss_conf             396872999834-6----888999987640578601246873156777757751765402132210056
Q gi|254780466|r   96 LKPNGTLWVIGS-Y----HNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSP  159 (375)
Q Consensus        96 LK~~Gsi~v~~~-~----~~i~~i~~~l~~~gf~~~n~IIW~K~n~~pn~~g~r~~~~hE~iiw~~K~~  159 (375)
                      |+++|.+.+.+. .    ..+-.+...++.+ |....    -....+|.+-+..     =..++++|..
T Consensus       199 L~~~Gv~v~q~~s~~~~~~~~~~i~~~l~~~-F~~v~----~y~~~vPsy~~g~-----w~f~~aSk~~  257 (304)
T 2o07_A          199 LKEDGVLCCQGECQWLHLDLIKEMRQFCQSL-FPVVA----YAYCTIPTYPSGQ-----IGFMLCSKNP  257 (304)
T ss_dssp             EEEEEEEEEEEECTTTCHHHHHHHHHHHHHH-CSEEE----EEEEECTTSGGGE-----EEEEEEESST
T ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHHHHHHH-CCCEE----EEEEEEEEECCHH-----CEEEEEECCC
T ss_conf             5999899990898100699999999999974-89526----8998988865701-----3879989985


No 171
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural genomics, joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413}
Probab=94.64  E-value=0.084  Score=29.78  Aligned_cols=50  Identities=20%  Similarity=0.284  Sum_probs=44.0

Q ss_pred             HHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHH
Q ss_conf             85289988899868885179999998098169997289999999999963
Q gi|254780466|r  218 VSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIAS  267 (375)
Q Consensus       218 ~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~  267 (375)
                      ....+++.-|||.=||+|..+..-.+.|.+.+|+|+++..++.|++|...
T Consensus        51 ~~~~~~~~~vLDvGCG~G~~~~~la~~g~~v~gvD~s~~~i~~Ar~~~~~  100 (245)
T 3ggd_A           51 ELLFNPELPLIDFACGNGTQTKFLSQFFPRVIGLDVSKSALEIAAKENTA  100 (245)
T ss_dssp             TTTSCTTSCEEEETCTTSHHHHHHHHHSSCEEEEESCHHHHHHHHHHSCC
T ss_pred             HHHCCCCCEEEEECCCCCHHHHHHHCCCCEEEEEECCHHHHHHHHHHCCC
T ss_conf             54069998589975879787999763784599850999999999986746


No 172
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str}
Probab=94.64  E-value=0.081  Score=29.87  Aligned_cols=47  Identities=19%  Similarity=0.247  Sum_probs=40.3

Q ss_pred             CCCCCEEEECCCCCHHHHHHHHHHC-CEEEEEEECHHHHHHHHHHHHH
Q ss_conf             8998889986888517999999809-8169997289999999999963
Q gi|254780466|r  221 TKPGDIILDPFFGSGTSGAVAKKLR-RSFIGIEMKQDYIDIATKRIAS  267 (375)
Q Consensus       221 S~~gDiVLDPF~GSGTT~~aA~~lg-R~~IGiE~~~~Y~~~a~~Rl~~  267 (375)
                      ..+|.-|||-=||+|..+....+.| ++.+|+|+++..++.|++|...
T Consensus        42 ~~~g~~VLDiGcG~G~~~~~l~~~g~~~v~giD~S~~~i~~a~~~~~~   89 (253)
T 3g5l_A           42 DFNQKTVLDLGCGFGWHCIYAAEHGAKKVLGIDLSERMLTEAKRKTTS   89 (253)
T ss_dssp             CCTTCEEEEETCTTCHHHHHHHHTTCSEEEEEESCHHHHHHHHHHCCC
T ss_pred             CCCCCEEEEECCCCCHHHHHHHHCCCCEEEEEECCCHHHHHHHHHHCC
T ss_conf             789698999837784999999964999899994850656899874034


No 173
>3cvo_A Methyltransferase-like protein of unknown function; YP_167254.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3}
Probab=94.62  E-value=0.13  Score=28.68  Aligned_cols=165  Identities=13%  Similarity=0.137  Sum_probs=96.0

Q ss_pred             CCCCC--CCCCCCHH--HHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHCCCCCHH
Q ss_conf             87533--68778189--999999852899888998688851799999980981699972899999999999630568765
Q gi|254780466|r  199 DGEKL--HPTQKPEA--LLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNI  274 (375)
Q Consensus       199 ~g~k~--HPTqKP~~--LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~~~~~~  274 (375)
                      .+++.  +.|..+.+  |++..+.    ++++||.- +-.|||..+|+..+.+.+.+|.|+++++..++++.........
T Consensus         6 ~~~~~~p~lt~~~~e~~~l~~~l~----~~~~iLE~-GSGgST~~~a~~~~~~I~SVE~d~~W~~~v~~~l~~~~~~~~~   80 (202)
T 3cvo_A            6 SGDQMRPELTMPPAEAEALRMAYE----EAEVILEY-GSGGSTVVAAELPGKHVTSVESDRAWARMMKAWLAANPPAEGT   80 (202)
T ss_dssp             ---CCCCCCCSCHHHHHHHHHHHH----HCSEEEEE-SCSHHHHHHHTSTTCEEEEEESCHHHHHHHHHHHHHSCCCTTC
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHC----CCCEEEEE-CCCHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHCCCCCCC
T ss_conf             777668777899889999999825----79999996-8989899999817980899679999999999986541330123


Q ss_pred             HHCCCC-----------CCCCCCCCCHHHHHHC---C-C-CCCCCEEECCCCCEEE------EECCCCCEEECC-EEC-C
Q ss_conf             630244-----------4333775523469882---8-6-5877657668980699------981598178698-653-1
Q gi|254780466|r  275 ELTVLT-----------GKRTEPRVAFNLLVER---G-L-IQPGQILTNAQGNISA------TVCADGTLISGT-ELG-S  330 (375)
Q Consensus       275 ~~~~~~-----------~~~~~~rvpfg~lie~---g-~-l~~g~~L~~~~~~~~a------~v~~DG~l~~~~-~~g-s  330 (375)
                      .+....           ......+..|......   . . -++--+|.|-+-|..|      .++.+|.|+.+| ... .
T Consensus        81 ~~~~~~~d~g~~~~~g~p~~~~~~~~~~~Y~~~i~~~~~~~~~DlIlIDGR~R~aC~l~~~~~lk~ggiIifDDy~~R~~  160 (202)
T 3cvo_A           81 EVNIVWTDIGPTGDWGHPVSDAKWRSYPDYPLAVWRTEGFRHPDVVLVDGRFRVGCALATAFSITRPVTLLFDDYSQRRW  160 (202)
T ss_dssp             EEEEEECCCSSBCGGGCBSSSTTGGGTTHHHHGGGGCTTCCCCSEEEECSSSHHHHHHHHHHHCSSCEEEEETTGGGCSS
T ss_pred             CCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEECCHHHHHHHHHHHHHCCCCCEEEEECCCCCHH
T ss_conf             34434467664333689962544401988788898753456887899756378999999999669994899967877626


Q ss_pred             HHHHHHHHCCCCCCCCEEEEEEEECCEEEEHHHHHHHHHH
Q ss_conf             9999987449810067114679759957129999999998
Q gi|254780466|r  331 IHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRK  370 (375)
Q Consensus       331 Ih~i~a~~~~~~~cNGw~fw~~~~~~~~~~id~lR~~~r~  370 (375)
                      -|.|---+.--+.+.---.+++  +.+..+.++|-+.++.
T Consensus       161 Yh~v~~~~~~~~~~~r~a~F~v--~~~~~~~~~l~~~~~~  198 (202)
T 3cvo_A          161 QHQVEEFLGAPLMIGRLAAFQV--EPQPIPPGSLMQLIRT  198 (202)
T ss_dssp             GGGGHHHHCCCEEETTEEEEEE--CCCCCCGGGHHHHHHH
T ss_pred             HHHHHHHHHHHHHCCCEEEEEE--CCCCCCHHHHHHHHHH
T ss_conf             7999998658881086689986--8988998999999998


No 174
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, PSI, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13
Probab=94.58  E-value=0.18  Score=27.71  Aligned_cols=138  Identities=17%  Similarity=0.247  Sum_probs=78.0

Q ss_pred             CCCC--CCHHHHHHHHHHCCCCCCEEEECCCCCHHHHH-HHHHHC--CEEEEEEECHHHHHHHHHHHHHCCCC--CHHHH
Q ss_conf             6877--81899999998528998889986888517999-999809--81699972899999999999630568--76563
Q gi|254780466|r  204 HPTQ--KPEALLSRILVSSTKPGDIILDPFFGSGTSGA-VAKKLR--RSFIGIEMKQDYIDIATKRIASVQPL--GNIEL  276 (375)
Q Consensus       204 HPTq--KP~~LleriI~~~S~~gDiVLDPF~GSGTT~~-aA~~lg--R~~IGiE~~~~Y~~~a~~Rl~~~~~~--~~~~~  276 (375)
                      |-||  .|...-.-+..+--.||+.|||-=+|||+... .|...|  =+-+++|++++.++.|+++++.....  .+..+
T Consensus        78 r~tqiiypkD~~~Ii~~ldi~PG~~VLE~GtGsG~lT~~LAr~vgp~G~V~t~D~~~~~~~~Ar~n~~~~~~~~~~nv~~  157 (280)
T 1i9g_A           78 RGPQVIYPKDAAQIVHEGDIFPGARVLEAGAGSGALTLSLLRAVGPAGQVISYEQRADHAEHARRNVSGCYGQPPDNWRL  157 (280)
T ss_dssp             SCSCCCCHHHHHHHHHHTTCCTTCEEEEECCTTSHHHHHHHHHHCTTSEEEEECSCHHHHHHHHHHHHHHHTSCCTTEEE
T ss_pred             CCCCCCCHHHHHHHHHHHCCCCCCEEEEEEECCHHHHHHHHHHHCCCEEEEEEECCHHHHHHHHHHHHHHCCCCCCEEEE
T ss_conf             88635585899999998499999989992276159999999974998599999589999999998555431578862999


Q ss_pred             CCCCCCC-CCCCCCHHHHHHCCCCCCCCEEECCCCCEEEEECCCCCEEECCEECCHHHHHHHHCCCCCCCCEE
Q ss_conf             0244433-37755234698828658776576689806999815981786986531999998744981006711
Q gi|254780466|r  277 TVLTGKR-TEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTLISGTELGSIHRVGAKVSGSETCNGWN  348 (375)
Q Consensus       277 ~~~~~~~-~~~rvpfg~lie~g~l~~g~~L~~~~~~~~a~v~~DG~l~~~~~~gsIh~i~a~~~~~~~cNGw~  348 (375)
                      ...+... ..|--+|.. |.-.+..|-+.|-    ...-.++++|.|+.  ..-.|.|+...++-....+||.
T Consensus       158 ~~~d~~~~~~~~~~fD~-VflDlp~P~~~l~----~~~~~LkpGG~lv~--~~P~i~Qv~~~~~al~~~~~f~  223 (280)
T 1i9g_A          158 VVSDLADSELPDGSVDR-AVLDMLAPWEVLD----AVSRLLVAGGVLMV--YVATVTQLSRIVEALRAKQCWT  223 (280)
T ss_dssp             ECSCGGGCCCCTTCEEE-EEEESSCGGGGHH----HHHHHEEEEEEEEE--EESSHHHHHHHHHHHHHHSSBC
T ss_pred             EECCCCCCCCCCCCCCE-EEECCCCHHHHHH----HHHHHCCCCCEEEE--ECCCHHHHHHHHHHHHHHCCCC
T ss_conf             95551225566788786-8972788899999----99984477989999--9398999999999999738987


No 175
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15
Probab=94.57  E-value=0.015  Score=34.25  Aligned_cols=60  Identities=12%  Similarity=0.015  Sum_probs=45.6

Q ss_pred             HHHHHHHHHHCCCCCCEEEECCCCCHHHH-HHHHHHCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             89999999852899888998688851799-9999809816999728999999999996305
Q gi|254780466|r  210 EALLSRILVSSTKPGDIILDPFFGSGTSG-AVAKKLRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       210 ~~LleriI~~~S~~gDiVLDPF~GSGTT~-~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      ...+.+++.....+|..|||-=||+|.-. .+|.+.+.+.+|+|+++.-++.|++++++..
T Consensus        42 ~~~~~~~~~~~~~~g~~vLDlGCG~G~~~~~~a~~~~~~V~giD~S~~~i~~a~~~~~~~~  102 (263)
T 2a14_A           42 LECLHKTFGPGGLQGDTLIDIGSGPTIYQVLAACDSFQDITLSDFTDRNREELEKWLKKEP  102 (263)
T ss_dssp             HHHHHHHHSTTSCCEEEEEESSCTTCCGGGTTGGGTEEEEEEEESCHHHHHHHHHHHHTCT
T ss_pred             HHHHHHHHCCCCCCCCEEEEECCCCCHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHCC
T ss_conf             9999998166888998899978886289999998479768995189999999999998657


No 176
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus}
Probab=94.56  E-value=0.15  Score=28.20  Aligned_cols=47  Identities=15%  Similarity=0.116  Sum_probs=38.8

Q ss_pred             CCCEEEECCCCCHHHH-HHHHHHCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             9888998688851799-9999809816999728999999999996305
Q gi|254780466|r  223 PGDIILDPFFGSGTSG-AVAKKLRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       223 ~gDiVLDPF~GSGTT~-~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      .+..|||-=||.|-.+ .-.+.--+.++|+|++++-++.|++|.++..
T Consensus        48 ~~~~VLDlgcG~GgDl~K~~~~~~~~vvGiDiS~~~I~~A~~R~~~~~   95 (302)
T 2vdw_A           48 NKRKVLAIDFGNGADLEKYFYGEIALLVATDPDADAIARGNERYNKLN   95 (302)
T ss_dssp             SCCEEEETTCTTTTTHHHHHHTTCSEEEEEESCHHHHHHHHHHHHHHC
T ss_pred             CCCEEEEEEEEECHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHC
T ss_conf             899799995000452799996699889999798999999999999721


No 177
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A
Probab=94.54  E-value=0.15  Score=28.28  Aligned_cols=48  Identities=17%  Similarity=0.256  Sum_probs=39.3

Q ss_pred             CCCCEEEECCCCCHHHHHHHHHH--CCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             99888998688851799999980--9816999728999999999996305
Q gi|254780466|r  222 KPGDIILDPFFGSGTSGAVAKKL--RRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       222 ~~gDiVLDPF~GSGTT~~aA~~l--gR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      ..+.-|||--||+|..+..-.+.  ..+.+|+|++++.++.|++|+....
T Consensus        28 ~~~~rVLDvGcG~G~~~~~l~~~~~~~~v~gvD~s~~~l~~A~~~~~~~~   77 (217)
T 3jwh_A           28 SNARRVIDLGCGQGNLLKILLKDSFFEQITGVDVSYRSLEIAQERLDRLR   77 (217)
T ss_dssp             TTCCEEEEETCTTCHHHHHHHHCTTCSEEEEEESCHHHHHHHHHHHTTCC
T ss_pred             CCCCEEEEEECCCCHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHHHHCC
T ss_conf             18398999818887999999984765225210389999999999887624


No 178
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17
Probab=94.49  E-value=0.12  Score=28.84  Aligned_cols=92  Identities=13%  Similarity=0.238  Sum_probs=56.5

Q ss_pred             HHHCCCEECCCHHHHHHHCCCCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             55327085172599897284147118984778761558713336785130013443577898999998899999999863
Q gi|254780466|r   17 FEWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVL   96 (375)
Q Consensus        17 ~~~~nkI~~GDcl~~l~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvL   96 (375)
                      .+=+-+|+.+|+...++.- +++.|+|+.|+|-..+...                     +     -|+++.++.|++.|
T Consensus       127 ~dprv~i~~~Da~~~l~~~-~~~yDvIi~D~~~p~~~~~---------------------~-----L~t~eFy~~~~~~L  179 (275)
T 1iy9_A          127 DDPRVDVQVDDGFMHIAKS-ENQYDVIMVDSTEPVGPAV---------------------N-----LFTKGFYAGIAKAL  179 (275)
T ss_dssp             TSTTEEEEESCSHHHHHTC-CSCEEEEEESCSSCCSCCC---------------------C-----CSTTHHHHHHHHHE
T ss_pred             CCCCCEEEECHHHHHHHCC-CCCCCEEEEECCCCCCCCH---------------------H-----HCCHHHHHHHHHHH
T ss_conf             3877438988589987505-6776789993899887212---------------------1-----16899999999874


Q ss_pred             CCCCEEEEECC--H---HHHHHHHHHHHHCCCCEEEEEEEECCCCCCCC
Q ss_conf             96872999834--6---88899998764057860124687315677775
Q gi|254780466|r   97 KPNGTLWVIGS--Y---HNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF  140 (375)
Q Consensus        97 K~~Gsi~v~~~--~---~~i~~i~~~l~~~gf~~~n~IIW~K~n~~pn~  140 (375)
                      +++|.+...+.  +   .....+...+.++ |  .+..+|.-.  +|.+
T Consensus       180 ~~~Gv~v~q~~s~~~~~~~~~~~~~tl~~v-F--~~v~~y~~~--iPty  223 (275)
T 1iy9_A          180 KEDGIFVAQTDNPWFTPELITNVQRDVKEI-F--PITKLYTAN--IPTY  223 (275)
T ss_dssp             EEEEEEEEECCCTTTCHHHHHHHHHHHHTT-C--SEEEEEEEC--CTTS
T ss_pred             CCCCEEEECCCCHHHHHHHHHHHHHHHHHH-C--CCEEEEEEE--EEEE
T ss_conf             799799985688133467889999999987-8--973899988--4032


No 179
>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A*
Probab=94.49  E-value=0.17  Score=27.96  Aligned_cols=24  Identities=21%  Similarity=0.227  Sum_probs=10.7

Q ss_pred             EECCCHHHHHHHCCCCCCCEEEECCCCC
Q ss_conf             8517259989728414711898477876
Q gi|254780466|r   23 IIKGNSISVLEKLPAKSVDLIFADPPYN   50 (375)
Q Consensus        23 I~~GDcl~~l~~Lpd~sVDlI~tDPPYn   50 (375)
                      ++...+++.|.-.|++    +|.|=-|+
T Consensus        13 Vll~Evl~~L~~~~~g----~~vD~T~G   36 (301)
T 1m6y_A           13 VMVREVIEFLKPEDEK----IILDCTVG   36 (301)
T ss_dssp             TTHHHHHHHHCCCTTC----EEEETTCT
T ss_pred             HHHHHHHHHCCCCCCC----EEEECCCC
T ss_conf             4199999836838999----99991889


No 180
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, structural genomics; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45
Probab=94.42  E-value=0.048  Score=31.28  Aligned_cols=70  Identities=24%  Similarity=0.332  Sum_probs=40.1

Q ss_pred             CCEECCCHHHHHHHCCCCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             70851725998972841471189847787615587133367851300134435778989999988999999998639687
Q gi|254780466|r   21 DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNG  100 (375)
Q Consensus        21 nkI~~GDcl~~l~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvLK~~G  100 (375)
                      ..+.++|.+   ..-+.+++|+|++.|||+.............       .+  ..+...+.    .|+..+.+.|+++|
T Consensus       238 ~~i~~~d~~---~~~~~~~fD~Ii~NPPf~~~~~~~~~~~~~~-------~~--~~~~~~~~----~Fi~~~l~~Lk~~G  301 (445)
T 2okc_A          238 SPIVCEDSL---EKEPSTLVDVILANPPFGTRPAGSVDINRPD-------FY--VETKNNQL----NFLQHMMLMLKTGG  301 (445)
T ss_dssp             CSEEECCTT---TSCCSSCEEEEEECCCSSCCCTTCCCCCCTT-------SS--SCCSCHHH----HHHHHHHHHEEEEE
T ss_pred             CEEECCCHH---HHCCCCCCCEEECCCCCCCCCCCCCCCCHHH-------HC--CCCCCHHH----HHHHHHHHHHCCCC
T ss_conf             012215303---2024346872245899788865533102244-------30--12330779----99999999821798


Q ss_pred             EEEEEC
Q ss_conf             299983
Q gi|254780466|r  101 TLWVIG  106 (375)
Q Consensus       101 si~v~~  106 (375)
                      .+.++.
T Consensus       302 ~~aiIv  307 (445)
T 2okc_A          302 RAAVVL  307 (445)
T ss_dssp             EEEEEE
T ss_pred             EEEEEE
T ss_conf             599993


No 181
>2f8l_A Hypothetical protein LMO1582; 16411011, structural genomics, PSI, protein structure initiative, joint center for structural genomics; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45
Probab=94.38  E-value=0.02  Score=33.51  Aligned_cols=74  Identities=18%  Similarity=0.189  Sum_probs=42.1

Q ss_pred             HHHCCCEECCCHHHHHHHCCCCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             55327085172599897284147118984778761558713336785130013443577898999998899999999863
Q gi|254780466|r   17 FEWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVL   96 (375)
Q Consensus        17 ~~~~nkI~~GDcl~~l~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvL   96 (375)
                      ......++++|.+   ...+.+.+|+|+++|||+............       .......+ ..+.    .++..+.+.|
T Consensus       182 ~~~~~~~~~~d~~---~~~~~~~fD~iv~NPP~~~~~~~~~~~~~~-------~~~~~~~~-~~~~----~fi~~~~~~L  246 (344)
T 2f8l_A          182 QRQKMTLLHQDGL---ANLLVDPVDVVISDLPVGYYPDDENAKTFE-------LCREEGHS-FAHF----LFIEQGMRYT  246 (344)
T ss_dssp             HTCCCEEEESCTT---SCCCCCCEEEEEEECCCSEESCHHHHTTST-------TCCSSSCE-EHHH----HHHHHHHHTE
T ss_pred             CCCHHHHHCCCCC---CCCCCCCCCCCCCCCCCCCCCCHHHHHHHC-------CCCCCCCC-HHHH----HHHHHHHHHC
T ss_conf             2221233100110---013467767211579966763002444200-------01357742-5999----9999999854


Q ss_pred             CCCCEEEEE
Q ss_conf             968729998
Q gi|254780466|r   97 KPNGTLWVI  105 (375)
Q Consensus        97 K~~Gsi~v~  105 (375)
                      +++|.+.++
T Consensus       247 k~~G~~~~I  255 (344)
T 2f8l_A          247 KPGGYLFFL  255 (344)
T ss_dssp             EEEEEEEEE
T ss_pred             CCCCEEEEE
T ss_conf             888629999


No 182
>3cc8_A Putative methyltransferase; NP_977653.1, structural genomics, joint center for structural genomics, JCSG; 1.64A {Bacillus cereus atcc 10987}
Probab=94.36  E-value=0.055  Score=30.88  Aligned_cols=54  Identities=26%  Similarity=0.207  Sum_probs=43.8

Q ss_pred             HHHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHCCC
Q ss_conf             985289988899868885179999998098169997289999999999963056
Q gi|254780466|r  217 LVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQP  270 (375)
Q Consensus       217 I~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~~  270 (375)
                      +.....++..|||-=||+|..+..-.+.|-+.+|+|+++..++.|++++.++.-
T Consensus        26 ~~~~~~~~~~ILDIGcG~G~~~~~l~~~~~~v~giD~s~~~i~~a~~~~~~~~~   79 (230)
T 3cc8_A           26 LKHIKKEWKEVLDIGCSSGALGAAIKENGTRVSGIEAFPEAAEQAKEKLDHVVL   79 (230)
T ss_dssp             HTTCCTTCSEEEEETCTTSHHHHHHHTTTCEEEEEESSHHHHHHHHTTSSEEEE
T ss_pred             HHHCCCCCCEEEEECCCCCHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEE
T ss_conf             973685799699951888699999997599899996725666665411312331


No 183
>1or8_A Protein arginine N-methyltransferase 1; protein arginine methylation, adoMet-dependent methylation, transferase; HET: SAH; 2.35A {Rattus norvegicus} SCOP: c.66.1.6 PDB: 1orh_A* 1ori_A*
Probab=94.27  E-value=0.099  Score=29.35  Aligned_cols=23  Identities=43%  Similarity=0.687  Sum_probs=12.9

Q ss_pred             EECCCHHHHHHHCCCCCCCEEEECC
Q ss_conf             8517259989728414711898477
Q gi|254780466|r   23 IIKGNSISVLEKLPAKSVDLIFADP   47 (375)
Q Consensus        23 I~~GDcl~~l~~Lpd~sVDlI~tDP   47 (375)
                      +++||..++  .+|++++|+|++++
T Consensus       110 ~~~~~~~~l--~~~~~~~DvivsE~  132 (340)
T 1or8_A          110 IIKGKVEEV--ELPVEKVDIIISEW  132 (340)
T ss_dssp             EEESCTTTC--CCSSSCEEEEEECC
T ss_pred             EEEEEEEEC--CCCCCCCCEEEEEE
T ss_conf             997313430--37865310799750


No 184
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53
Probab=94.18  E-value=0.068  Score=30.34  Aligned_cols=52  Identities=17%  Similarity=0.190  Sum_probs=41.4

Q ss_pred             HHCCCCCCEEEECCCCCHHHHHH--HHHHCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             85289988899868885179999--99809816999728999999999996305
Q gi|254780466|r  218 VSSTKPGDIILDPFFGSGTSGAV--AKKLRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       218 ~~~S~~gDiVLDPF~GSGTT~~a--A~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      ..+.+++-+|||-=||+|..++.  +..-+.++||+|+++..+..|.+++++..
T Consensus        33 ~~F~~~~p~vLEIGcG~G~~~~~lA~~~p~~~~iGiD~~~~~i~~a~~~~~~~~   86 (213)
T 2fca_A           33 TVFGNDNPIHIEVGTGKGQFISGMAKQNPDINYIGIELFKSVIVTAVQKVKDSE   86 (213)
T ss_dssp             HHHTSCCCEEEEECCTTSHHHHHHHHHCTTSEEEEECSCHHHHHHHHHHHHHSC
T ss_pred             HHCCCCCCEEEEEECCCCHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHC
T ss_conf             974999952999803588999999986899828999835999999999999838


No 185
>3adn_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, polyamine biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} PDB: 3o4f_A
Probab=94.17  E-value=0.014  Score=34.49  Aligned_cols=58  Identities=21%  Similarity=0.433  Sum_probs=32.8

Q ss_pred             CCEECCCHHHHHHHCCCCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             70851725998972841471189847787615587133367851300134435778989999988999999998639687
Q gi|254780466|r   21 DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNG  100 (375)
Q Consensus        21 nkI~~GDcl~~l~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvLK~~G  100 (375)
                      =+|+.+|..+.|+. .+++.|+|+.|++-..+                          ...--|+.+++..|+|.|+++|
T Consensus       140 v~i~~~Da~~~l~~-~~~~yDvIi~D~~dp~~--------------------------~~~~L~t~eFy~~~~~~L~p~G  192 (294)
T 3adn_A          140 FKLVIDDGVNFVNQ-TSQTFDVIISDCTDPIG--------------------------PGESLFTSAFYEGCKRCLNPGG  192 (294)
T ss_dssp             CCEECSCSCC---C-CCCCEEEEEECC------------------------------------CCHHHHHHHHHTEEEEE
T ss_pred             EEEEECHHHHHHHH-CCCCCCEEEEECCCCCC--------------------------CCHHHCCHHHHHHHHHHHCCCC
T ss_conf             79995168999851-68877789980887788--------------------------7746568999999998738995


Q ss_pred             EEEEE
Q ss_conf             29998
Q gi|254780466|r  101 TLWVI  105 (375)
Q Consensus       101 si~v~  105 (375)
                      .+.+.
T Consensus       193 v~v~q  197 (294)
T 3adn_A          193 IFVAQ  197 (294)
T ss_dssp             EEEEE
T ss_pred             EEEEE
T ss_conf             89992


No 186
>3ege_A Putative methyltransferase from antibiotic biosynthesis pathway; YP_324569.1, structural genomics; 2.40A {Anabaena variabilis atcc 29413}
Probab=94.15  E-value=0.082  Score=29.84  Aligned_cols=18  Identities=6%  Similarity=0.211  Sum_probs=11.7

Q ss_pred             HHHHHHHHCCCCCEEEEE
Q ss_conf             999999863968729998
Q gi|254780466|r   88 WLLACRRVLKPNGTLWVI  105 (375)
Q Consensus        88 wl~e~~RvLK~~Gsi~v~  105 (375)
                      .|.+++|+|||+|.+++.
T Consensus       113 ~l~e~~r~LkpgG~l~~~  130 (261)
T 3ege_A          113 SFQEMQRIIRDGTIVLLT  130 (261)
T ss_dssp             HHHHHHHHBCSSCEEEEE
T ss_pred             HHHHHHHHCCCCCEEEEE
T ss_conf             999999982818589999


No 187
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, tRNA processing; HET: SAM; 1.50A {Escherichia coli K12} PDB: 3dxx_A* 3dxz_A*
Probab=94.10  E-value=0.03  Score=32.49  Aligned_cols=51  Identities=22%  Similarity=0.269  Sum_probs=41.5

Q ss_pred             HCCCCCCEEEECCCCCHHHHH-HHHH-HCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             528998889986888517999-9998-09816999728999999999996305
Q gi|254780466|r  219 SSTKPGDIILDPFFGSGTSGA-VAKK-LRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       219 ~~S~~gDiVLDPF~GSGTT~~-aA~~-lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      .+.+++-+|||-=||+|..++ .|.+ -..+|||||+.+..+..|.++++...
T Consensus        30 lF~~~~pliLEIGcG~G~~l~~~A~~~P~~~~iGiEi~~~~v~~a~~~~~~~~   82 (218)
T 3dxy_A           30 LFGREAPVTLEIGFGMGASLVAMAKDRPEQDFLGIEVHSPGVGACLASAHEEG   82 (218)
T ss_dssp             HHSSCCCEEEEESCTTCHHHHHHHHHCTTSEEEEECSCHHHHHHHHHHHHHTT
T ss_pred             HCCCCCCEEEEECCCCCHHHHHHHHHCCCCCEEEEEEECCCEEEEHHHCCHHH
T ss_conf             72999953999726888999999996899988999972350553032120121


No 188
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38
Probab=94.09  E-value=0.18  Score=27.79  Aligned_cols=50  Identities=14%  Similarity=0.318  Sum_probs=40.4

Q ss_pred             CCCCCCEEEECCCCCHH-HHHHHHHHC--CEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             28998889986888517-999999809--816999728999999999996305
Q gi|254780466|r  220 STKPGDIILDPFFGSGT-SGAVAKKLR--RSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       220 ~S~~gDiVLDPF~GSGT-T~~aA~~lg--R~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      --.+|+.|||..+|.|. |...|..++  ..-+++|+++.-++..++++++..
T Consensus        99 ~~~~g~~VLD~CAapGgKt~~la~l~~~~~~i~a~D~~~~Rl~~l~~~~~r~g  151 (309)
T 2b9e_A           99 DPPPGSHVIDACAAPGNKTSHLAALLKNQGKIFAFDLDAKRLASMATLLARAG  151 (309)
T ss_dssp             CCCTTCEEEESSCTTCHHHHHHHHHHTTCSEEEEEESCHHHHHHHHHHHHHTT
T ss_pred             CCCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHCC
T ss_conf             99999949996789657999999872589669998087888999987677508


No 189
>2oo3_A Protein involved in catabolism of external DNA; structural genomics, unknown function, PSI-2, protein structure initiative; 2.00A {Legionella pneumophila subsp} SCOP: c.66.1.59
Probab=94.03  E-value=0.3  Score=26.38  Aligned_cols=85  Identities=18%  Similarity=0.144  Sum_probs=49.8

Q ss_pred             CCCEECCCHHHHHHH-CCC-CCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCC
Q ss_conf             270851725998972-841-471189847787615587133367851300134435778989999988999999998639
Q gi|254780466|r   20 KDKIIKGNSISVLEK-LPA-KSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLK   97 (375)
Q Consensus        20 ~nkI~~GDcl~~l~~-Lpd-~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvLK   97 (375)
                      .=++.+.|..+.+.. ||. +.=-||++||||-.                          -+||..-. +.+.++++- =
T Consensus       138 ~~~v~~~DG~~~l~allPP~erRgLVLIDPpYE~--------------------------k~Ey~~v~-~~l~~a~kR-~  189 (283)
T 2oo3_A          138 KVYVNHTDGVSKLNALLPPPEKRGLIFIDPSYER--------------------------KEEYKEIP-YAIKNAYSK-F  189 (283)
T ss_dssp             CEEEECSCHHHHHHHHCSCTTSCEEEEECCCCCS--------------------------TTHHHHHH-HHHHHHHHH-C
T ss_pred             CCEEEECCHHHHHHHHCCCCCCCEEEEECCCCCC--------------------------HHHHHHHH-HHHHHHHHH-C
T ss_conf             7569816578899866799878668995798665--------------------------43899999-999999986-6


Q ss_pred             CCCEEEEE---CCHHHHHHHHHHHHHCCCCEEEEEEEE
Q ss_conf             68729998---346888999987640578601246873
Q gi|254780466|r   98 PNGTLWVI---GSYHNIFRIGTMLQNLNFWILNDIVWR  132 (375)
Q Consensus        98 ~~Gsi~v~---~~~~~i~~i~~~l~~~gf~~~n~IIW~  132 (375)
                      ++|++.|+   -+-.....+...+++.|...+..-.|.
T Consensus       190 ~~G~~~iWYPi~~~~~~~~~~~~l~~~~~k~l~~El~v  227 (283)
T 2oo3_A          190 STGLYCVWYPVVNKAWTEQFLRKMREISSKSVRIELHL  227 (283)
T ss_dssp             TTSEEEEEEEESSHHHHHHHHHHHHHHCSSEEEEEEEC
T ss_pred             CCCEEEEEEECCCHHHHHHHHHHHHHCCCCCEEEEEEE
T ss_conf             68659998204560888999999985386706899983


No 190
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E
Probab=94.01  E-value=0.02  Score=33.54  Aligned_cols=47  Identities=17%  Similarity=0.126  Sum_probs=33.4

Q ss_pred             CCCCCEEEECCCCCHHHH--HHHHHHCCEEEEEEECHHHHHHHHHHHHH
Q ss_conf             899888998688851799--99998098169997289999999999963
Q gi|254780466|r  221 TKPGDIILDPFFGSGTSG--AVAKKLRRSFIGIEMKQDYIDIATKRIAS  267 (375)
Q Consensus       221 S~~gDiVLDPF~GSGTT~--~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~  267 (375)
                      ..+.-+|||-=||.|..+  .|...-+.+|||+|+.+..+..+.+|+..
T Consensus        47 ~~~~p~iLeIGcG~G~~l~~lA~~~p~~~~iGiEi~~~~v~~~~~ri~~   95 (246)
T 2vdv_E           47 MTKKVTIADIGCGFGGLMIDLSPAFPEDLILGMEIRVQVTNYVEDRIIA   95 (246)
T ss_dssp             BSCCEEEEEETCTTSHHHHHHHHHSTTSEEEEEESCHHHHHHHHHHHHH
T ss_pred             CCCCCEEEEECCCCCHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHH
T ss_conf             6899879998268998999999868987589885036899999999999


No 191
>3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus}
Probab=93.97  E-value=0.078  Score=29.99  Aligned_cols=77  Identities=17%  Similarity=0.204  Sum_probs=36.8

Q ss_pred             EECCCHHHHH-HHCCCCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCC-CCC
Q ss_conf             8517259989-72841471189847787615587133367851300134435778989999988999999998639-687
Q gi|254780466|r   23 IIKGNSISVL-EKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLK-PNG  100 (375)
Q Consensus        23 I~~GDcl~~l-~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvLK-~~G  100 (375)
                      |.++|.+..- .....+.+|+|++.|||+.............++..+.....  .+..+|     .|+..+...|+ ++|
T Consensus       280 i~~~d~l~~~~~~~~~~~fD~Il~NPPfg~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~-----~fi~~~~~~L~~~gG  352 (542)
T 3lkd_A          280 LHNADTLDEDWPTQEPTNFDGVLMNPPYSAKWSASSGFMDDPRFSPFGKLAP--KSKADF-----AFLLHGYYHLKQDNG  352 (542)
T ss_dssp             EEESCTTTSCSCCSSCCCBSEEEECCCTTCCCCCCGGGGGSTTTGGGSSCCC--TTCCHH-----HHHHHHHHTBCTTTC
T ss_pred             EECCCCCCCCCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCHHH-----HHHHHHHHHHCCCCC
T ss_conf             3205654444432323200035634886777674211123510013577899--862599-----999999998663787


Q ss_pred             EEEEEC
Q ss_conf             299983
Q gi|254780466|r  101 TLWVIG  106 (375)
Q Consensus       101 si~v~~  106 (375)
                      .+.|+.
T Consensus       353 ~~~iV~  358 (542)
T 3lkd_A          353 VMAIVL  358 (542)
T ss_dssp             EEEEEE
T ss_pred             EEEEEE
T ss_conf             299995


No 192
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei}
Probab=93.95  E-value=0.32  Score=26.29  Aligned_cols=46  Identities=17%  Similarity=0.330  Sum_probs=21.4

Q ss_pred             CCCCEEEECCCCCHHHHHHHHHHC--CEEEEEEECHHHHHHHHHHHHH
Q ss_conf             998889986888517999999809--8169997289999999999963
Q gi|254780466|r  222 KPGDIILDPFFGSGTSGAVAKKLR--RSFIGIEMKQDYIDIATKRIAS  267 (375)
Q Consensus       222 ~~gDiVLDPF~GSGTT~~aA~~lg--R~~IGiE~~~~Y~~~a~~Rl~~  267 (375)
                      .||+.|||-=||+|..+....+.+  .+.+|+|+++..++.|+++.+.
T Consensus        36 ~pg~rVLDiGcG~G~~~~~la~~~~~~~v~gvD~s~~~~~~a~~~~~~   83 (276)
T 3mgg_A           36 PPGAKVLEAGCGIGAQTVILAKNNPDAEITSIDISPESLEKARENTEK   83 (276)
T ss_dssp             CTTCEEEETTCTTSHHHHHHHHHCTTSEEEEEESCHHHHHHHHHHHHH
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHH
T ss_conf             999989995585889999999879997899997956763222211221


No 193
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens}
Probab=93.95  E-value=0.085  Score=29.74  Aligned_cols=47  Identities=21%  Similarity=0.253  Sum_probs=39.8

Q ss_pred             CCCCEEEECCCCCHHHHH-HHHHH-CCEEEEEEECHHHHHHHHHHHHHC
Q ss_conf             998889986888517999-99980-981699972899999999999630
Q gi|254780466|r  222 KPGDIILDPFFGSGTSGA-VAKKL-RRSFIGIEMKQDYIDIATKRIASV  268 (375)
Q Consensus       222 ~~gDiVLDPF~GSGTT~~-aA~~l-gR~~IGiE~~~~Y~~~a~~Rl~~~  268 (375)
                      .+|..|||-=||||..+. .|.+. +.+.+|+|+++..++.|.++++..
T Consensus        45 ~~~~~vLDiGCG~G~~~i~la~~~~~~~v~GiDis~~~i~~A~~n~~~~   93 (292)
T 3g07_A           45 FRGRDVLDLGCNVGHLTLSIACKWGPSRMVGLDIDSRLIHSARQNIRHY   93 (292)
T ss_dssp             TTTSEEEEESCTTCHHHHHHHHHTCCSEEEEEESCHHHHHHHHHTC---
T ss_pred             CCCCEEEEEECCCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHH
T ss_conf             6999599985797899999998789988999709889999999999983


No 194
>1r18_A Protein-L-isoaspartate(D-aspartate)-O- methyltransferase; isomerization, protein repair, S- adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7
Probab=93.95  E-value=0.32  Score=26.29  Aligned_cols=58  Identities=22%  Similarity=0.269  Sum_probs=44.5

Q ss_pred             HHHHHHHHHC---CCCCCEEEECCCCCHHHH-HHHHHH-------CCEEEEEEECHHHHHHHHHHHHHC
Q ss_conf             9999999852---899888998688851799-999980-------981699972899999999999630
Q gi|254780466|r  211 ALLSRILVSS---TKPGDIILDPFFGSGTSG-AVAKKL-------RRSFIGIEMKQDYIDIATKRIASV  268 (375)
Q Consensus       211 ~LleriI~~~---S~~gDiVLDPF~GSGTT~-~aA~~l-------gR~~IGiE~~~~Y~~~a~~Rl~~~  268 (375)
                      .+.-++++..   -++|+-|||-=+|||-.. ++|+.+       +-+-+++|++++.++.|+++++..
T Consensus        69 ~~~a~~l~~L~~~l~pg~~VLeIG~GtGy~ta~la~l~g~~g~~~~~~V~~iE~~~~l~~~A~~~l~~~  137 (227)
T 1r18_A           69 HMHAFALEYLRDHLKPGARILDVGSGSGYLTACFYRYIKAKGVDADTRIVGIEHQAELVRRSKANLNTD  137 (227)
T ss_dssp             HHHHHHHHHTTTTCCTTCEEEEESCTTSHHHHHHHHHHHHSCCCTTCEEEEEESCHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHHHCCCCCCCEEEEEECCHHHHHHHHHHHHHC
T ss_conf             999999997675389998899957997799999999853315777668999947899999999999760


No 195
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, PSI, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13
Probab=93.94  E-value=0.07  Score=30.27  Aligned_cols=66  Identities=26%  Similarity=0.316  Sum_probs=46.9

Q ss_pred             CEECCCHHHHHHHCCCCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCE
Q ss_conf             08517259989728414711898477876155871333678513001344357789899999889999999986396872
Q gi|254780466|r   22 KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGT  101 (375)
Q Consensus        22 kI~~GDcl~~l~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvLK~~Gs  101 (375)
                      .+.++|+.+  ..+|++++|.||.|=|-                     -|              +.+.++.|+||++|.
T Consensus       156 ~~~~~d~~~--~~~~~~~fD~VflDlp~---------------------P~--------------~~l~~~~~~LkpGG~  198 (280)
T 1i9g_A          156 RLVVSDLAD--SELPDGSVDRAVLDMLA---------------------PW--------------EVLDAVSRLLVAGGV  198 (280)
T ss_dssp             EEECSCGGG--CCCCTTCEEEEEEESSC---------------------GG--------------GGHHHHHHHEEEEEE
T ss_pred             EEEECCCCC--CCCCCCCCCEEEECCCC---------------------HH--------------HHHHHHHHHCCCCCE
T ss_conf             999555122--55667887868972788---------------------89--------------999999984477989


Q ss_pred             EEEECC-HHHHHHHHHHHHH-CCCC
Q ss_conf             999834-6888999987640-5786
Q gi|254780466|r  102 LWVIGS-YHNIFRIGTMLQN-LNFW  124 (375)
Q Consensus       102 i~v~~~-~~~i~~i~~~l~~-~gf~  124 (375)
                      +.++.- ...+.++..+|++ .+|.
T Consensus       199 lv~~~P~i~Qv~~~~~al~~~~~f~  223 (280)
T 1i9g_A          199 LMVYVATVTQLSRIVEALRAKQCWT  223 (280)
T ss_dssp             EEEEESSHHHHHHHHHHHHHHSSBC
T ss_pred             EEEECCCHHHHHHHHHHHHHHCCCC
T ss_conf             9999398999999999999738987


No 196
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A*
Probab=93.94  E-value=0.025  Score=33.01  Aligned_cols=61  Identities=13%  Similarity=0.025  Sum_probs=48.4

Q ss_pred             CHHHHHHHHHHCCCCCCEEEECCCCCHHHH-HHHHHHCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             189999999852899888998688851799-9999809816999728999999999996305
Q gi|254780466|r  209 PEALLSRILVSSTKPGDIILDPFFGSGTSG-AVAKKLRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       209 P~~LleriI~~~S~~gDiVLDPF~GSGTT~-~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      ....+.+++.....+|+.|||-=||+|.-+ ..|.+.+.+-+|+|+++.-++.|+++++...
T Consensus        42 ~~~~l~~~~~~~~~~g~~vLDlGCG~G~~~~~l~~~~~~~V~giD~S~~~i~~a~~~~~~~~  103 (265)
T 2i62_A           42 LLKNLFKIFCLGAVKGELLIDIGSGPTIYQLLSACESFTEIIVSDYTDQNLWELQKWLKKEP  103 (265)
T ss_dssp             HHHHHHHHHHSSSCCEEEEEEESCTTCCGGGTTGGGTEEEEEEEESCHHHHHHHHHHHTTCT
T ss_pred             HHHHHHHHCCCCCCCCCEEEEECCCCCHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHCC
T ss_conf             99999997278888898899967877676999997219989995699999999999987547


No 197
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus}
Probab=93.86  E-value=0.018  Score=33.77  Aligned_cols=39  Identities=23%  Similarity=0.427  Sum_probs=25.1

Q ss_pred             HHHHHHHHHCCCCCEEEEECCHH--------------HHHHHHHHHHHCCCCEE
Q ss_conf             99999998639687299983468--------------88999987640578601
Q gi|254780466|r   87 AWLLACRRVLKPNGTLWVIGSYH--------------NIFRIGTMLQNLNFWIL  126 (375)
Q Consensus        87 ~wl~e~~RvLK~~Gsi~v~~~~~--------------~i~~i~~~l~~~gf~~~  126 (375)
                      ..|.+++|+||++|.+.+. +|.              ....+..++++.||.+.
T Consensus       124 ~~l~ei~rvLkpgG~l~i~-d~~~~~~~~~~~~~~~~~~~~~~~~l~~aGf~~~  176 (219)
T 3dh0_A          124 KFLEELKRVAKPFAYLAII-DWKKEERDKGPPPEEVYSEWEVGLILEDAGIRVG  176 (219)
T ss_dssp             HHHHHHHHHEEEEEEEEEE-EECSSCCSSSCCGGGSCCHHHHHHHHHHTTCEEE
T ss_pred             HHHHHHHHHCCCCEEEEEE-ECCCCCCCCCCCHHHCCCHHHHHHHHHHCCCEEE
T ss_conf             9999999986838189999-8886546669875765899999999998699698


No 198
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken structural genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17
Probab=93.73  E-value=0.043  Score=31.56  Aligned_cols=93  Identities=15%  Similarity=0.239  Sum_probs=54.5

Q ss_pred             HCCCEECCCHHHHHHHCCCCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             32708517259989728414711898477876155871333678513001344357789899999889999999986396
Q gi|254780466|r   19 WKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKP   98 (375)
Q Consensus        19 ~~nkI~~GDcl~~l~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvLK~   98 (375)
                      =+-+|+.+|+.+.|+.. ++..|+|+.|++--.....                       ....-|+.+++..|++.|++
T Consensus       132 prv~v~~~Da~~~l~~~-~~~yDvIi~D~~dp~~~~~-----------------------~~~~L~t~eF~~~~~~~L~~  187 (314)
T 1uir_A          132 PRAVLVIDDARAYLERT-EERYDVVIIDLTDPVGEDN-----------------------PARLLYTVEFYRLVKAHLNP  187 (314)
T ss_dssp             TTEEEEESCHHHHHHHC-CCCEEEEEEECCCCBSTTC-----------------------GGGGGSSHHHHHHHHHTEEE
T ss_pred             CEEEEEECHHHHHHHHC-CCCCCEEEECCCCCCCCCC-----------------------HHHHHCCHHHHHHHHHHCCC
T ss_conf             70699972599999748-7767889987887545775-----------------------14444459999999974689


Q ss_pred             CCEEEEECC--H---HHH-HHHHHHHHHCCCCEEEEEEEECCCCCCCC
Q ss_conf             872999834--6---888-99998764057860124687315677775
Q gi|254780466|r   99 NGTLWVIGS--Y---HNI-FRIGTMLQNLNFWILNDIVWRKSNPMPNF  140 (375)
Q Consensus        99 ~Gsi~v~~~--~---~~i-~~i~~~l~~~gf~~~n~IIW~K~n~~pn~  140 (375)
                      +|.+.+...  +   ... -.+...+++. |.  ..-.|  ...+|.+
T Consensus       188 ~Gvlv~q~~~~~~~~~~~~~~i~~tl~~~-F~--~v~~~--~~~iPs~  230 (314)
T 1uir_A          188 GGVMGMQTGMILLTHHRVHPVVHRTVREA-FR--YVRSY--KNHIPGF  230 (314)
T ss_dssp             EEEEEEEEEEECC---CHHHHHHHHHHTT-CS--EEEEE--EEEEGGG
T ss_pred             CEEEEEECCCCCCCHHHHHHHHHHHHHHH-CC--CEEEE--EEEECCC
T ss_conf             84999955886325799999999999976-89--64898--8550776


No 199
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural genomics consortium, SGC; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13
Probab=93.73  E-value=0.034  Score=32.19  Aligned_cols=69  Identities=13%  Similarity=0.061  Sum_probs=39.2

Q ss_pred             EECCCHHHHHHHCCCCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCEE
Q ss_conf             85172599897284147118984778761558713336785130013443577898999998899999999863968729
Q gi|254780466|r   23 IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTL  102 (375)
Q Consensus        23 I~~GDcl~~l~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvLK~~Gsi  102 (375)
                      +.++|..+....+++.++|.||.|-|-                     -|              +.+.+++|+|||+|.+
T Consensus       171 ~~~~di~~~~~~~~~~~~D~VfLDlp~---------------------P~--------------~~l~~~~r~LKPGG~l  215 (336)
T 2b25_A          171 FIHKDISGATEDIKSLTFDAVALDMLN---------------------PH--------------VTLPVFYPHLKHGGVC  215 (336)
T ss_dssp             EEESCTTCCC-------EEEEEECSSS---------------------TT--------------TTHHHHGGGEEEEEEE
T ss_pred             EEECCHHHCCCCCCCCCCCEEECCCCC---------------------HH--------------HHHHHHHHHCCCCCEE
T ss_conf             997766652355688753331046769---------------------89--------------9999999846679799


Q ss_pred             EEECC-HHHHHHHHHHHHHCCCCEE
Q ss_conf             99834-6888999987640578601
Q gi|254780466|r  103 WVIGS-YHNIFRIGTMLQNLNFWIL  126 (375)
Q Consensus       103 ~v~~~-~~~i~~i~~~l~~~gf~~~  126 (375)
                      .++.- ...+.++..+|+..++.+.
T Consensus       216 vvy~P~i~Qv~~~~~~L~~~~~~f~  240 (336)
T 2b25_A          216 AVYVVNITQVIELLDGIRTCELALS  240 (336)
T ss_dssp             EEEESSHHHHHHHHHHHHHHTCCEE
T ss_pred             EEECCCHHHHHHHHHHHHHCCCCCE
T ss_conf             9993989999999999997289943


No 200
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A
Probab=93.72  E-value=0.33  Score=26.14  Aligned_cols=73  Identities=25%  Similarity=0.379  Sum_probs=51.6

Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHCCCCCC-EEEECCCCCHHHHHHHHHHC----CEEEEEEECHHHHHHHHHHHHHCCC
Q ss_conf             7875336877818999999985289988-89986888517999999809----8169997289999999999963056
Q gi|254780466|r  198 KDGEKLHPTQKPEALLSRILVSSTKPGD-IILDPFFGSGTSGAVAKKLR----RSFIGIEMKQDYIDIATKRIASVQP  270 (375)
Q Consensus       198 ~~g~k~HPTqKP~~LleriI~~~S~~gD-iVLDPF~GSGTT~~aA~~lg----R~~IGiE~~~~Y~~~a~~Rl~~~~~  270 (375)
                      ..|.-.+|..--.++++|+....-..+- .+-||.||||--+-+---|-    ++-++-|+|++.+++|.+.|.-+.+
T Consensus        25 ApGfP~FPVRLAsEifqRal~~~~~~~p~tlwDPCCGsgYlLTvlgLLh~~~l~~v~aSDVd~~al~LA~~NL~LLt~  102 (250)
T 1o9g_A           25 APGYPAFPVRLATEIFQRALARLPGDGPVTLWDPCCGSGYLLTVLGLLHRRSLRQVIASDVDPAPLELAAKNLALLSP  102 (250)
T ss_dssp             BTTBCCCCHHHHHHHHHHHHHTSSCCSCEEEEETTCTTSHHHHHHHHHTGGGEEEEEEEESCHHHHHHHHHHHHTTSH
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHHCHHHHHHHHHCCCCHHHHHHHHHHHHHCCH
T ss_conf             899988518999999999998636888730430577720899999884305777777335887899998852211131


No 201
>2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A
Probab=93.63  E-value=0.03  Score=32.51  Aligned_cols=28  Identities=18%  Similarity=0.541  Sum_probs=20.4

Q ss_pred             CEECCCHHHHHHHCCCCCCCEEEECCCCC
Q ss_conf             08517259989728414711898477876
Q gi|254780466|r   22 KIIKGNSISVLEKLPAKSVDLIFADPPYN   50 (375)
Q Consensus        22 kI~~GDcl~~l~~Lpd~sVDlI~tDPPYn   50 (375)
                      ++++||+++.|+.+. .++|+||.||+|.
T Consensus       148 ~l~~~Ds~~~L~~~~-~~~DvIYlDPMFp  175 (258)
T 2oyr_A          148 QLIHASSLTALTDIT-PRPQVVYLDPMFP  175 (258)
T ss_dssp             EEEESCHHHHSTTCS-SCCSEEEECCCCC
T ss_pred             EEECCCHHHHHHHCC-CCCCEEEECCCCC
T ss_conf             787387999986267-6688799899998


No 202
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A*
Probab=93.47  E-value=0.065  Score=30.47  Aligned_cols=48  Identities=13%  Similarity=-0.022  Sum_probs=40.6

Q ss_pred             CCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHC
Q ss_conf             899888998688851799999980981699972899999999999630
Q gi|254780466|r  221 TKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASV  268 (375)
Q Consensus       221 S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~  268 (375)
                      ..++.-|||-=||+|..+....+.|.+.+|+|+++..++.|++|....
T Consensus        49 ~~~~~~vLDvGcG~G~~~~~la~~~~~v~gvD~s~~~l~~a~~~~~~~   96 (216)
T 3ofk_A           49 SGAVSNGLEIGCAAGAFTEKLAPHCKRLTVIDVMPRAIGRACQRTKRW   96 (216)
T ss_dssp             TSSEEEEEEECCTTSHHHHHHGGGEEEEEEEESCHHHHHHHHHHTTTC
T ss_pred             CCCCCEEEEEECCCCHHHHHHHHHCCEEEEEECCHHHHHHHHHHHCCC
T ss_conf             989990999638898999999970998999969989999999861546


No 203
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A*
Probab=93.46  E-value=0.23  Score=27.15  Aligned_cols=47  Identities=17%  Similarity=0.097  Sum_probs=39.6

Q ss_pred             CCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             998889986888517999999809816999728999999999996305
Q gi|254780466|r  222 KPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       222 ~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      .++.-|||-=||+|..+.... -+.+.+|+|+++..++.|++++....
T Consensus       104 ~~~~~VLDlGCG~G~l~~~~~-~~~~v~gvD~s~~~l~~ar~~~~~~~  150 (253)
T 3frh_A          104 ETPRRVLDIACGLNPLALYER-GIASVWGCDIHQGLGDVITPFAREKD  150 (253)
T ss_dssp             CCCSEEEEETCTTTHHHHHHT-TCSEEEEEESBHHHHHHHHHHHHHTT
T ss_pred             CCCCEEEEECCCCCHHHHHHC-CCCEEEEEECCHHHHHHHHHHHHHCC
T ss_conf             999859996788889999976-89838999797999999999999829


No 204
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E
Probab=93.44  E-value=0.17  Score=27.97  Aligned_cols=82  Identities=16%  Similarity=0.303  Sum_probs=50.2

Q ss_pred             HHCC-CEECCCHHHHHHH-CCCCCCCEEEECCCC-CCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             5327-0851725998972-841471189847787-615587133367851300134435778989999988999999998
Q gi|254780466|r   18 EWKD-KIIKGNSISVLEK-LPAKSVDLIFADPPY-NLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRR   94 (375)
Q Consensus        18 ~~~n-kI~~GDcl~~l~~-Lpd~sVDlI~tDPPY-ni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~R   94 (375)
                      ...| ++++||+.+.|.. ++++|+|.|++-=|= |-+.+..   ..  +          .-        ..+.+.++.+
T Consensus       105 ~l~Ni~~~~~da~~~l~~~~~~~s~d~v~i~FPDPw~K~rh~---kr--R----------li--------~~~fl~~~~~  161 (246)
T 2vdv_E          105 GFQNINVLRGNAMKFLPNFFEKGQLSKMFFCFPDPHFKQRKH---KA--R----------II--------TNTLLSEYAY  161 (246)
T ss_dssp             TTTTEEEEECCTTSCGGGTSCTTCEEEEEEESCCCC---------CS--S----------CC--------CHHHHHHHHH
T ss_pred             CCCEEEEEECCHHHHHHHHCCCCCCCEEEEECCCCCCCCCCH---HH--H----------HC--------CHHHHHHHHH
T ss_conf             987199993734888887514677673489889887731101---13--4----------32--------4778999999


Q ss_pred             HCCCCCEEEEECCHHHHHH-HHHHHHHCC
Q ss_conf             6396872999834688899-998764057
Q gi|254780466|r   95 VLKPNGTLWVIGSYHNIFR-IGTMLQNLN  122 (375)
Q Consensus        95 vLK~~Gsi~v~~~~~~i~~-i~~~l~~~g  122 (375)
                      +|+++|.+++.+|....+. +...+.+.+
T Consensus       162 ~LkpgG~l~~~TD~~~y~~~~~~~~~~~~  190 (246)
T 2vdv_E          162 VLKEGGVVYTITDVKDLHEWMVKHLEEHP  190 (246)
T ss_dssp             HEEEEEEEEEEESCHHHHHHHHHHHHHST
T ss_pred             HHCCCCEEEEEECCHHHHHHHHHHHHHCC
T ss_conf             70669899999799999999999998683


No 205
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A*
Probab=93.32  E-value=0.05  Score=31.16  Aligned_cols=61  Identities=21%  Similarity=0.317  Sum_probs=35.3

Q ss_pred             CCCEECCCHHHHHHHCCCCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             27085172599897284147118984778761558713336785130013443577898999998899999999863968
Q gi|254780466|r   20 KDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPN   99 (375)
Q Consensus        20 ~nkI~~GDcl~~l~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvLK~~   99 (375)
                      +-+|+.+|+.+.++.- +++.|+|+.|++.....                         ....-|+.+++..|+|.|+++
T Consensus       145 rv~ii~~Da~~~l~~~-~~~yDvIi~D~~dp~~~-------------------------~~~~L~t~eFy~~~~~~L~~~  198 (296)
T 1inl_A          145 RAEIVIANGAEYVRKF-KNEFDVIIIDSTDPTAG-------------------------QGGHLFTEEFYQACYDALKED  198 (296)
T ss_dssp             TEEEEESCHHHHGGGC-SSCEEEEEEEC-----------------------------------CCSHHHHHHHHHHEEEE
T ss_pred             CCEEEEHHHHHHHHHC-CCCCCEEEEECCCCCCC-------------------------CCCCCCCHHHHHHHHHHHCCC
T ss_conf             6089961489999747-88776899908986544-------------------------201116799999999860899


Q ss_pred             CEEEEEC
Q ss_conf             7299983
Q gi|254780466|r  100 GTLWVIG  106 (375)
Q Consensus       100 Gsi~v~~  106 (375)
                      |.+.+.+
T Consensus       199 Gi~v~q~  205 (296)
T 1inl_A          199 GVFSAET  205 (296)
T ss_dssp             EEEEEEC
T ss_pred             CEEEECC
T ss_conf             6999867


No 206
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C*
Probab=93.15  E-value=0.14  Score=28.36  Aligned_cols=17  Identities=29%  Similarity=0.575  Sum_probs=6.6

Q ss_pred             CCHHHHHHHHHHCCCCCC
Q ss_conf             818999999985289988
Q gi|254780466|r  208 KPEALLSRILVSSTKPGD  225 (375)
Q Consensus       208 KP~~LleriI~~~S~~gD  225 (375)
                      -|.+.++.+-... +||.
T Consensus       172 ~p~~~l~~~~~~L-kpGG  188 (255)
T 3mb5_A          172 QPERVVEHAAKAL-KPGG  188 (255)
T ss_dssp             CGGGGHHHHHHHE-EEEE
T ss_pred             CHHHHHHHHHHHC-CCCC
T ss_conf             5678999999856-8998


No 207
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus HB27}
Probab=93.12  E-value=0.12  Score=28.83  Aligned_cols=36  Identities=17%  Similarity=0.153  Sum_probs=19.0

Q ss_pred             HHHHHHHCCCCCEEEEEC-CHHHHHHHHHHHHHCCCC
Q ss_conf             999998639687299983-468889999876405786
Q gi|254780466|r   89 LLACRRVLKPNGTLWVIG-SYHNIFRIGTMLQNLNFW  124 (375)
Q Consensus        89 l~e~~RvLK~~Gsi~v~~-~~~~i~~i~~~l~~~gf~  124 (375)
                      +.+++|+|||+|.+.++. ...++.++...+.+.||.
T Consensus       181 l~~~~~~LKpGG~lv~~~p~~~Q~~~~~~~l~~~gf~  217 (258)
T 2pwy_A          181 LEKAALALKPDRFLVAYLPNITQVLELVRAAEAHPFR  217 (258)
T ss_dssp             HHHHHHHEEEEEEEEEEESCHHHHHHHHHHHTTTTEE
T ss_pred             HHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHHCCCE
T ss_conf             9999986678959999939889999999999988983


No 208
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase- like protein, methyltransferase domain; 1.85A {Lactobacillus casei atcc 334}
Probab=93.08  E-value=0.1  Score=29.29  Aligned_cols=58  Identities=21%  Similarity=0.288  Sum_probs=41.5

Q ss_pred             CHHHHHHHHHHCCCCCCEEEECCCCCHHHH-HHHHHHCC--EEEEEEECHH------HHHHHHHHHHHCC
Q ss_conf             189999999852899888998688851799-99998098--1699972899------9999999996305
Q gi|254780466|r  209 PEALLSRILVSSTKPGDIILDPFFGSGTSG-AVAKKLRR--SFIGIEMKQD------YIDIATKRIASVQ  269 (375)
Q Consensus       209 P~~LleriI~~~S~~gDiVLDPF~GSGTT~-~aA~~lgR--~~IGiE~~~~------Y~~~a~~Rl~~~~  269 (375)
                      +.+|++.+   -=.||+.|||-=||+|... ..|..+|+  +.+|+|+++.      .++.|++|+.+..
T Consensus        32 ~~~ll~~~---~i~pG~rVLDiGCG~G~~t~~la~~~g~~~~V~gvD~s~~~~~~~~~l~~A~~~~~~~~   98 (275)
T 3bkx_A           32 RLAIAEAW---QVKPGEKILEIGCGQGDLSAVLADQVGSSGHVTGIDIASPDYGAPLTLGQAWNHLLAGP   98 (275)
T ss_dssp             HHHHHHHH---TCCTTCEEEEESCTTSHHHHHHHHHHCTTCEEEEECSSCTTCCSSSCHHHHHHHHHTST
T ss_pred             HHHHHHHC---CCCCCCEEEEECCCCCHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHHHHHHCC
T ss_conf             99999867---97986989996653885789999983877752347677777666689999999988557


No 209
>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45
Probab=93.07  E-value=0.13  Score=28.67  Aligned_cols=70  Identities=16%  Similarity=0.240  Sum_probs=38.4

Q ss_pred             CCCEECCCHHHHHHHCCCCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             27085172599897284147118984778761558713336785130013443577898999998899999999863968
Q gi|254780466|r   20 KDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPN   99 (375)
Q Consensus        20 ~nkI~~GDcl~~l~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvLK~~   99 (375)
                      .+.+..++.+.. ...+...+|+|++.|||+........+.          .+ ...+..++     .|+..+.+.||++
T Consensus       243 ~~~~~~~~~l~~-d~~~~~~fD~Vl~NPPfg~~~~~~~~~~----------~~-~~~~~~~~-----~Fi~~~l~~Lk~~  305 (541)
T 2ar0_A          243 GGAIRLGNTLGS-DGENLPKAHIVATNPPFGSAAGTNITRT----------FV-HPTSNKQL-----CFMQHIIETLHPG  305 (541)
T ss_dssp             TBSEEESCTTSH-HHHTSCCEEEEEECCCCTTCSSCCCCSC----------CS-SCCSCHHH-----HHHHHHHHHEEEE
T ss_pred             CCCHHCCCCHHH-CCCCCCCCCEEEECCCCCCCCCCCCCCC----------CC-CCCCCHHH-----HHHHHHHHHCCCC
T ss_conf             750210450433-0444434666873699766444343000----------25-76552779-----9999999973789


Q ss_pred             CEEEEEC
Q ss_conf             7299983
Q gi|254780466|r  100 GTLWVIG  106 (375)
Q Consensus       100 Gsi~v~~  106 (375)
                      |.+.++.
T Consensus       306 Gr~aiIl  312 (541)
T 2ar0_A          306 GRAAVVV  312 (541)
T ss_dssp             EEEEEEE
T ss_pred             CEEEEEE
T ss_conf             7699995


No 210
>2i7c_A Spermidine synthase; transferase, structural genomics consortium, SGC; HET: AAT 1PG; 1.71A {Plasmodium falciparum 3D7} PDB: 2hte_A* 3b7p_A* 2pwp_A*
Probab=92.99  E-value=0.13  Score=28.70  Aligned_cols=106  Identities=17%  Similarity=0.187  Sum_probs=59.6

Q ss_pred             HHHCCCEECCCHHHHHHHCCCCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             55327085172599897284147118984778761558713336785130013443577898999998899999999863
Q gi|254780466|r   17 FEWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVL   96 (375)
Q Consensus        17 ~~~~nkI~~GDcl~~l~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvL   96 (375)
                      .+=+-+++.+|..+.|+.- +++.|+|+.|++=..          ..                ...-|+.+++..|++.|
T Consensus       130 ~d~rv~v~~~Da~~~l~~~-~~~yDvIi~D~~dp~----------~~----------------~~~L~t~eF~~~~~~~L  182 (283)
T 2i7c_A          130 EDKRVNVFIEDASKFLENV-TNTYDVIIVDSSDPI----------GP----------------AETLFNQNFYEKIYNAL  182 (283)
T ss_dssp             GSTTEEEEESCHHHHHHHC-CSCEEEEEEECCCTT----------TG----------------GGGGSSHHHHHHHHHHE
T ss_pred             CCCCCCEEECHHHHHHHHC-CCCCCEEEEECCCCC----------CC----------------HHHHCCHHHHHHHHHHC
T ss_conf             4876528960689999746-887777999479988----------74----------------26554899999998761


Q ss_pred             CCCCEEEEECC-H----HHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHCCC
Q ss_conf             96872999834-6----888999987640578601246873156777757751765402132210056
Q gi|254780466|r   97 KPNGTLWVIGS-Y----HNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSP  159 (375)
Q Consensus        97 K~~Gsi~v~~~-~----~~i~~i~~~l~~~gf~~~n~IIW~K~n~~pn~~g~r~~~~hE~iiw~~K~~  159 (375)
                      +++|.+.+.+. .    ..+-.+...++++ |..    +-.....+|.+-+.-     =..++++|..
T Consensus       183 ~~~Gi~v~q~~s~~~~~~~~~~i~~~l~~~-F~~----v~~y~~~iPty~~G~-----w~f~~ask~~  240 (283)
T 2i7c_A          183 KPNGYCVAQCESLWIHVGTIKNMIGYAKKL-FKK----VEYANISIPTYPCGC-----IGILCCSKTD  240 (283)
T ss_dssp             EEEEEEEEECCCTTTCHHHHHHHHHHHHTT-CSE----EEEEEEECTTSGGGE-----EEEEEEESST
T ss_pred             CCCCEEEEECCCCCCCHHHHHHHHHHHHHH-CCC----EEEEEEEECCCCCCC-----EEEEEEECCC
T ss_conf             899689994788010799999999988765-895----478998964536781-----0046887898


No 211
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltransferase, structural genomics, PSI-2, protein structure initiative; HET: SAH; 1.95A {Agrobacterium tumefaciens str}
Probab=92.93  E-value=0.15  Score=28.23  Aligned_cols=57  Identities=19%  Similarity=0.256  Sum_probs=40.9

Q ss_pred             HHHHHHHHHHCCCCCCEEEECCCCCHHHHHH-HHHH-CCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             8999999985289988899868885179999-9980-9816999728999999999996305
Q gi|254780466|r  210 EALLSRILVSSTKPGDIILDPFFGSGTSGAV-AKKL-RRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       210 ~~LleriI~~~S~~gDiVLDPF~GSGTT~~a-A~~l-gR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      .+|+.+   .-..++.-|||-=||||+.... |.+. +++.+|+|+++..++.|++|+.++.
T Consensus        23 ~~ll~~---~~~~~~~rVLDiGCGtG~~t~~la~~~~~~~v~gvD~S~~ml~~A~~~~~~v~   81 (259)
T 2p35_A           23 RDLLAQ---VPLERVLNGYDLGCGPGNSTELLTDRYGVNVITGIDSDDDMLEKAADRLPNTN   81 (259)
T ss_dssp             HHHHTT---CCCSCCSSEEEETCTTTHHHHHHHHHHCTTSEEEEESCHHHHHHHHHHSTTSE
T ss_pred             HHHHHC---CCCCCCCEEEEECCCCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHCCCCC
T ss_conf             999952---88889898999816286999999987899879999898799999997256631


No 212
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural genomics, NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus VF5}
Probab=92.84  E-value=0.36  Score=25.93  Aligned_cols=62  Identities=13%  Similarity=0.247  Sum_probs=30.5

Q ss_pred             CEECCCHHHHHHHCCCCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCE
Q ss_conf             08517259989728414711898477876155871333678513001344357789899999889999999986396872
Q gi|254780466|r   22 KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGT  101 (375)
Q Consensus        22 kI~~GDcl~~l~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvLK~~Gs  101 (375)
                      .++++|..+.  .++++++|.||.|.|-                     .|              +.+.+++++||++|.
T Consensus       143 ~~~~~D~~~~--~~~~~~fD~V~ld~p~---------------------p~--------------~~l~~~~~~LKpGG~  185 (248)
T 2yvl_A          143 KFFNVDFKDA--EVPEGIFHAAFVDVRE---------------------PW--------------HYLEKVHKSLMEGAP  185 (248)
T ss_dssp             EEECSCTTTS--CCCTTCBSEEEECSSC---------------------GG--------------GGHHHHHHHBCTTCE
T ss_pred             EEEECCHHHC--CCCCCCCCEEEEECCC---------------------HH--------------HHHHHHHHHCCCCCE
T ss_conf             9999122214--3245878999991787---------------------68--------------889999984288978


Q ss_pred             EEEECC-HHHHHHHHHHHHH
Q ss_conf             999834-6888999987640
Q gi|254780466|r  102 LWVIGS-YHNIFRIGTMLQN  120 (375)
Q Consensus       102 i~v~~~-~~~i~~i~~~l~~  120 (375)
                      +.++.- ...+.++..++++
T Consensus       186 lv~~~P~i~Qv~~~~~~l~~  205 (248)
T 2yvl_A          186 VGFLLPTANQVIKLLESIEN  205 (248)
T ss_dssp             EEEEESSHHHHHHHHHHSTT
T ss_pred             EEEEECCHHHHHHHHHHHHH
T ss_conf             99992979999999999970


No 213
>2i6g_A Putative methyltransferase; 16420133, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MLY; 1.90A {Salmonella typhimurium LT2} SCOP: c.66.1.44
Probab=92.58  E-value=0.47  Score=25.26  Aligned_cols=56  Identities=14%  Similarity=0.117  Sum_probs=44.2

Q ss_pred             HHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             99999998528998889986888517999999809816999728999999999996305
Q gi|254780466|r  211 ALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       211 ~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      ++++.+  ..-.|| -|||.=||+|..+....+.|-+.+|+|+++..++.++++..+..
T Consensus        22 ~~~~~~--~~l~pg-rVLDiGcG~G~~~~~la~~g~~v~gvD~s~~~l~~a~~~~~~~~   77 (199)
T 2i6g_A           22 DVLAAA--XVVAPG-RTLDLGCGNGRNSLYLAANGYDVTAWDXNPASMANLERIXAAEG   77 (199)
T ss_dssp             HHHHHH--TTSCSC-EEEEETCTTSHHHHHHHHTTCEEEEEESCHHHHHHHHHHHHHTT
T ss_pred             HHHHHH--CCCCCC-CEEEECCCCCHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHCC
T ss_conf             999984--378989-68998588978999998549989999587189999998642137


No 214
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, alternative splicing; 2.55A {Rattus norvegicus}
Probab=92.57  E-value=0.28  Score=26.59  Aligned_cols=99  Identities=19%  Similarity=0.280  Sum_probs=58.7

Q ss_pred             CCCCCCEEEECCCCCHHHHHHHHHHC-CEEEEEEECHHHHHHHHHHHHHCCCCCHHHHCCCCCCCCC----CC---C---
Q ss_conf             28998889986888517999999809-8169997289999999999963056876563024443337----75---5---
Q gi|254780466|r  220 STKPGDIILDPFFGSGTSGAVAKKLR-RSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRTE----PR---V---  288 (375)
Q Consensus       220 ~S~~gDiVLDPF~GSGTT~~aA~~lg-R~~IGiE~~~~Y~~~a~~Rl~~~~~~~~~~~~~~~~~~~~----~r---v---  288 (375)
                      ...+|.+|||--+|||--...|.+.| ++-+++|.++ .++.|++.++.- .+.+ .++....+-..    .+   |   
T Consensus       155 ~~~~~kvVLDvGcGtGiLs~~AA~aGA~kV~avE~S~-~a~~A~~~v~~N-gl~d-~I~vi~g~~e~l~lpe~vDvIVSE  231 (480)
T 3b3j_A          155 TDFKDKIVLDVGCGSGILSFFAAQAGARKIYAVEAST-MAQHAEVLVKSN-NLTD-RIVVIPGKVEEVSLPEQVDIIISE  231 (480)
T ss_dssp             GGTTTCEEEEESCSTTHHHHHHHHTTCSEEEEEECHH-HHHHHHHHHHHT-TCTT-TEEEEESCTTTCCCSSCEEEEECC
T ss_pred             HHCCCCEEEEECCCCCHHHHHHHHCCCCEEEEECCHH-HHHHHHHHHHHC-CCCC-CEEEEECCHHHCCCCCCCCEEEEE
T ss_conf             5359898999688836999999985998899990959-999999999974-9986-168997527656767666789998


Q ss_pred             CHHHH-----------HHCCCCCCCCEEECCCCCEEEEECCCCC
Q ss_conf             23469-----------8828658776576689806999815981
Q gi|254780466|r  289 AFNLL-----------VERGLIQPGQILTNAQGNISATVCADGT  321 (375)
Q Consensus       289 pfg~l-----------ie~g~l~~g~~L~~~~~~~~a~v~~DG~  321 (375)
                      ++|+.           -.+.+|+||..++-......+..-.+..
T Consensus       232 ~mg~~Ll~E~~l~~v~~Arr~LkPgG~~iPs~a~l~~~~ie~~~  275 (480)
T 3b3j_A          232 PMGYMLFNERMLESYLHAKKYLKPSGNMFPTIGDVHLAPFTDEQ  275 (480)
T ss_dssp             CCHHHHTCHHHHHHHHHGGGGEEEEEEEESCEEEEEEEEECCHH
T ss_pred             CCCCCCCCCHHHHHHHHHHHHCCCCCEEEECCCEEEEEEECCHH
T ss_conf             32200245203567999997347883697154409999943588


No 215
>2pt6_A Spermidine synthase; transferase, structural genomics consortium, SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum 3D7} PDB: 2pss_A* 2pt9_A*
Probab=92.52  E-value=0.15  Score=28.24  Aligned_cols=43  Identities=14%  Similarity=-0.002  Sum_probs=25.1

Q ss_pred             CEEEECCCCCHHHHHHHHHH--CCEEEEEEECHHHHHHHHHHHHH
Q ss_conf             88998688851799999980--98169997289999999999963
Q gi|254780466|r  225 DIILDPFFGSGTSGAVAKKL--RRSFIGIEMKQDYIDIATKRIAS  267 (375)
Q Consensus       225 DiVLDPF~GSGTT~~aA~~l--gR~~IGiE~~~~Y~~~a~~Rl~~  267 (375)
                      .-||--=+|.|+++....+.  ..+-..+|+|++-+++|++-+..
T Consensus       118 k~VLIiGgGdG~~~rellk~~~~~~v~~VEID~~Vv~~ak~~f~~  162 (321)
T 2pt6_A          118 KNVLVVGGGDGGIIRELCKYKSVENIDICEIDETVIEVSKIYFKN  162 (321)
T ss_dssp             CEEEEEECTTCHHHHHHTTCTTCCEEEEEESCHHHHHHHHHHCTT
T ss_pred             CEEEEECCCCHHHHHHHHHCCCCCCEEEECCCHHHHHHHHHHHHH
T ss_conf             769998489539999999729964147852579999999986266


No 216
>2g1p_A DNA adenine methylase; DAM methylation, GATC recognition, base flipping, bacterial virulence factor, transferase/DNA complex; HET: DNA SAH; 1.89A {Escherichia coli} PDB: 2ore_D*
Probab=92.44  E-value=0.23  Score=27.13  Aligned_cols=28  Identities=14%  Similarity=0.352  Sum_probs=18.6

Q ss_pred             CEECCCHHHHHHHCCCCCCCEEEECCCCCC
Q ss_conf             085172599897284147118984778761
Q gi|254780466|r   22 KIIKGNSISVLEKLPAKSVDLIFADPPYNL   51 (375)
Q Consensus        22 kI~~GDcl~~l~~Lpd~sVDlI~tDPPYni   51 (375)
                      .+.++|..+.+....+  =|+||.||||-.
T Consensus       159 ~~~~~d~~~~~~~~~~--~~fiYlDPPY~~  186 (278)
T 2g1p_A          159 FFYCESYADSMARADD--SSVVYCDPPYAP  186 (278)
T ss_dssp             EEEECCHHHHHTTCCT--TEEEEECCSCCC
T ss_pred             HHHCCHHHHHHHHCCC--CEEEEECCCCCC
T ss_conf             6411107666553156--708997899855


No 217
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens}
Probab=92.28  E-value=0.12  Score=28.74  Aligned_cols=27  Identities=22%  Similarity=0.176  Sum_probs=19.4

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             999988999999998639687299983
Q gi|254780466|r   80 AYDAFTRAWLLACRRVLKPNGTLWVIG  106 (375)
Q Consensus        80 ~Y~~f~~~wl~e~~RvLK~~Gsi~v~~  106 (375)
                      +..+-....|.|++|+|||+|.+.++.
T Consensus       133 ~~~~~~~~~l~e~~r~LkpgG~~i~~~  159 (215)
T 2pxx_A          133 EGVHTVDQVLSEVSRVLVPGGRFISMT  159 (215)
T ss_dssp             HHHHHHHHHHHHHHHHEEEEEEEEEEE
T ss_pred             CCHHHHHHHHHHHHHHCCCCCEEEEEE
T ss_conf             124319999999998773587899995


No 218
>3hvi_A Catechol O-methyltransferase; neurotransmitter degradation, alternative initiation, catecholamine metabolism, cell membrane, cytoplasm; HET: 619; 1.20A {Rattus norvegicus} PDB: 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 2zlb_A 2zth_A* 2zvj_A* 3a7d_A* 3bwm_A* 3bwy_A* 3a7e_A*
Probab=92.12  E-value=0.11  Score=29.07  Aligned_cols=58  Identities=17%  Similarity=0.288  Sum_probs=40.2

Q ss_pred             HHHHHHHHHHCCCCCCEEEECCCCCHHHH-HHHHHH--CCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             89999999852899888998688851799-999980--9816999728999999999996305
Q gi|254780466|r  210 EALLSRILVSSTKPGDIILDPFFGSGTSG-AVAKKL--RRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       210 ~~LleriI~~~S~~gDiVLDPF~GSGTT~-~aA~~l--gR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      -++|..++...-.+  .||+-=+|.|-++ ..|..+  +=+.+++|+++++++.|++.++...
T Consensus        47 g~~L~~lv~~~kpk--~iLEiGt~~G~Stl~la~al~~~g~v~~id~~~~~~~~ar~~~~~ag  107 (221)
T 3hvi_A           47 GQIMDAVIREYSPS--LVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAG  107 (221)
T ss_dssp             HHHHHHHHHHHCCS--EEEEECCTTSHHHHHHHTTCCTTCEEEEECCCHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHCCCC--EEEEEECCCHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHHCC
T ss_conf             99999999861999--99997147429999999857999789999888412589999999759


No 219
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei}
Probab=92.09  E-value=0.6  Score=24.61  Aligned_cols=58  Identities=21%  Similarity=0.304  Sum_probs=42.1

Q ss_pred             HHHHHHHHHHCC--CCCCEEEECCCCCHHHHHH-HHHH-CCEEEEEEECHHHHHHHHHHHHH
Q ss_conf             899999998528--9988899868885179999-9980-98169997289999999999963
Q gi|254780466|r  210 EALLSRILVSST--KPGDIILDPFFGSGTSGAV-AKKL-RRSFIGIEMKQDYIDIATKRIAS  267 (375)
Q Consensus       210 ~~LleriI~~~S--~~gDiVLDPF~GSGTT~~a-A~~l-gR~~IGiE~~~~Y~~~a~~Rl~~  267 (375)
                      .++...++....  .++.-|||-=||+|..+.. +++. +-+.+|+|++++.++.|++++..
T Consensus        29 ~~~~~~~~~~~~~~~~~~~VLDiGcG~G~~~~~l~~~~~~~~v~giD~s~~~l~~A~~~~~~   90 (234)
T 3dtn_A           29 DDFYGVSVSIASVDTENPDILDLGAGTGLLSAFLMEKYPEATFTLVDMSEKMLEIAKNRFRG   90 (234)
T ss_dssp             HHHHHHHHHTCCCSCSSCEEEEETCTTSHHHHHHHHHCTTCEEEEEESCHHHHHHHHHHTCS
T ss_pred             HHHHHHHHHHHHCCCCCCEEEEECCCCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHC
T ss_conf             99999999984356999959998176859999999988996899995850457899986302


No 220
>3b3f_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase, catalytic domain, alternative splicing, chromatin regulator; HET: SAH; 2.20A {Rattus norvegicus} PDB: 3b3g_A 2v74_B* 2v7e_A
Probab=91.88  E-value=0.38  Score=25.78  Aligned_cols=17  Identities=29%  Similarity=0.665  Sum_probs=11.5

Q ss_pred             HHHHHHHHHCCCCCEEE
Q ss_conf             99999998639687299
Q gi|254780466|r   87 AWLLACRRVLKPNGTLW  103 (375)
Q Consensus        87 ~wl~e~~RvLK~~Gsi~  103 (375)
                      +.+..++|+|||+|.++
T Consensus       132 ~~l~~ar~~LkpgG~~i  148 (341)
T 3b3f_A          132 ESYLHAKKYLKPSGNMF  148 (341)
T ss_dssp             HHHHHGGGGEEEEEEEE
T ss_pred             HHHHHHHHHCCCCCEEE
T ss_conf             67999997357885796


No 221
>1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23
Probab=91.76  E-value=0.48  Score=25.19  Aligned_cols=21  Identities=14%  Similarity=0.430  Sum_probs=8.6

Q ss_pred             CCHHHHHHHCCCCCCCEEEECCCCC
Q ss_conf             7259989728414711898477876
Q gi|254780466|r   26 GNSISVLEKLPAKSVDLIFADPPYN   50 (375)
Q Consensus        26 GDcl~~l~~Lpd~sVDlI~tDPPYn   50 (375)
                      ..+++.|..-|++    +|.|=-++
T Consensus        12 ~Evl~~L~~~~~g----~~iD~T~G   32 (285)
T 1wg8_A           12 QEALDLLAVRPGG----VYVDATLG   32 (285)
T ss_dssp             HHHHHHHTCCTTC----EEEETTCT
T ss_pred             HHHHHHCCCCCCC----EEEEECCC
T ss_conf             9999727858999----99994889


No 222
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5- methylpyrimidin-2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A*
Probab=91.72  E-value=0.29  Score=26.52  Aligned_cols=19  Identities=16%  Similarity=0.267  Sum_probs=6.1

Q ss_pred             CHHHHHHHHHHCCCCCCEE
Q ss_conf             1899999998528998889
Q gi|254780466|r  209 PEALLSRILVSSTKPGDII  227 (375)
Q Consensus       209 P~~LleriI~~~S~~gDiV  227 (375)
                      .......+.......+|+.
T Consensus       246 ~~~~~~~~~~~~~~l~~~~  264 (421)
T 2ih2_A          246 ETEETRKLEISGMPLGDLF  264 (421)
T ss_dssp             CCHHHHHHHHTSEEHHHHE
T ss_pred             CHHHHHHHHHCCCCCCCCC
T ss_conf             7056778863697654221


No 223
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42
Probab=91.58  E-value=0.28  Score=26.57  Aligned_cols=57  Identities=19%  Similarity=0.174  Sum_probs=43.6

Q ss_pred             HHHHHHHHC--CCCCCEEEECCCCCHHHHHH-HHHHCCEEEEEEECHHHHHHHHHHHHHC
Q ss_conf             999999852--89988899868885179999-9980981699972899999999999630
Q gi|254780466|r  212 LLSRILVSS--TKPGDIILDPFFGSGTSGAV-AKKLRRSFIGIEMKQDYIDIATKRIASV  268 (375)
Q Consensus       212 LleriI~~~--S~~gDiVLDPF~GSGTT~~a-A~~lgR~~IGiE~~~~Y~~~a~~Rl~~~  268 (375)
                      ++.+++...  ..++..|||-=||+|..... +.+.+.+.+|+|+++..++.|++|+...
T Consensus        66 fl~~~l~~~~~~~~~~~vLDiGcG~G~~~~~ll~~~~~~v~~vD~s~~~l~~ar~~~~~~  125 (241)
T 2ex4_A           66 FLQRFLREGPNKTGTSCALDCGAGIGRITKRLLLPLFREVDMVDITEDFLVQAKTYLGEE  125 (241)
T ss_dssp             HHHGGGC----CCCCSEEEEETCTTTHHHHHTTTTTCSEEEEEESCHHHHHHHHHHTGGG
T ss_pred             HHHHHHHHCCCCCCCCEEEEECCCCCHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHC
T ss_conf             999999865577788769990157078699999705998999999999999999877650


No 224
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.30A {Bacillus cereus atcc 14579} PDB: 2gh1_A
Probab=91.55  E-value=0.68  Score=24.24  Aligned_cols=21  Identities=14%  Similarity=0.177  Sum_probs=17.0

Q ss_pred             HHHHHHHHHHCCCCCEEEEEC
Q ss_conf             999999998639687299983
Q gi|254780466|r   86 RAWLLACRRVLKPNGTLWVIG  106 (375)
Q Consensus        86 ~~wl~e~~RvLK~~Gsi~v~~  106 (375)
                      ...+.+++|+|||+|.+.++-
T Consensus       106 ~~~l~~~~~~LkpgG~lii~e  126 (284)
T 3gu3_A          106 ETMLQKMIHSVKKGGKIICFE  126 (284)
T ss_dssp             HHHHHHHHHTEEEEEEEEEEE
T ss_pred             HHHHHHHHHHCCCCCEEEEEE
T ss_conf             999999999838895899997


No 225
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomics, JCSG, PSI, protein structure initiative; 1.65A {Thermotoga maritima} SCOP: c.66.1.13
Probab=91.53  E-value=0.24  Score=27.02  Aligned_cols=35  Identities=23%  Similarity=0.320  Sum_probs=14.0

Q ss_pred             HHHHHHHCCCCCEEEEECC-HHHHHHHHHHHHHCCC
Q ss_conf             9999986396872999834-6888999987640578
Q gi|254780466|r   89 LLACRRVLKPNGTLWVIGS-YHNIFRIGTMLQNLNF  123 (375)
Q Consensus        89 l~e~~RvLK~~Gsi~v~~~-~~~i~~i~~~l~~~gf  123 (375)
                      +.+++++|||+|.+.++.- ...+.++..+|.+.||
T Consensus       196 l~~~~~~LKpGG~lv~~~P~i~Qv~~~~~~L~~~gF  231 (277)
T 1o54_A          196 IDKCWEALKGGGRFATVCPTTNQVQETLKKLQELPF  231 (277)
T ss_dssp             HHHHHHHEEEEEEEEEEESSHHHHHHHHHHHHHSSE
T ss_pred             HHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHHCCC
T ss_conf             999997358998999995978999999999998798


No 226
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile}
Probab=91.46  E-value=0.33  Score=26.18  Aligned_cols=13  Identities=8%  Similarity=0.621  Sum_probs=7.3

Q ss_pred             CCCEEEEEEEECC
Q ss_conf             0671146797599
Q gi|254780466|r  344 CNGWNFWYFEKLG  356 (375)
Q Consensus       344 cNGw~fw~~~~~~  356 (375)
                      |.||+.|-+--+.
T Consensus       335 ~~gw~~~ilt~d~  347 (385)
T 3ldu_A          335 LKNWSYYLITSYE  347 (385)
T ss_dssp             SBSCEEEEEESCT
T ss_pred             CCCCEEEEEECCH
T ss_conf             9997699995887


No 227
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A*
Probab=91.44  E-value=0.34  Score=26.08  Aligned_cols=45  Identities=13%  Similarity=0.094  Sum_probs=39.5

Q ss_pred             CCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHH
Q ss_conf             289988899868885179999998098169997289999999999
Q gi|254780466|r  220 STKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKR  264 (375)
Q Consensus       220 ~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~R  264 (375)
                      ...+++-|||-=||+|.-+......|.+.+|+|++++.++.|+++
T Consensus        43 ~~~~~~~vLDvGcG~G~~~~~la~~g~~v~gvD~S~~~l~~a~~~   87 (218)
T 3ou2_A           43 AGNIRGDVLELASGTGYWTRHLSGLADRVTALDGSAEMIAEAGRH   87 (218)
T ss_dssp             TTTSCSEEEEESCTTSHHHHHHHHHSSEEEEEESCHHHHHHHGGG
T ss_pred             CCCCCCCEEEECCCCCHHHHHHHHCCCEEEEEECCCHHHHHHHHH
T ss_conf             668899799988988789999996199899997831789999973


No 228
>2g1p_A DNA adenine methylase; DAM methylation, GATC recognition, base flipping, bacterial virulence factor, transferase/DNA complex; HET: DNA SAH; 1.89A {Escherichia coli} PDB: 2ore_D*
Probab=91.43  E-value=0.28  Score=26.61  Aligned_cols=17  Identities=18%  Similarity=0.378  Sum_probs=10.1

Q ss_pred             HHHHHCCCCCCCEEEECCCC
Q ss_conf             98972841471189847787
Q gi|254780466|r   30 SVLEKLPAKSVDLIFADPPY   49 (375)
Q Consensus        30 ~~l~~Lpd~sVDlI~tDPPY   49 (375)
                      .++..||+..   .|.+|=-
T Consensus        20 ~I~~~~p~~~---~yvEpF~   36 (278)
T 2g1p_A           20 DIKRHLPKGE---CLVEPFV   36 (278)
T ss_dssp             HHHHHCCCCS---EEEETTC
T ss_pred             HHHHHCCCCC---EEEEECC
T ss_conf             9998689999---5997446


No 229
>3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei}
Probab=91.42  E-value=0.098  Score=29.36  Aligned_cols=81  Identities=17%  Similarity=0.186  Sum_probs=37.1

Q ss_pred             CCEECCCHHHHHHHCCCCCCCEEEECCCCCCCCCCCEECCCCCEE--EECC-CCCCCCCCHHHHHHHHHHHHHHHHHHCC
Q ss_conf             708517259989728414711898477876155871333678513--0013-4435778989999988999999998639
Q gi|254780466|r   21 DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLV--DAVT-DSWDKFSSFEAYDAFTRAWLLACRRVLK   97 (375)
Q Consensus        21 nkI~~GDcl~~l~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~--~~~~-d~wd~~~s~~~Y~~f~~~wl~e~~RvLK   97 (375)
                      ..+.++|++.. ...+..++|+|++.|||+.............+.  .... ...........+.    .|+..+.+.||
T Consensus       312 ~~~~~~d~l~~-~~~~~~~fD~Il~NPPfg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~Fi~~~l~~Lk  386 (544)
T 3khk_A          312 FGKKNADSFLD-DQHPDLRADFVMTNPPFNMKDWWHEKLADDPRWTINTNGEKRILTPPTGNANF----AWMLHMLYHLA  386 (544)
T ss_dssp             CCSSSCCTTTS-CSCTTCCEEEEEECCCSSCCSCCCGGGTTCGGGEECCC--CEECCCCTTCTHH----HHHHHHHHTEE
T ss_pred             CCCCCCCCCCC-CCCCCCCCCEEEECCCCCCCCCCCCCCCCCHHHHHCCCCCCCCCCCCCCCHHH----HHHHHHHHHCC
T ss_conf             45356754346-55655446757506987766555300013545540345643457899874789----99999997177


Q ss_pred             CCCEEEEEC
Q ss_conf             687299983
Q gi|254780466|r   98 PNGTLWVIG  106 (375)
Q Consensus        98 ~~Gsi~v~~  106 (375)
                      ++|.+.++.
T Consensus       387 ~~G~~aiIv  395 (544)
T 3khk_A          387 PTGSMALLL  395 (544)
T ss_dssp             EEEEEEEEE
T ss_pred             CCCEEEEEE
T ss_conf             778069997


No 230
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA processing, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens}
Probab=91.36  E-value=0.17  Score=27.99  Aligned_cols=50  Identities=16%  Similarity=0.132  Sum_probs=38.7

Q ss_pred             CCCCCCEEEECCCCCHHHHH--HHHHHCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             28998889986888517999--999809816999728999999999996305
Q gi|254780466|r  220 STKPGDIILDPFFGSGTSGA--VAKKLRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       220 ~S~~gDiVLDPF~GSGTT~~--aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      ..+.+-.|||-=||+|..++  |+..-+.+|||||+.+..+..+..+++..+
T Consensus        43 ~~~~~~~iLeIGcG~G~~l~~lA~~~P~~~~iGiei~~~~~~~~~~~~~~~~   94 (235)
T 3ckk_A           43 RAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALR   94 (235)
T ss_dssp             ---CCEEEEEETCTTCHHHHHHGGGSTTSEEEEEESCHHHHHHHHHHHHHHH
T ss_pred             CCCCCCEEEEEECCCCHHHHHHHHHCCCCCEEEEEECHHHHHHHHHHHHHHH
T ss_conf             4668987999822686999999986868728988613589999998999999


No 231
>2qrv_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens}
Probab=91.24  E-value=0.34  Score=26.11  Aligned_cols=33  Identities=24%  Similarity=0.371  Sum_probs=21.1

Q ss_pred             HHCC-CEECCCHHHHHHH-C-CCCCCCEEEECCCCC
Q ss_conf             5327-0851725998972-8-414711898477876
Q gi|254780466|r   18 EWKD-KIIKGNSISVLEK-L-PAKSVDLIFADPPYN   50 (375)
Q Consensus        18 ~~~n-kI~~GDcl~~l~~-L-pd~sVDlI~tDPPYn   50 (375)
                      ++-+ .+++||.-++... + ....+|+++.+||--
T Consensus        59 n~~~~~~~~~Di~~~~~~~~~~~~~~Dil~ggpPCQ   94 (295)
T 2qrv_A           59 RHQGKIMYVGDVRSVTQKHIQEWGPFDLVIGGSPCN   94 (295)
T ss_dssp             HTTTCEEEECCGGGCCHHHHHHTCCCSEEEECCCCG
T ss_pred             HCCCCCCCCCCEEEEEECCCCCCCCCEEEECCCCCC
T ss_conf             789997703660157402445677673997268887


No 232
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54
Probab=90.75  E-value=0.81  Score=23.79  Aligned_cols=60  Identities=12%  Similarity=-0.002  Sum_probs=43.3

Q ss_pred             HHHHHHHHHHCC---CCCCEEEECCCCCHHHH--HHHHHHCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             899999998528---99888998688851799--9999809816999728999999999996305
Q gi|254780466|r  210 EALLSRILVSST---KPGDIILDPFFGSGTSG--AVAKKLRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       210 ~~LleriI~~~S---~~gDiVLDPF~GSGTT~--~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      +.+++.++....   .+.-.|||-=+|||.-+  +++..-+-+++|+|++++.+++|++-++.-.
T Consensus        49 ~~~i~dlL~~~~~~~~~~~~~lDiGtGsg~I~~~L~~~~~~~~~~~~Di~~~al~~A~~N~~~n~  113 (254)
T 2h00_A           49 IHWVEDLIGHQDSDKSTLRRGIDIGTGASCIYPLLGATLNGWYFLATEVDDMCFNYAKKNVEQNN  113 (254)
T ss_dssp             HHHHHHHHCCCCGGGCCCCEEEEESCTTTTHHHHHHHHHHCCEEEEEESCHHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHCCCCCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHC
T ss_conf             99999997054666677754899567878999999997799759999899999999999999838


No 233
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum}
Probab=90.71  E-value=0.7  Score=24.19  Aligned_cols=58  Identities=24%  Similarity=0.362  Sum_probs=36.6

Q ss_pred             HHHHHHHHHHCC-CCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHH
Q ss_conf             899999998528-9988899868885179999998098169997289999999999963
Q gi|254780466|r  210 EALLSRILVSST-KPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIAS  267 (375)
Q Consensus       210 ~~LleriI~~~S-~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~  267 (375)
                      ..++++|+.+.. .++|.||+-=.|.|+-..+-.+.+.+.+++|+|+..++..++++..
T Consensus        28 ~~i~~kIv~~~~~~~~d~VLEIGPG~G~LT~~Ll~~~~~v~aiE~D~~l~~~L~e~~~~   86 (299)
T 2h1r_A           28 PGILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLAKKVITIDIDSRMISEVKKRCLY   86 (299)
T ss_dssp             HHHHHHHHHHHCCCTTCEEEEECCTTSTTHHHHTTTSSEEEEECSCHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHCCCCCCCEEEEECCCHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHH
T ss_conf             89999999845899989899968972799999982399079997770899999975432


No 234
>3ege_A Putative methyltransferase from antibiotic biosynthesis pathway; YP_324569.1, structural genomics; 2.40A {Anabaena variabilis atcc 29413}
Probab=90.71  E-value=0.1  Score=29.23  Aligned_cols=54  Identities=15%  Similarity=0.070  Sum_probs=43.8

Q ss_pred             HHHHHHHHHC-CCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHH
Q ss_conf             9999999852-89988899868885179999998098169997289999999999
Q gi|254780466|r  211 ALLSRILVSS-TKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKR  264 (375)
Q Consensus       211 ~LleriI~~~-S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~R  264 (375)
                      .+.++++... .++|+.|||-=||+|.-+....+.|.+.+|+|+++..++.+.++
T Consensus        21 ~~~~~~~~~l~l~~~~~vLDvGcG~G~~~~~l~~~~~~v~gvD~s~~~~~~a~~~   75 (261)
T 3ege_A           21 RIVNAIINLLNLPKGSVIADIGAGTGGYSVALANQGLFVYAVEPSIVMRQQAVVH   75 (261)
T ss_dssp             HHHHHHHHHHCCCTTCEEEEETCTTSHHHHHHHTTTCEEEEECSCHHHHHSSCCC
T ss_pred             HHHHHHHHHCCCCCCCEEEEECCCCCHHHHHHHHCCCEEEEEECCCCCCCCCCCC
T ss_conf             9999999965999969999964888899999997699899997445312100012


No 235
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structural genomics; HET: SAH; 2.20A {Pyrococcus horikoshii OT3} SCOP: c.66.1.32
Probab=90.63  E-value=0.11  Score=29.16  Aligned_cols=31  Identities=26%  Similarity=0.458  Sum_probs=23.4

Q ss_pred             HHHHCCCEECCCHHHHHHHCCCCCCCEEEECCCCCC
Q ss_conf             355327085172599897284147118984778761
Q gi|254780466|r   16 IFEWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNL   51 (375)
Q Consensus        16 ~~~~~nkI~~GDcl~~l~~Lpd~sVDlI~tDPPYni   51 (375)
                      ......+++++|+.+     .++.+|+|++||||+.
T Consensus        94 ~~~~~~~~~~~d~~~-----~~~~~D~ii~npP~~~  124 (207)
T 1wy7_A           94 EFKGKFKVFIGDVSE-----FNSRVDIVIMNPPFGS  124 (207)
T ss_dssp             GGTTSEEEEESCGGG-----CCCCCSEEEECCCCSS
T ss_pred             HCCCCCEEEECCHHH-----HHCCCCEEECCCCCCH
T ss_conf             839982799766788-----6146546444888520


No 236
>2dpm_A M.dpnii 1, protein (adenine-specific methyltransferase dpnii 1); DNA adenine methyltransferase, methylase; HET: SAM; 1.80A {Streptococcus pneumoniae} SCOP: c.66.1.28
Probab=90.59  E-value=0.38  Score=25.77  Aligned_cols=28  Identities=25%  Similarity=0.527  Sum_probs=19.0

Q ss_pred             CEECCCHHHHHHHCCCCCCCEEEECCCCCC
Q ss_conf             085172599897284147118984778761
Q gi|254780466|r   22 KIIKGNSISVLEKLPAKSVDLIFADPPYNL   51 (375)
Q Consensus        22 kI~~GDcl~~l~~Lpd~sVDlI~tDPPYni   51 (375)
                      .|.+.|..+.+...  .+-|+||.||||-.
T Consensus       172 ~i~~~d~~~~~~~~--~~~~fvYlDPPY~~  199 (284)
T 2dpm_A          172 EIKVGDFEKAIVDV--RTGDFVYFDPPYIP  199 (284)
T ss_dssp             EEEESCGGGGGTTC--CTTCEEEECCCCCC
T ss_pred             CCCHHHHHHHHHCC--CCCCEEEECCCCCC
T ss_conf             20207399987517--98868998699877


No 237
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium}
Probab=89.77  E-value=0.99  Score=23.27  Aligned_cols=97  Identities=18%  Similarity=0.271  Sum_probs=59.6

Q ss_pred             CCC-EECCCHHHHHHHCCCCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             270-8517259989728414711898477876155871333678513001344357789899999889999999986396
Q gi|254780466|r   20 KDK-IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKP   98 (375)
Q Consensus        20 ~nk-I~~GDcl~~l~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvLK~   98 (375)
                      .|. +.+.|..+....+ .+.+|.|+.|+|=- +.  ++.|-+-    .....|.. +....+.....+.|..+.+.||+
T Consensus       156 ~n~~v~~~d~~~~~~~~-~~~fD~VLvDaPCS-G~--G~~rk~p----~~~~~~~~-~~~~~~~~~Q~~iL~~a~~~lkp  226 (456)
T 3m4x_A          156 SNAIVTNHAPAELVPHF-SGFFDRIVVDAPCS-GE--GMFRKDP----NAIKEWTE-ESPLYCQKRQQEILSSAIKMLKN  226 (456)
T ss_dssp             SSEEEECCCHHHHHHHH-TTCEEEEEEECCCC-CG--GGTTTCH----HHHHHCCT-THHHHHHHHHHHHHHHHHHTEEE
T ss_pred             CCEEEEECCCCCCCCCC-CCCCCEEEECCCCC-CC--CCCCCCH----HHHHHCCH-HHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             74899932544355212-46555799748767-78--7306680----66554244-46778999999999999975889


Q ss_pred             CCEE-EEECCH---HHHHHHHHHHHHCCCCE
Q ss_conf             8729-998346---88899998764057860
Q gi|254780466|r   99 NGTL-WVIGSY---HNIFRIGTMLQNLNFWI  125 (375)
Q Consensus        99 ~Gsi-~v~~~~---~~i~~i~~~l~~~gf~~  125 (375)
                      +|.+ |..|+.   .|---|..++++.++.+
T Consensus       227 GG~lvYSTCS~~~eENE~vV~~~L~~~~~~~  257 (456)
T 3m4x_A          227 KGQLIYSTCTFAPEENEEIISWLVENYPVTI  257 (456)
T ss_dssp             EEEEEEEESCCCGGGTHHHHHHHHHHSSEEE
T ss_pred             CCEEEEEECCCCHHHCHHHHHHHHHHCCCCE
T ss_conf             9889999189974529999999998699837


No 238
>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structural genomics; 1.50A {Listeria monocytogenes str}
Probab=89.75  E-value=0.32  Score=26.26  Aligned_cols=10  Identities=20%  Similarity=0.105  Sum_probs=4.7

Q ss_pred             HCCCCCEEEE
Q ss_conf             6396872999
Q gi|254780466|r   95 VLKPNGTLWV  104 (375)
Q Consensus        95 vLK~~Gsi~v  104 (375)
                      .+.++.++-|
T Consensus        96 ~l~~~~~f~v  105 (393)
T 3k0b_A           96 YLPLDAQFPV  105 (393)
T ss_dssp             TCCTTCBCCE
T ss_pred             HCCCCCCEEE
T ss_conf             6476771788


No 239
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 2zzm_A*
Probab=89.62  E-value=0.2  Score=27.48  Aligned_cols=16  Identities=13%  Similarity=-0.197  Sum_probs=7.2

Q ss_pred             EEEECCCCCHHHHHHH
Q ss_conf             8998688851799999
Q gi|254780466|r  226 IILDPFFGSGTSGAVA  241 (375)
Q Consensus       226 iVLDPF~GSGTT~~aA  241 (375)
                      +|++|-.+|-.-.-+|
T Consensus       262 Ii~~~P~~~~~~l~~a  277 (336)
T 2yx1_A          262 VIMNLPKFAHKFIDKA  277 (336)
T ss_dssp             EEECCTTTGGGGHHHH
T ss_pred             EEECCHHHHHHHHHHH
T ss_conf             9965804669999999


No 240
>1yf3_A DNA adenine methylase; T4DAM, methyltransferase, transferase/DNA complex; HET: DNA SAH; 2.29A {Enterobacteria phage T4} SCOP: c.66.1.28 PDB: 1yfj_A* 1yfl_A* 1q0s_A* 1q0t_A*
Probab=89.56  E-value=0.5  Score=25.09  Aligned_cols=14  Identities=36%  Similarity=0.809  Sum_probs=6.7

Q ss_pred             CCCCCEEEECCCCC
Q ss_conf             14711898477876
Q gi|254780466|r   37 AKSVDLIFADPPYN   50 (375)
Q Consensus        37 d~sVDlI~tDPPYn   50 (375)
                      +..-|+||.||||.
T Consensus       162 ~~~~~fvYlDPPY~  175 (259)
T 1yf3_A          162 ILDGDFVYVDPPYL  175 (259)
T ss_dssp             CCTTEEEEECCCCT
T ss_pred             CCCCEEEEECCCCC
T ss_conf             46661899789876


No 241
>1yf3_A DNA adenine methylase; T4DAM, methyltransferase, transferase/DNA complex; HET: DNA SAH; 2.29A {Enterobacteria phage T4} SCOP: c.66.1.28 PDB: 1yfj_A* 1yfl_A* 1q0s_A* 1q0t_A*
Probab=89.50  E-value=0.37  Score=25.86  Aligned_cols=16  Identities=19%  Similarity=0.285  Sum_probs=8.9

Q ss_pred             HHHHCCCCCCCEEEECCCC
Q ss_conf             8972841471189847787
Q gi|254780466|r   31 VLEKLPAKSVDLIFADPPY   49 (375)
Q Consensus        31 ~l~~Lpd~sVDlI~tDPPY   49 (375)
                      +++.+|+  ++ .|.+|=-
T Consensus        18 i~~~~P~--~~-~yvEpF~   33 (259)
T 1yf3_A           18 LKSHFPK--YN-RFVDLFC   33 (259)
T ss_dssp             HHHTCCC--CS-EEEETTC
T ss_pred             HHHHCCC--CC-EEEEECC
T ss_conf             9986899--88-6984566


No 242
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18
Probab=89.43  E-value=0.11  Score=28.96  Aligned_cols=15  Identities=13%  Similarity=-0.048  Sum_probs=8.6

Q ss_pred             HHHHHHCCEEEEEEE
Q ss_conf             999980981699972
Q gi|254780466|r  239 AVAKKLRRSFIGIEM  253 (375)
Q Consensus       239 ~aA~~lgR~~IGiE~  253 (375)
                      ..+++.|-.-|.++-
T Consensus       219 ~~l~~~Gf~~i~~~d  233 (297)
T 2o57_A          219 SLAKECGLVTLRTFS  233 (297)
T ss_dssp             HHHHHTTEEEEEEEE
T ss_pred             HHHHHCCCEEEEEEE
T ss_conf             999987998999998


No 243
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24
Probab=89.38  E-value=1.1  Score=23.08  Aligned_cols=26  Identities=23%  Similarity=0.529  Sum_probs=13.2

Q ss_pred             CEECCCHHHHHHHCCCCCCCEEEECCCCCC
Q ss_conf             085172599897284147118984778761
Q gi|254780466|r   22 KIIKGNSISVLEKLPAKSVDLIFADPPYNL   51 (375)
Q Consensus        22 kI~~GDcl~~l~~Lpd~sVDlI~tDPPYni   51 (375)
                      .+++||.++.  .+  .....|+.-.|||+
T Consensus        80 ~ii~~D~l~~--d~--~~~~~vVgNLPYnI  105 (285)
T 1zq9_A           80 QVLVGDVLKT--DL--PFFDTCVANLPYQI  105 (285)
T ss_dssp             EEEESCTTTS--CC--CCCSEEEEECCGGG
T ss_pred             EEECHHHHHC--HH--HHHHHEECCCHHHH
T ss_conf             4540665411--05--54432110221656


No 244
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus HB8} PDB: 3m6v_A* 3m6u_A* 3m6x_A*
Probab=89.04  E-value=1.1  Score=22.93  Aligned_cols=94  Identities=16%  Similarity=0.271  Sum_probs=60.0

Q ss_pred             HCCCEECCCHHHHHHHCCCCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             32708517259989728414711898477876155871333678513001344357789899999889999999986396
Q gi|254780466|r   19 WKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKP   98 (375)
Q Consensus        19 ~~nkI~~GDcl~~l~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvLK~   98 (375)
                      ..+.+.+.|..... ....+.+|.|+.|+|-- +.  ++.|.+-.    ....|.. .+...+....++.|..+.+.||+
T Consensus       151 ~~~~v~~~d~~~l~-~~~~~~fD~ILvDaPCS-G~--G~~rk~p~----~~~~~~~-~~~~~l~~~Q~~iL~~A~~~Lkp  221 (464)
T 3m6w_A          151 APLAVTQAPPRALA-EAFGTYFHRVLLDAPCS-GE--GMFRKDRE----AARHWGP-SAPKRMAEVQKALLAQASRLLGP  221 (464)
T ss_dssp             CCCEEECSCHHHHH-HHHCSCEEEEEEECCCC-CG--GGTTTCTT----SGGGCCT-THHHHHHHHHHHHHHHHHTTEEE
T ss_pred             CCEEEEECCHHHHH-CCCCCCCCEEEECCCCC-CC--CCCCCCCH----HHHCCCH-HHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             86168723224332-04666443798448766-67--63233802----4220587-78999999999999999987188


Q ss_pred             CCEE-EEECCH---HHHHHHHHHHHHC
Q ss_conf             8729-998346---8889999876405
Q gi|254780466|r   99 NGTL-WVIGSY---HNIFRIGTMLQNL  121 (375)
Q Consensus        99 ~Gsi-~v~~~~---~~i~~i~~~l~~~  121 (375)
                      +|.+ |..|+.   .|-..|..+|++.
T Consensus       222 GG~LVYSTCS~~~eENE~vV~~~L~~~  248 (464)
T 3m6w_A          222 GGVLVYSTCTFAPEENEGVVAHFLKAH  248 (464)
T ss_dssp             EEEEEEEESCCCGGGTHHHHHHHHHHC
T ss_pred             CCEEEEEECCCCHHHHHHHHHHHHHHC
T ss_conf             988999969998687799999999869


No 245
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1, methyltransferase domain, structural genomics; HET: PGE GOL; 2.00A {Clostridium acetobutylicum}
Probab=89.00  E-value=0.11  Score=29.01  Aligned_cols=54  Identities=19%  Similarity=0.276  Sum_probs=31.9

Q ss_pred             CCEECCCHHHHHHHCCCCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             70851725998972841471189847787615587133367851300134435778989999988999999998639687
Q gi|254780466|r   21 DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNG  100 (375)
Q Consensus        21 nkI~~GDcl~~l~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvLK~~G  100 (375)
                      -.+++||+.+.  .+|++|+|+|+..-=        +             .|   -+.++.    ...+.+++|+|||+|
T Consensus        73 v~~~~~d~~~l--~~~~~sfD~I~s~~~--------l-------------~h---~~~~~~----~~~l~~~~r~LkpgG  122 (209)
T 2p8j_A           73 LNISKGDIRKL--PFKDESMSFVYSYGT--------I-------------FH---MRKNDV----KEAIDEIKRVLKPGG  122 (209)
T ss_dssp             CCEEECCTTSC--CSCTTCEEEEEECSC--------G-------------GG---SCHHHH----HHHHHHHHHHEEEEE
T ss_pred             EEEECCEEECC--CCCCCCCCHHHHHHH--------H-------------HC---CCHHHH----HHHHHHHHHHCCCCE
T ss_conf             65300202236--854342338887667--------8-------------72---884789----999999998758584


Q ss_pred             EEEE
Q ss_conf             2999
Q gi|254780466|r  101 TLWV  104 (375)
Q Consensus       101 si~v  104 (375)
                      .+++
T Consensus       123 ~~~i  126 (209)
T 2p8j_A          123 LACI  126 (209)
T ss_dssp             EEEE
T ss_pred             EEEE
T ss_conf             9999


No 246
>1dct_A Protein (modification methylase HAEIII); enzyme, cytosine methylase, transferase/DNA complex; HET: DNA C49 5CM; 2.80A {Haemophilus influenzae biotypeaegyptius} SCOP: c.66.1.26
Probab=88.98  E-value=0.77  Score=23.92  Aligned_cols=33  Identities=27%  Similarity=0.494  Sum_probs=23.5

Q ss_pred             HHHHCCCEECCCHHHH-HHHCCCCCCCEEEECCCCC
Q ss_conf             3553270851725998-9728414711898477876
Q gi|254780466|r   16 IFEWKDKIIKGNSISV-LEKLPAKSVDLIFADPPYN   50 (375)
Q Consensus        16 ~~~~~nkI~~GDcl~~-l~~Lpd~sVDlI~tDPPYn   50 (375)
                      ..++-+.+++||..++ .+.+|  .||+++..||=-
T Consensus        39 ~~N~~~~~~~~Di~~~~~~~~~--~~D~~~~g~PCq   72 (324)
T 1dct_A           39 ESNHSAKLIKGDISKISSDEFP--KCDGIIGGPPCQ   72 (324)
T ss_dssp             HHHCCSEEEESCTTTSCGGGSC--CCSEEEECCCCT
T ss_pred             HHHCCCCCCCCCHHHCCHHHCC--CCCEEEECCCCC
T ss_conf             9878999724982459985767--536577369984


No 247
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG; HET: MSE; 2.15A {Nostoc punctiforme pcc 73102}
Probab=88.98  E-value=0.97  Score=23.32  Aligned_cols=60  Identities=13%  Similarity=0.232  Sum_probs=44.5

Q ss_pred             CHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHH--CCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             189999999852899888998688851799999980--9816999728999999999996305
Q gi|254780466|r  209 PEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKL--RRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       209 P~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~l--gR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      +...+..++......+..|||-=+|+|+.+.+..+.  +-+++++|+ +..++.|+++++...
T Consensus       151 ~~~~~~~~~~~~~~~~~~vLDvG~G~G~~~~~l~~~~p~~~~~~~Dl-p~~~~~a~~~~~~~~  212 (335)
T 2r3s_A          151 PAQLIAQLVNENKIEPLKVLDISASHGLFGIAVAQHNPNAEIFGVDW-ASVLEVAKENARIQG  212 (335)
T ss_dssp             HHHHHHHHHTC--CCCSEEEEETCTTCHHHHHHHHHCTTCEEEEEEC-HHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHCCCCCCEEEEECCCCCHHHHHHHHHCCCCCEEEECC-HHHHHHHHHHHHHHC
T ss_conf             89999987110068898799979996299999998589877377446-788899998788608


No 248
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein structure initiative; HET: MSE; 1.80A {Porphyromonas gingivalis}
Probab=88.76  E-value=0.077  Score=29.99  Aligned_cols=47  Identities=19%  Similarity=0.089  Sum_probs=42.5

Q ss_pred             CCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHC
Q ss_conf             99888998688851799999980981699972899999999999630
Q gi|254780466|r  222 KPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASV  268 (375)
Q Consensus       222 ~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~  268 (375)
                      .+|+.|+|-+||.|.-+.+.-+.+.+-+++|+++.-+++|+.-+...
T Consensus        92 ~~g~~v~Dl~cG~G~da~alA~~~~~V~~vE~d~~~~~~A~~N~~~~  138 (410)
T 3ll7_A           92 REGTKVVDLTGGLGIDFIALMSKASQGIYIERNDETAVAARHNIPLL  138 (410)
T ss_dssp             CTTCEEEESSCSSSHHHHHHHTTCSEEEEEESCHHHHHHHHHHHHHH
T ss_pred             CCCCEEEECCCCHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHH
T ss_conf             79998998788667999999963998999958999999999848987


No 249
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A
Probab=88.67  E-value=1.2  Score=22.78  Aligned_cols=59  Identities=17%  Similarity=0.312  Sum_probs=43.0

Q ss_pred             CCCCCHHHHHHHHHHCCCCCCEEEECCCCCHHHHHH-HHHHC--CEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             877818999999985289988899868885179999-99809--816999728999999999996305
Q gi|254780466|r  205 PTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAV-AKKLR--RSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       205 PTqKP~~LleriI~~~S~~gDiVLDPF~GSGTT~~a-A~~lg--R~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      ..|.|..++      -..+|+.|||.++|.|.-..+ |..++  ...+++|+++.-++..+++++..-
T Consensus        71 sS~l~~~~l------~~~~g~~vLD~CaapGgKt~~i~~~~~~~~~i~a~d~~~~rl~~l~~~~~r~g  132 (274)
T 3ajd_A           71 SSMIPPIVL------NPREDDFILDMCAAPGGKTTHLAQLMKNKGTIVAVEISKTRTKALKSNINRMG  132 (274)
T ss_dssp             GGGHHHHHH------CCCTTCEEEETTCTTCHHHHHHHHHTTTCSEEEEEESCHHHHHHHHHHHHHTT
T ss_pred             HHHCHHHHC------CCCCCCEEEEECCCCCHHHHHHHHHHHCCCCEEEECCCHHHHHHHHHHHHHHH
T ss_conf             651589758------99999979990788868899999985386833873277889999988787651


No 250
>3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural genomics, protein structure initiative, PSI; 1.75A {Escherichia coli O157}
Probab=88.55  E-value=0.76  Score=23.95  Aligned_cols=28  Identities=14%  Similarity=0.375  Sum_probs=17.2

Q ss_pred             EECCCHH----HHHHHC--CCCCCCEEEECCCCC
Q ss_conf             8517259----989728--414711898477876
Q gi|254780466|r   23 IIKGNSI----SVLEKL--PAKSVDLIFADPPYN   50 (375)
Q Consensus        23 I~~GDcl----~~l~~L--pd~sVDlI~tDPPYn   50 (375)
                      .+++|.-    +.++.+  ....||+++..||--
T Consensus        49 ~~~~di~~~~~~~~~~~~~~~~~vDvl~ggpPCQ   82 (376)
T 3g7u_A           49 HVQEDVSLLNAEIIKGFFKNDMPIDGIIGGPPCQ   82 (376)
T ss_dssp             EECCCGGGCCHHHHHHHHCSCCCCCEEEECCCCC
T ss_pred             CCCCCHHHCCHHHHHHHHCCCCCCCEEEECCCCC
T ss_conf             3588533489999755402588877799688988


No 251
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii}
Probab=88.46  E-value=0.2  Score=27.43  Aligned_cols=18  Identities=6%  Similarity=-0.084  Sum_probs=8.1

Q ss_pred             EEEECCCCCHHHHHHHHH
Q ss_conf             899868885179999998
Q gi|254780466|r  226 IILDPFFGSGTSGAVAKK  243 (375)
Q Consensus       226 iVLDPF~GSGTT~~aA~~  243 (375)
                      +|++|...|-.-.-+|.+
T Consensus       190 Vimn~p~~s~~fl~~a~~  207 (272)
T 3a27_A          190 VIMGYVHKTHKFLDKTFE  207 (272)
T ss_dssp             EEECCCSSGGGGHHHHHH
T ss_pred             EEECCCCCHHHHHHHHHH
T ss_conf             997895127999999999


No 252
>1vl5_A Unknown conserved protein BH2331; 10174951, hypothetical protein, structural genomics, JCSG, protein structure initiative, PSI; HET: MSE; 1.95A {Bacillus halodurans c-125} SCOP: c.66.1.41
Probab=88.13  E-value=0.14  Score=28.40  Aligned_cols=19  Identities=32%  Similarity=0.579  Sum_probs=15.9

Q ss_pred             HHHHHHHHHCCCCCEEEEE
Q ss_conf             9999999863968729998
Q gi|254780466|r   87 AWLLACRRVLKPNGTLWVI  105 (375)
Q Consensus        87 ~wl~e~~RvLK~~Gsi~v~  105 (375)
                      ..+.+++|+|||+|.+++.
T Consensus       121 ~~l~~~~r~LkPgG~l~i~  139 (260)
T 1vl5_A          121 SFVSEAYRVLKKGGQLLLV  139 (260)
T ss_dssp             HHHHHHHHHEEEEEEEEEE
T ss_pred             HHHHHHHHHCCCCCEEEEE
T ss_conf             9999999742858289999


No 253
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A
Probab=88.01  E-value=0.38  Score=25.83  Aligned_cols=51  Identities=10%  Similarity=0.240  Sum_probs=39.5

Q ss_pred             HCCCCCCEEEECCCCCHHHHH-HHHHH-CCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             528998889986888517999-99980-9816999728999999999996305
Q gi|254780466|r  219 SSTKPGDIILDPFFGSGTSGA-VAKKL-RRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       219 ~~S~~gDiVLDPF~GSGTT~~-aA~~l-gR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      ....+|+.|||-.+|-|.=.. .|..+ .-.-+.+|+++.-++..++++....
T Consensus       242 l~~~~~~~VLD~CAaPGgKt~~la~~~~~~~i~a~d~~~~r~~~l~~~~~r~g  294 (429)
T 1sqg_A          242 LAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRLG  294 (429)
T ss_dssp             HCCCTTCEEEEESCTTCHHHHHHHHHCTTCEEEEEESSTTTHHHHHHHHHHTT
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHCCCCCCEEECCHHHHHHHHHHHHHHCC
T ss_conf             18421441456068804899999986222465622342677888877786416


No 254
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 1.90A {Geobacter sulfurreducens pca}
Probab=88.00  E-value=1.3  Score=22.51  Aligned_cols=57  Identities=18%  Similarity=0.197  Sum_probs=41.7

Q ss_pred             HHHHHHHHHCCCCCCEEEECCCCCH-HHHHHHHHHC--CEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             9999999852899888998688851-7999999809--816999728999999999996305
Q gi|254780466|r  211 ALLSRILVSSTKPGDIILDPFFGSG-TSGAVAKKLR--RSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       211 ~LleriI~~~S~~gDiVLDPF~GSG-TT~~aA~~lg--R~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      +++..++.. ++ ...||+-=+|+| +|...|+.++  -+.+++|++++.++.|++.++..-
T Consensus        46 ~~L~~L~~~-~~-~~~ILEiGtg~G~st~~la~~~~~~g~v~~id~~~~~~~~ar~~~~~~g  105 (210)
T 3c3p_A           46 RLLYLLARI-KQ-PQLVVVPGDGLGCASWWFARAISISSRVVMIDPDRDNVEHARRMLHDNG  105 (210)
T ss_dssp             HHHHHHHHH-HC-CSEEEEESCGGGHHHHHHHTTSCTTCEEEEEESCHHHHHHHHHHHHHHS
T ss_pred             HHHHHHHHH-HC-CCEEEEEECCCHHHHHHHHHHCCCCEEEEEEECCCCHHHHHHHHHHHCC
T ss_conf             999999885-68-0989995081439999999975568199999775103789998798729


No 255
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A*
Probab=87.97  E-value=0.11  Score=29.15  Aligned_cols=52  Identities=27%  Similarity=0.432  Sum_probs=33.5

Q ss_pred             CEECCCHHHHHHHCCCCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCE
Q ss_conf             08517259989728414711898477876155871333678513001344357789899999889999999986396872
Q gi|254780466|r   22 KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGT  101 (375)
Q Consensus        22 kI~~GDcl~~l~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvLK~~Gs  101 (375)
                      .++++|..+.  .++++++|+|+..=-.                     .|  +.+.       ...+++++|+|||+|.
T Consensus        72 ~~~~~d~~~l--~~~d~~fD~v~~~~~l---------------------~~--~~d~-------~~~l~ei~r~LkpgG~  119 (239)
T 1xxl_A           72 RFQQGTAESL--PFPDDSFDIITCRYAA---------------------HH--FSDV-------RKAVREVARVLKQDGR  119 (239)
T ss_dssp             EEEECBTTBC--CSCTTCEEEEEEESCG---------------------GG--CSCH-------HHHHHHHHHHEEEEEE
T ss_pred             EEEECCCCCC--CCCCCCEEEEHHCCCH---------------------HC--CCCH-------HHHHHHHHHHCCCCCE
T ss_conf             0010222356--8888736530204512---------------------22--4689-------9999999998083829


Q ss_pred             EEEE
Q ss_conf             9998
Q gi|254780466|r  102 LWVI  105 (375)
Q Consensus       102 i~v~  105 (375)
                      +++.
T Consensus       120 ~~~~  123 (239)
T 1xxl_A          120 FLLV  123 (239)
T ss_dssp             EEEE
T ss_pred             EEEE
T ss_conf             9999


No 256
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus}
Probab=87.34  E-value=0.26  Score=26.81  Aligned_cols=53  Identities=21%  Similarity=0.462  Sum_probs=32.3

Q ss_pred             HCCCEECCCHHHHHHHCCCCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             32708517259989728414711898477876155871333678513001344357789899999889999999986396
Q gi|254780466|r   19 WKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKP   98 (375)
Q Consensus        19 ~~nkI~~GDcl~~l~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvLK~   98 (375)
                      ..+.+...|.    ..+|++|+|+|+.---+.                       .+.+.       ...+.+++|+|||
T Consensus        59 ~~~~~~~~~~----~~l~~~~fD~i~~~~~l~-----------------------~~~~~-------~~~l~~i~r~Lkp  104 (170)
T 3i9f_A           59 FDSVITLSDP----KEIPDNSVDFILFANSFH-----------------------DMDDK-------QHVISEVKRILKD  104 (170)
T ss_dssp             CTTSEEESSG----GGSCTTCEEEEEEESCST-----------------------TCSCH-------HHHHHHHHHHEEE
T ss_pred             CEEEEEEECC----CCCCCCCEEEEEEEEEEE-----------------------CCCCH-------HHHHHHHHHHCCC
T ss_conf             1035532001----237878578999850334-----------------------17799-------9999999997587


Q ss_pred             CCEEEEE
Q ss_conf             8729998
Q gi|254780466|r   99 NGTLWVI  105 (375)
Q Consensus        99 ~Gsi~v~  105 (375)
                      +|.+++.
T Consensus       105 gG~l~i~  111 (170)
T 3i9f_A          105 DGRVIII  111 (170)
T ss_dssp             EEEEEEE
T ss_pred             CEEEEEE
T ss_conf             8099999


No 257
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1, methyltransferase domain, structural genomics; HET: MSE; 1.60A {Mesorhizobium loti MAFF303099}
Probab=87.29  E-value=1.2  Score=22.67  Aligned_cols=47  Identities=17%  Similarity=0.106  Sum_probs=37.4

Q ss_pred             CCCCCEEEECCCCCHHHHHHHHHHC-CEEEEEEECHHHHHHHHHHHHH
Q ss_conf             8998889986888517999999809-8169997289999999999963
Q gi|254780466|r  221 TKPGDIILDPFFGSGTSGAVAKKLR-RSFIGIEMKQDYIDIATKRIAS  267 (375)
Q Consensus       221 S~~gDiVLDPF~GSGTT~~aA~~lg-R~~IGiE~~~~Y~~~a~~Rl~~  267 (375)
                      ..+|.-|||-=||+|-.+....+.+ .+.+|+|+++..++.|+++...
T Consensus        41 ~~~g~rVLDiGCG~G~~~~~l~~~~~~~V~gvD~S~~~l~~a~~~~~~   88 (243)
T 3bkw_A           41 EVGGLRIVDLGCGFGWFCRWAHEHGASYVLGLDLSEKMLARARAAGPD   88 (243)
T ss_dssp             CCTTCEEEEETCTTCHHHHHHHHTTCSEEEEEESCHHHHHHHHHTSCS
T ss_pred             CCCCCEEEEECCCCCHHHHHHHHCCCCEEEEECCHHHHHHHHHHHCCC
T ss_conf             778899999788898999999975987899987579899999861344


No 258
>2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ...
Probab=87.25  E-value=1.1  Score=22.97  Aligned_cols=30  Identities=20%  Similarity=0.399  Sum_probs=18.2

Q ss_pred             HHCCCEECCCHHHHH-HHCCCCCCCEEEECCCCC
Q ss_conf             532708517259989-728414711898477876
Q gi|254780466|r   18 EWKDKIIKGNSISVL-EKLPAKSVDLIFADPPYN   50 (375)
Q Consensus        18 ~~~nkI~~GDcl~~l-~~Lpd~sVDlI~tDPPYn   50 (375)
                      ++-+ ..++|-.++- +.++  .+|+++..||-.
T Consensus        52 N~~~-~~~~Di~~~~~~~~~--~~Dll~gg~PCQ   82 (327)
T 2c7p_A           52 NFGE-KPEGDITQVNEKTIP--DHDILCAGFPCQ   82 (327)
T ss_dssp             HHSC-CCBSCGGGSCGGGSC--CCSEEEEECCCT
T ss_pred             HCCC-CCCCCHHHCCHHHCC--CCCEEEECCCCC
T ss_conf             7799-975753238851477--756799758987


No 259
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima MSB8} SCOP: c.66.1.41
Probab=86.88  E-value=0.24  Score=27.03  Aligned_cols=19  Identities=37%  Similarity=0.475  Sum_probs=11.2

Q ss_pred             HHHHHHHHHHCCCCCEEEE
Q ss_conf             9999999986396872999
Q gi|254780466|r   86 RAWLLACRRVLKPNGTLWV  104 (375)
Q Consensus        86 ~~wl~e~~RvLK~~Gsi~v  104 (375)
                      ...|.+++|+|||+|.+++
T Consensus       132 ~~~l~~i~r~Lk~gG~li~  150 (260)
T 2avn_A          132 DKAFSEIRRVLVPDGLLIA  150 (260)
T ss_dssp             HHHHHHHHHHEEEEEEEEE
T ss_pred             HHHHHHHHHHCCCCCEEEE
T ss_conf             9999999997398978999


No 260
>1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26
Probab=86.55  E-value=1  Score=23.18  Aligned_cols=32  Identities=22%  Similarity=0.459  Sum_probs=22.2

Q ss_pred             HHCC-CEECCCHHH-HHHHCCCCCCCEEEECCCC
Q ss_conf             5327-085172599-8972841471189847787
Q gi|254780466|r   18 EWKD-KIIKGNSIS-VLEKLPAKSVDLIFADPPY   49 (375)
Q Consensus        18 ~~~n-kI~~GDcl~-~l~~Lpd~sVDlI~tDPPY   49 (375)
                      ++-+ .++++|.-+ ..+.++...||+++..||=
T Consensus        45 N~~~~~~~~~di~~~~~~~~~~~~~Dll~ggpPC   78 (343)
T 1g55_A           45 NFPHTQLLAKTIEGITLEEFDRLSFDMILMSPPC   78 (343)
T ss_dssp             HCTTSCEECSCGGGCCHHHHHHHCCSEEEECCC-
T ss_pred             HCCCCCEEECCHHHCCHHHCCCCCCCEEEEECCC
T ss_conf             7899975407533498957587786779972899


No 261
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A
Probab=86.55  E-value=0.15  Score=28.27  Aligned_cols=52  Identities=25%  Similarity=0.239  Sum_probs=33.6

Q ss_pred             CCEECCCHHHHHHHCCCCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             70851725998972841471189847787615587133367851300134435778989999988999999998639687
Q gi|254780466|r   21 DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNG  100 (375)
Q Consensus        21 nkI~~GDcl~~l~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvLK~~G  100 (375)
                      -.++++|+.++  .++++++|+|++.=-.                     .|   .+.       ...+.+++|+|||+|
T Consensus        98 v~~~~~d~~~l--~~~~~~FD~I~s~~~l---------------------~~---~~~-------~~~l~~i~r~LkpgG  144 (267)
T 3kkz_A           98 VTGIVGSMDDL--PFRNEELDLIWSEGAI---------------------YN---IGF-------ERGLNEWRKYLKKGG  144 (267)
T ss_dssp             EEEEECCTTSC--CCCTTCEEEEEESSCG---------------------GG---TCH-------HHHHHHHGGGEEEEE
T ss_pred             CCHHHCCCCCC--CCCCCCEEEEEECHHH---------------------HH---CCH-------HHHHHHHHHHCCCCE
T ss_conf             10010012356--7788846689740437---------------------83---898-------999999999659782


Q ss_pred             EEEEE
Q ss_conf             29998
Q gi|254780466|r  101 TLWVI  105 (375)
Q Consensus       101 si~v~  105 (375)
                      .+.+.
T Consensus       145 ~l~i~  149 (267)
T 3kkz_A          145 YLAVS  149 (267)
T ss_dssp             EEEEE
T ss_pred             EEEEE
T ss_conf             99999


No 262
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assembly S-adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A*
Probab=86.52  E-value=1.6  Score=22.00  Aligned_cols=58  Identities=17%  Similarity=0.205  Sum_probs=38.3

Q ss_pred             HHHHHHHHHHCC-CCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHH
Q ss_conf             899999998528-9988899868885179999998098169997289999999999963
Q gi|254780466|r  210 EALLSRILVSST-KPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIAS  267 (375)
Q Consensus       210 ~~LleriI~~~S-~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~  267 (375)
                      ..++++|+.+.. .++|.||+-=.|.|+-..+-.+.+.+.+++|+|+..++...++.+.
T Consensus        36 ~~i~~kIv~~~~~~~~d~VlEIGpG~G~LT~~Ll~~~~~v~aiEiD~~l~~~L~~~~~~   94 (295)
T 3gru_A           36 KNFVNKAVESANLTKDDVVLEIGLGKGILTEELAKNAKKVYVIEIDKSLEPYANKLKEL   94 (295)
T ss_dssp             HHHHHHHHHHTTCCTTCEEEEECCTTSHHHHHHHHHSSEEEEEESCGGGHHHHHHHHHH
T ss_pred             HHHHHHHHHHCCCCCCCEEEEECCCHHHHHHHHHHCCCCEEEEEECHHHHHHHHHHHHH
T ss_conf             99999999963899999599979974699999981689669999887999999976764


No 263
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.70A {Bacillus thuringiensis}
Probab=86.35  E-value=0.34  Score=26.07  Aligned_cols=28  Identities=18%  Similarity=0.112  Sum_probs=14.9

Q ss_pred             CCCCCCHHHHHHHHHHCCCCCCEEEECC
Q ss_conf             6877818999999985289988899868
Q gi|254780466|r  204 HPTQKPEALLSRILVSSTKPGDIILDPF  231 (375)
Q Consensus       204 HPTqKP~~LleriI~~~S~~gDiVLDPF  231 (375)
                      |-..-|.++++.+-....+-|-+++.-+
T Consensus       127 ~hi~d~~~~l~~~~r~LkpgG~~~i~~~  154 (242)
T 3l8d_A          127 EWTEEPLRALNEIKRVLKSDGYACIAIL  154 (242)
T ss_dssp             TSSSCHHHHHHHHHHHEEEEEEEEEEEE
T ss_pred             HHCCCHHHHHHHHHHHCCCCCEEEEEEE
T ss_conf             8447999999999998584828999996


No 264
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative, SAM-dependent methyltransferase; HET: SAI; 1.94A {Leishmania major strain friedlin} SCOP: c.66.1.42
Probab=85.81  E-value=1.7  Score=21.78  Aligned_cols=56  Identities=18%  Similarity=0.123  Sum_probs=42.2

Q ss_pred             HHHHHHC-CCCCCEEEECCCCCHHHH-HHHHHHCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             9999852-899888998688851799-9999809816999728999999999996305
Q gi|254780466|r  214 SRILVSS-TKPGDIILDPFFGSGTSG-AVAKKLRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       214 eriI~~~-S~~gDiVLDPF~GSGTT~-~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      +..+... ..++.-|||.=||+|-.. ..+.+.+-+..|+|+++..++.|++++....
T Consensus        83 ~~fl~~~~~~~~~~vLDiGcG~G~~t~~ll~~~~~~V~~vD~s~~~l~~a~~~~~~~~  140 (254)
T 1xtp_A           83 RNFIASLPGHGTSRALDCGAGIGRITKNLLTKLYATTDLLEPVKHMLEEAKRELAGMP  140 (254)
T ss_dssp             HHHHHTSTTCCCSEEEEETCTTTHHHHHTHHHHCSEEEEEESCHHHHHHHHHHTTTSS
T ss_pred             HHHHHHCCCCCCCEEEEECCCCCHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCCCC
T ss_conf             9999857335897389966788599999998639858999198899999864015774


No 265
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, NYSGXRC, structural genomics; 2.00A {Lactobacillus delbrueckii subsp}
Probab=85.69  E-value=0.49  Score=25.15  Aligned_cols=20  Identities=20%  Similarity=0.195  Sum_probs=10.9

Q ss_pred             HHHHHHHCCCCCEEEEECCH
Q ss_conf             99999863968729998346
Q gi|254780466|r   89 LLACRRVLKPNGTLWVIGSY  108 (375)
Q Consensus        89 l~e~~RvLK~~Gsi~v~~~~  108 (375)
                      +..+.+.++++.++.=+|.-
T Consensus        51 l~~L~~~~~~~~~VLDlGcG   70 (205)
T 3grz_A           51 MLGIERAMVKPLTVADVGTG   70 (205)
T ss_dssp             HHHHHHHCSSCCEEEEETCT
T ss_pred             HHHHHHCCCCCCEEEEEECC
T ss_conf             99998347995999999526


No 266
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans}
Probab=84.96  E-value=0.097  Score=29.41  Aligned_cols=12  Identities=25%  Similarity=0.498  Sum_probs=5.7

Q ss_pred             HCCCCCEEEEEC
Q ss_conf             639687299983
Q gi|254780466|r   95 VLKPNGTLWVIG  106 (375)
Q Consensus        95 vLK~~Gsi~v~~  106 (375)
                      .|.|++++.=+|
T Consensus        45 ~l~pg~rVLDvG   56 (226)
T 3m33_A           45 LLTPQTRVLEAG   56 (226)
T ss_dssp             HCCTTCEEEEES
T ss_pred             HCCCCCEEEEEC
T ss_conf             189999799988


No 267
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus HB8} PDB: 2yr0_A
Probab=84.72  E-value=0.22  Score=27.22  Aligned_cols=52  Identities=23%  Similarity=0.376  Sum_probs=32.8

Q ss_pred             CEECCCHHHHHHHCCCCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCE
Q ss_conf             08517259989728414711898477876155871333678513001344357789899999889999999986396872
Q gi|254780466|r   22 KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGT  101 (375)
Q Consensus        22 kI~~GDcl~~l~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvLK~~Gs  101 (375)
                      .+.++|+.+.  .++++|+|+|++---.                     .|  +.+.       ...|.+++|+|||+|.
T Consensus        89 ~~~~~da~~l--~~~~~sfD~V~~~~~l---------------------~~--~~d~-------~~~l~e~~r~LkPGG~  136 (263)
T 2yqz_A           89 QVVQADARAI--PLPDESVHGVIVVHLW---------------------HL--VPDW-------PKVLAEAIRVLKPGGA  136 (263)
T ss_dssp             EEEESCTTSC--CSCTTCEEEEEEESCG---------------------GG--CTTH-------HHHHHHHHHHEEEEEE
T ss_pred             HHHHHCCCCC--CCCCCCCCEEEECCHH---------------------HH--CCCH-------HHHHHHHHHHCCCCCE
T ss_conf             0222012223--4667610478751227---------------------75--5899-------9999999998580838


Q ss_pred             EEEE
Q ss_conf             9998
Q gi|254780466|r  102 LWVI  105 (375)
Q Consensus       102 i~v~  105 (375)
                      +.+.
T Consensus       137 l~~~  140 (263)
T 2yqz_A          137 LLEG  140 (263)
T ss_dssp             EEEE
T ss_pred             EEEE
T ss_conf             9999


No 268
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus HB8} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A*
Probab=84.41  E-value=2  Score=21.38  Aligned_cols=58  Identities=16%  Similarity=0.115  Sum_probs=36.5

Q ss_pred             HHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHH
Q ss_conf             8999999985289988899868885179999998098169997289999999999963
Q gi|254780466|r  210 EALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIAS  267 (375)
Q Consensus       210 ~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~  267 (375)
                      ...+++++.+....+|.||+-=.|.|+-..+-.+.+.+.+++|+|+..++.-.++...
T Consensus        33 ~~i~~~iv~~~~~~~~~VlEIGpG~G~LT~~L~~~~~~v~avE~D~~l~~~L~~~~~~   90 (271)
T 3fut_A           33 EAHLRRIVEAARPFTGPVFEVGPGLGALTRALLEAGAEVTAIEKDLRLRPVLEETLSG   90 (271)
T ss_dssp             HHHHHHHHHHHCCCCSCEEEECCTTSHHHHHHHHTTCCEEEEESCGGGHHHHHHHTTT
T ss_pred             HHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHCCCCEEEEEECHHHHHHHHHHHHH
T ss_conf             8999999996589999889967977199999996089679998370678888754333


No 269
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron}
Probab=83.26  E-value=0.31  Score=26.31  Aligned_cols=50  Identities=22%  Similarity=0.289  Sum_probs=31.0

Q ss_pred             CEECCCHHHHHHHCCCCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCE
Q ss_conf             08517259989728414711898477876155871333678513001344357789899999889999999986396872
Q gi|254780466|r   22 KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGT  101 (375)
Q Consensus        22 kI~~GDcl~~l~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvLK~~Gs  101 (375)
                      .+++||+.+.  .+|++++|+|+.-=        .+             .|   -+.       ...|.+++|+|||+|.
T Consensus        99 ~~~~~d~~~l--~~~~~~fD~V~~~~--------~l-------------~~---~~~-------~~~l~e~~rvLkpgG~  145 (257)
T 3f4k_A           99 KGITGSMDNL--PFQNEELDLIWSEG--------AI-------------YN---IGF-------ERGMNEWSKYLKKGGF  145 (257)
T ss_dssp             EEEECCTTSC--SSCTTCEEEEEEES--------CS-------------CC---CCH-------HHHHHHHHTTEEEEEE
T ss_pred             HHHHHHHHHH--HCCCCCCCEEEEHH--------HH-------------HH---CCH-------HHHHHHHHHHCCCCEE
T ss_conf             1113038876--23688521898605--------47-------------72---898-------9999999997085819


Q ss_pred             EEE
Q ss_conf             999
Q gi|254780466|r  102 LWV  104 (375)
Q Consensus       102 i~v  104 (375)
                      +.+
T Consensus       146 l~i  148 (257)
T 3f4k_A          146 IAV  148 (257)
T ss_dssp             EEE
T ss_pred             EEE
T ss_conf             999


No 270
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32
Probab=83.18  E-value=0.47  Score=25.21  Aligned_cols=27  Identities=11%  Similarity=0.283  Sum_probs=20.4

Q ss_pred             CCEECCCHHHHHHHCCCCCCCEEEECCCCCCC
Q ss_conf             70851725998972841471189847787615
Q gi|254780466|r   21 DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQ   52 (375)
Q Consensus        21 nkI~~GDcl~~l~~Lpd~sVDlI~tDPPYni~   52 (375)
                      ..++++|..+    + ++++|+|+.+|||+.+
T Consensus        97 ~~~~~~d~~~----~-~~~fD~Vi~NPPfg~~  123 (200)
T 1ne2_A           97 VNFMVADVSE----I-SGKYDTWIMNPPFGSV  123 (200)
T ss_dssp             SEEEECCGGG----C-CCCEEEEEECCCC---
T ss_pred             CCCEEEEHHH----C-CCCCCEEEECCCCCHH
T ss_conf             7853765210----5-7754889877986311


No 271
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A*
Probab=82.88  E-value=2.3  Score=21.00  Aligned_cols=58  Identities=19%  Similarity=0.166  Sum_probs=44.0

Q ss_pred             HHHHHHHHHHCCCCCCEEEECCCCCH-HHHHHHHHHC--CEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             89999999852899888998688851-7999999809--816999728999999999996305
Q gi|254780466|r  210 EALLSRILVSSTKPGDIILDPFFGSG-TSGAVAKKLR--RSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       210 ~~LleriI~~~S~~gDiVLDPF~GSG-TT~~aA~~lg--R~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      -.|+..++...-. . .||+-=+|+| ||...|+.++  -+.+++|.++++++.|++++....
T Consensus        47 g~~L~~L~~~~~p-k-~ILEiGt~~G~St~~la~al~~~g~i~tie~~~~~~~~a~~~~~~~g  107 (223)
T 3duw_A           47 GKFLQLLVQIQGA-R-NILEIGTLGGYSTIWLARGLSSGGRVVTLEASEKHADIARSNIERAN  107 (223)
T ss_dssp             HHHHHHHHHHHTC-S-EEEEECCTTSHHHHHHHTTCCSSCEEEEEESCHHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHHCC-C-EEEEEECCCCHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHHCC
T ss_conf             9999999997499-8-89998344278999999748888859999448888999999999849


No 272
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransferase domain; 2.90A {Escherichia coli}
Probab=82.59  E-value=2.4  Score=20.93  Aligned_cols=92  Identities=17%  Similarity=0.191  Sum_probs=55.7

Q ss_pred             EECCCHHHHHHHCCCCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCEE
Q ss_conf             85172599897284147118984778761558713336785130013443577898999998899999999863968729
Q gi|254780466|r   23 IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTL  102 (375)
Q Consensus        23 I~~GDcl~~l~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvLK~~Gsi  102 (375)
                      +.+.|... +.....+.+|.|+.|||-- +.  ++.|.+-.    ....|.. .....+....++.|..+.+.||++|.+
T Consensus       172 ~~~~d~~~-~~~~~~~~fD~ILvDaPCS-G~--G~~rk~p~----~~~~~s~-~~~~~l~~~Q~~iL~~A~~~LkpGG~L  242 (479)
T 2frx_A          172 LTHFDGRV-FGAAVPEMFDAILLDAPCS-GE--GVVRKDPD----ALKNWSP-ESNQEIAATQRELIDSAFHALRPGGTL  242 (479)
T ss_dssp             EECCCSTT-HHHHSTTCEEEEEEECCCC-CG--GGGGTCTT----SSSSCCH-HHHHHHHHHHHHHHHHHHHHEEEEEEE
T ss_pred             EEECCCHH-CCCCCCCCCCEEEECCCCC-CC--CCCCCCHH----HHHHCCH-HHHHHHHHHHHHHHHHHHHHCCCCCEE
T ss_conf             99354001-1401310167899659856-78--64045855----7765588-677899999999999999857889889


Q ss_pred             -EEECCH---HHHHHHHHHHHHCCC
Q ss_conf             -998346---888999987640578
Q gi|254780466|r  103 -WVIGSY---HNIFRIGTMLQNLNF  123 (375)
Q Consensus       103 -~v~~~~---~~i~~i~~~l~~~gf  123 (375)
                       |..|+.   .|---|..+|++.+.
T Consensus       243 vYSTCS~~~eENE~vV~~~L~~~~~  267 (479)
T 2frx_A          243 VYSTCTLNQEENEAVCLWLKETYPD  267 (479)
T ss_dssp             EEEESCCSSTTTHHHHHHHHHHSTT
T ss_pred             EEEECCCCHHHHHHHHHHHHHHCCC
T ss_conf             9994899645329999999974988


No 273
>1qyr_A KSGA, high level kasugamycin resistance protein, S-; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24
Probab=81.16  E-value=2.3  Score=21.00  Aligned_cols=30  Identities=20%  Similarity=0.463  Sum_probs=14.6

Q ss_pred             CEECCCHHHH-HHHCCC--CCCCEEEECCCCCC
Q ss_conf             0851725998-972841--47118984778761
Q gi|254780466|r   22 KIIKGNSISV-LEKLPA--KSVDLIFADPPYNL   51 (375)
Q Consensus        22 kI~~GDcl~~-l~~Lpd--~sVDlI~tDPPYni   51 (375)
                      +|++||.+++ +..++.  +.=-.|+..-|||+
T Consensus        70 ~ii~~D~l~~~~~~~~~~~~~~~~vvgNLPY~I  102 (252)
T 1qyr_A           70 TIYQQDAMTFNFGELAEKMGQPLRVFGNLPYNI  102 (252)
T ss_dssp             EEECSCGGGCCHHHHHHHHTSCEEEEEECCTTT
T ss_pred             EEEECHHHHHCHHHHHCCCCCCEEEEECCHHHH
T ss_conf             565011455232122103689759994662889


No 274
>1vlm_A SAM-dependent methyltransferase; possible histamine N-methyltransferase, structural genomics, JCSG, protein structure initiative, PSI; 2.20A {Thermotoga maritima MSB8} SCOP: c.66.1.41
Probab=81.08  E-value=1.6  Score=22.03  Aligned_cols=39  Identities=28%  Similarity=0.324  Sum_probs=23.3

Q ss_pred             CCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHH
Q ss_conf             9988899868885179999998098169997289999999999
Q gi|254780466|r  222 KPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKR  264 (375)
Q Consensus       222 ~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~R  264 (375)
                      .|++.|||-=||+|..+   ..+.+ -+|+|.++..++.|+++
T Consensus        46 ~~~~~vLDiGcGtG~~~---~~l~~-~~giD~s~~~i~~a~~~   84 (219)
T 1vlm_A           46 LPEGRGVEIGVGTGRFA---VPLKI-KIGVEPSERMAEIARKR   84 (219)
T ss_dssp             CCSSCEEEETCTTSTTH---HHHTC-CEEEESCHHHHHHHHHT
T ss_pred             CCCCEEEEECCCCCHHH---HHHHH-EEEEECCHHHHHHHHHC
T ss_conf             89990999858677999---97758-69994999999999986


No 275
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli}
Probab=80.92  E-value=2.8  Score=20.56  Aligned_cols=61  Identities=18%  Similarity=0.192  Sum_probs=50.9

Q ss_pred             HHHHHHHHHHC-CCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHCCC
Q ss_conf             89999999852-89988899868885179999998098169997289999999999963056
Q gi|254780466|r  210 EALLSRILVSS-TKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQP  270 (375)
Q Consensus       210 ~~LleriI~~~-S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~~  270 (375)
                      ..+.-+++.+. -.+||.||+-=+|||-..++.-++...-+.+|.+++-.+.+.+++++...
T Consensus        63 P~~~A~~l~~L~~~~g~~VLeIGsGtGY~tAlla~l~~~v~~ve~~~~~~~~a~~~~~~~~~  124 (210)
T 3lbf_A           63 PYMVARMTELLELTPQSRVLEIGTGSGYQTAILAHLVQHVCSVERIKGLQWQARRRLKNLDL  124 (210)
T ss_dssp             HHHHHHHHHHTTCCTTCEEEEECCTTSHHHHHHHHHSSEEEEEESCHHHHHHHHHHHHHTTC
T ss_pred             CHHHHHHHHHCCCCCCCEEEEECCCHHHHHHHHHHHHCEECCCCCCHHHHHHHHHHHHHHCC
T ss_conf             36747678756568998799967840699999998628325454222899999999886266


No 276
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 1f3l_A*
Probab=80.83  E-value=0.35  Score=26.04  Aligned_cols=25  Identities=36%  Similarity=0.499  Sum_probs=10.0

Q ss_pred             EECCCHHHHHHHCCCCCCCEEEECCCC
Q ss_conf             851725998972841471189847787
Q gi|254780466|r   23 IIKGNSISVLEKLPAKSVDLIFADPPY   49 (375)
Q Consensus        23 I~~GDcl~~l~~Lpd~sVDlI~tDPPY   49 (375)
                      +++||..++  .++++++|+|++.+..
T Consensus       117 ~i~~d~~~l--~~~~~~~D~ivse~~~  141 (340)
T 2fyt_A          117 LIKGKIEEV--HLPVEKVDVIISEWMG  141 (340)
T ss_dssp             EEESCTTTS--CCSCSCEEEEEECCCB
T ss_pred             EEEEEHHHC--CCCCCCCCEEEEECCC
T ss_conf             898148876--4764667689996321


No 277
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str}
Probab=80.38  E-value=0.48  Score=25.19  Aligned_cols=20  Identities=15%  Similarity=0.041  Sum_probs=15.2

Q ss_pred             HHHHHHHHHHCCCCCEEEEE
Q ss_conf             99999999863968729998
Q gi|254780466|r   86 RAWLLACRRVLKPNGTLWVI  105 (375)
Q Consensus        86 ~~wl~e~~RvLK~~Gsi~v~  105 (375)
                      ...+.+++|+|||+|.+.+.
T Consensus       125 ~~~l~~i~r~LkpgG~lv~~  144 (253)
T 3g5l_A          125 DDICKKVYINLKSSGSFIFS  144 (253)
T ss_dssp             HHHHHHHHHHEEEEEEEEEE
T ss_pred             HHHHHHHHHHCCCCCEEEEE
T ss_conf             99999999974889489999


No 278
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer, dimer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6
Probab=77.50  E-value=0.37  Score=25.88  Aligned_cols=46  Identities=26%  Similarity=0.372  Sum_probs=32.0

Q ss_pred             CCCCEEEECCCCCHHHHHHHHHHC-CEEEEEEECHHHHHHHHHHHHHC
Q ss_conf             998889986888517999999809-81699972899999999999630
Q gi|254780466|r  222 KPGDIILDPFFGSGTSGAVAKKLR-RSFIGIEMKQDYIDIATKRIASV  268 (375)
Q Consensus       222 ~~gDiVLDPF~GSGTT~~aA~~lg-R~~IGiE~~~~Y~~~a~~Rl~~~  268 (375)
                      .+|..|||--||+|..+..|.+.| ++-+++|.++ .+..|+++++.-
T Consensus        37 ~~~~~VLDiGcGtG~ls~~aa~~Ga~~V~a~d~s~-~~~~a~~~~~~~   83 (328)
T 1g6q_1           37 FKDKIVLDVGCGTGILSMFAAKHGAKHVIGVDMSS-IIEMAKELVELN   83 (328)
T ss_dssp             HTTCEEEEETCTTSHHHHHHHHTCCSEEEEEESST-HHHHHHHHHHHT
T ss_pred             CCCCEEEEECCCCCHHHHHHHHCCCCEEEEEECHH-HHHHHHHHHHHC
T ss_conf             69799999789977999999971999899995979-999999999873


No 279
>3ndi_A Methyltransferase; S-adenosylmethionine, kijanose, tetronitrose, tetradeoxysuga micromonospora chalcea, TCAB9, SUGA methylation; HET: SAM TMP; 1.50A {Micromonospora chalcea} PDB: 3ndj_A*
Probab=77.47  E-value=3.5  Score=19.91  Aligned_cols=30  Identities=0%  Similarity=-0.098  Sum_probs=14.0

Q ss_pred             CCCCCCEEEECCCCCHHHHHHHHHHCCEEE
Q ss_conf             289988899868885179999998098169
Q gi|254780466|r  220 STKPGDIILDPFFGSGTSGAVAKKLRRSFI  249 (375)
Q Consensus       220 ~S~~gDiVLDPF~GSGTT~~aA~~lgR~~I  249 (375)
                      ..+.+-+++=--++.|+|......++.+.|
T Consensus       316 ~~~~~~i~~~GA~~~~~~ll~~~~l~~~~I  345 (416)
T 3ndi_A          316 RAEGRSVVGYGATAKSATVTNFCGIGPDLV  345 (416)
T ss_dssp             HHTTCCEEEECCCSHHHHHHHHHTCCTTTS
T ss_pred             HHCCCCEEEECCCHHHHHHHHHHCCCCCCC
T ss_conf             974991589704517899999818871025


No 280
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP}
Probab=76.49  E-value=3.8  Score=19.74  Aligned_cols=60  Identities=12%  Similarity=0.084  Sum_probs=46.9

Q ss_pred             HHHHHHHHHHCCCCCCEEEECCCCCHHHHHH-HHHHCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             8999999985289988899868885179999-99809816999728999999999996305
Q gi|254780466|r  210 EALLSRILVSSTKPGDIILDPFFGSGTSGAV-AKKLRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       210 ~~LleriI~~~S~~gDiVLDPF~GSGTT~~a-A~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      -.|+..++.+.-.+.=+-+=.|.|-.|...| |..-+-+.+.||.++++.++|++-+++.-
T Consensus        61 g~~L~~L~~~~~ak~iLEiGT~~GyStl~lA~al~~~g~v~tiE~~~~~~~~A~~~~~~ag  121 (232)
T 3cbg_A           61 AQFLGLLISLTGAKQVLEIGVFRGYSALAMALQLPPDGQIIACDQDPNATAIAKKYWQKAG  121 (232)
T ss_dssp             HHHHHHHHHHHTCCEEEEECCTTSHHHHHHHTTSCTTCEEEEEESCHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHHHHHCC
T ss_conf             9999999997499789998434389999999858998589999767414899999999869


No 281
>3me5_A Cytosine-specific methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.75A {Shigella flexneri 2A} PDB: 3lx6_A
Probab=74.55  E-value=4  Score=19.59  Aligned_cols=28  Identities=11%  Similarity=0.107  Sum_probs=19.0

Q ss_pred             CEECCCHHHHHHHCC---------------CCCCCEEEECCCC
Q ss_conf             085172599897284---------------1471189847787
Q gi|254780466|r   22 KIIKGNSISVLEKLP---------------AKSVDLIFADPPY   49 (375)
Q Consensus        22 kI~~GDcl~~l~~Lp---------------d~sVDlI~tDPPY   49 (375)
                      ..++||+.++...-.               -..||+++..||=
T Consensus       137 ~~~~~Di~~i~~~~~~~~~~~~~~~~~~~~~p~vDvl~gGpPC  179 (482)
T 3me5_A          137 HHFNEDIRDITLSHQEGVSDEAAAEHIRQHIPEHDVLLAGFPC  179 (482)
T ss_dssp             CEEESCTHHHHCTTCTTSCHHHHHHHHHHHSCCCSEEEEECCC
T ss_pred             CEECCCHHHCCHHHCCCCCCCHHHHHHHCCCCCCCEEEECCCC
T ss_conf             3635647656610101222101233321138877879977998


No 282
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1
Probab=72.96  E-value=4.6  Score=19.20  Aligned_cols=59  Identities=14%  Similarity=0.116  Sum_probs=41.2

Q ss_pred             HHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHH--CCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             89999999852899888998688851799999980--9816999728999999999996305
Q gi|254780466|r  210 EALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKL--RRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       210 ~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~l--gR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      -.|+..++...-.+.=+-+-.|.|-.|... |..+  +=+.+.+|.++++.+.|++.+++..
T Consensus        58 g~lL~~l~~~~~~k~vLEiGt~~GySal~l-A~al~~~g~v~tie~~~~~~~~Ar~~~~~ag  118 (229)
T 2avd_A           58 AQLLANLARLIQAKKALDLGTFTGYSALAL-ALALPADGRVVTCEVDAQPPELGRPLWRQAE  118 (229)
T ss_dssp             HHHHHHHHHHTTCCEEEEECCTTSHHHHHH-HTTSCTTCEEEEEESCSHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHHCCCEEEEEECCCCHHHHHH-HHCCCCCCEEEEEECCHHHHHHHHHHHHHCC
T ss_conf             999999998649978999844468999999-9437999789999574659999999999769


No 283
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A*
Probab=72.83  E-value=4.7  Score=19.18  Aligned_cols=45  Identities=18%  Similarity=0.058  Sum_probs=24.6

Q ss_pred             EEEECCCCCHHHHH-HHHHH-------CCEEEEEEECHHHHHHHHHHHHHCCC
Q ss_conf             89986888517999-99980-------98169997289999999999963056
Q gi|254780466|r  226 IILDPFFGSGTSGA-VAKKL-------RRSFIGIEMKQDYIDIATKRIASVQP  270 (375)
Q Consensus       226 iVLDPF~GSGTT~~-aA~~l-------gR~~IGiE~~~~Y~~~a~~Rl~~~~~  270 (375)
                      -|||-=||+|++.. .+..+       +-+++|+|.+++.++.|++++++...
T Consensus        55 ~VLdiGcG~G~~~~~il~~l~~~~~~~~~~~~~vD~s~~~l~~ak~~~~~~~~  107 (292)
T 2aot_A           55 KILSIGGGAGEIDLQILSKVQAQYPGVCINNEVVEPSAEQIAKYKELVAKTSN  107 (292)
T ss_dssp             EEEEETCTTSHHHHHHHHHHHHHSTTCEEEEEEECSCHHHHHHHHHHHHTCSS
T ss_pred             EEEEECCCCCHHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHHHHHHHHC
T ss_conf             69998797997789999988874478777599998988999999999887413


No 284
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; HET: MSE; 1.90A {Bacillus halodurans c-125}
Probab=71.14  E-value=5.1  Score=18.94  Aligned_cols=63  Identities=21%  Similarity=0.196  Sum_probs=42.6

Q ss_pred             CCCCCH--HHHHHHHHHCCCCCCEEEECCCCCHHHH-HHHHHHC-CEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             877818--9999999852899888998688851799-9999809-816999728999999999996305
Q gi|254780466|r  205 PTQKPE--ALLSRILVSSTKPGDIILDPFFGSGTSG-AVAKKLR-RSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       205 PTqKP~--~LleriI~~~S~~gDiVLDPF~GSGTT~-~aA~~lg-R~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      |...|+  .++..++..  .+...||+-=+|+|.++ ..|..+. -+.++||.++++++.|++++++.-
T Consensus        36 pii~~~~~~~l~~l~~~--~~~~~VLEIGtg~G~Stl~la~~~p~~~v~tiD~~~~~~~~A~~~~~~~g  102 (233)
T 2gpy_A           36 PIMDLLGMESLLHLLKM--AAPARILEIGTAIGYSAIRMAQALPEATIVSIERDERRYEEAHKHVKALG  102 (233)
T ss_dssp             CCCCHHHHHHHHHHHHH--HCCSEEEEECCTTSHHHHHHHHHCTTCEEEEECCCHHHHHHHHHHHHHTT
T ss_pred             CCCCHHHHHHHHHHHHH--HCCCEEEEEECCCCHHHHHHHHHCCCCEEEEEEECHHHHHHHHHHHHHHH
T ss_conf             97788999999999886--58998999611212999999987899779999704899999999999974


No 285
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, MFE-1, fatty acid beta oxidation, oxidoreductase; 1.90A {Rattus norvegicus}
Probab=67.04  E-value=2.3  Score=21.09  Aligned_cols=40  Identities=20%  Similarity=0.091  Sum_probs=18.1

Q ss_pred             CHHHHHHHHHHCCCCCCEEEEC-CCCCHHHHHHHHHHCCEE
Q ss_conf             1899999998528998889986-888517999999809816
Q gi|254780466|r  209 PEALLSRILVSSTKPGDIILDP-FFGSGTSGAVAKKLRRSF  248 (375)
Q Consensus       209 P~~LleriI~~~S~~gDiVLDP-F~GSGTT~~aA~~lgR~~  248 (375)
                      ..++.+|++...-++.-.+|+. -+-+-...=.|.++|-.|
T Consensus       356 ~~~i~~R~l~~~vnea~~~l~e~Ia~~~~dID~am~~G~G~  396 (463)
T 1zcj_A          356 KEEILERCLYSLINEAFRILEEGMAARPEHIDVIYLHGYGW  396 (463)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHTTSBSCHHHHHHHHHHHSCC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHCCCCC
T ss_conf             89999999999999999987607579989999999828899


No 286
>1p3d_A UDP-N-acetylmuramate--alanine ligase; alpha/beta protein; HET: UMA ANP; 1.70A {Haemophilus influenzae} SCOP: c.5.1.1 c.59.1.1 c.72.2.1 PDB: 1gqq_A* 1p31_A* 1gqy_A*
Probab=65.97  E-value=4.1  Score=19.49  Aligned_cols=34  Identities=18%  Similarity=0.127  Sum_probs=20.1

Q ss_pred             CCEEEECCCCCHHHHHHHHHH------CCEEEEEEECHHH
Q ss_conf             888998688851799999980------9816999728999
Q gi|254780466|r  224 GDIILDPFFGSGTSGAVAKKL------RRSFIGIEMKQDY  257 (375)
Q Consensus       224 gDiVLDPF~GSGTT~~aA~~l------gR~~IGiE~~~~Y  257 (375)
                      +-+|.|-|+-+.|...||...      +|+-|.+-....+
T Consensus       339 ~~~iiDDya~~p~si~a~l~al~~~~~~~~ii~i~~~~~~  378 (475)
T 1p3d_A          339 KVRLVDDYGHHPTEVGVTIKAAREGWGDKRIVMIFQPHRY  378 (475)
T ss_dssp             EEEEEEECCCSHHHHHHHHHHHHHHHCSSCEEEEECCBCH
T ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEEECCCCC
T ss_conf             7899976788979999999999865699769999547777


No 287
>1tk9_A Phosphoheptose isomerase 1; lipopolysaccharide biosynthesis, structural genomics, NYSGXRC, LPC1_camje, PSI, protein structure initiative; 2.10A {Campylobacter jejuni} SCOP: c.80.1.3
Probab=63.67  E-value=6.7  Score=18.22  Aligned_cols=46  Identities=26%  Similarity=0.271  Sum_probs=36.4

Q ss_pred             CHHHHHHHHHHCCCCCCEEEECCCCCHHHH------HHHHHHCCEEEEEEECH
Q ss_conf             189999999852899888998688851799------99998098169997289
Q gi|254780466|r  209 PEALLSRILVSSTKPGDIILDPFFGSGTSG------AVAKKLRRSFIGIEMKQ  255 (375)
Q Consensus       209 P~~LleriI~~~S~~gDiVLDPF~GSGTT~------~aA~~lgR~~IGiE~~~  255 (375)
                      .+++..|-+++..++||+++ .|.+||.|.      .+|++.|-+-|++--.+
T Consensus        96 ~~~~f~~ql~~~~~~gDvlI-~iS~SG~s~nii~a~~~Ak~~g~~~i~ltg~~  147 (188)
T 1tk9_A           96 FEFVFSRQVEALGNEKDVLI-GISTSGKSPNVLEALKKAKELNMLCLGLSGKG  147 (188)
T ss_dssp             GGGHHHHHHHHHCCTTCEEE-EECSSSCCHHHHHHHHHHHHTTCEEEEEEEGG
T ss_pred             HHHHHHHHHHHHCCCCCEEE-EEECCCCCCCHHHHHHHHHHCCCEEEEEECCC
T ss_conf             89999999998378999899-98289999557789999998799899995789


No 288
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum}
Probab=61.65  E-value=7.9  Score=17.80  Aligned_cols=62  Identities=18%  Similarity=0.177  Sum_probs=42.7

Q ss_pred             CCCH--HHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHH--CCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             7818--9999999852899888998688851799999980--9816999728999999999996305
Q gi|254780466|r  207 QKPE--ALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKL--RRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       207 qKP~--~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~l--gR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      .-|+  .|+..++.+.-.+.=+-+-.|.|-. |...|+.+  +-+-+.+|.++++.+.|++.+++..
T Consensus        54 ~~p~~g~lL~~L~~~~~~k~vLEiGT~~GyS-tl~la~al~~~g~v~tie~~~~~~~~A~~~~~~ag  119 (237)
T 3c3y_A           54 TSPLAGQLMSFVLKLVNAKKTIEVGVFTGYS-LLLTALSIPDDGKITAIDFDREAYEIGLPFIRKAG  119 (237)
T ss_dssp             CCHHHHHHHHHHHHHTTCCEEEEECCTTSHH-HHHHHHHSCTTCEEEEEESCHHHHHHHHHHHHHTT
T ss_pred             CCHHHHHHHHHHHHHHCCCEEEEEECCCCHH-HHHHHHHCCCCCEEEEEEECHHHHHHHHHHHHHCC
T ss_conf             6999999999999973998899970525789-99999748998489999602676899999999849


No 289
>2q5c_A NTRC family transcriptional regulator; structural genomics, PSI-2, protein structure initiative; HET: SO4 GOL; 1.49A {Clostridium acetobutylicum atcc 824}
Probab=60.75  E-value=5.6  Score=18.69  Aligned_cols=60  Identities=10%  Similarity=-0.026  Sum_probs=41.4

Q ss_pred             CCCCCCHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHH
Q ss_conf             6877818999999985289988899868885179999998098169997289999999999963
Q gi|254780466|r  204 HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIAS  267 (375)
Q Consensus       204 HPTqKP~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~  267 (375)
                      ++...+.++...+ +.....|   .|-+.|.++|.-.|+++|-+++-++.+++.+..|.+.=.+
T Consensus       123 ~~~~~~~e~~~~i-~~l~~~G---~~vvVG~~~~~~~A~~~Gl~~ili~Sg~eSI~~Al~eA~~  182 (196)
T 2q5c_A          123 FLFSSEDEITTLI-SKVKTEN---IKIVVSGKTVTDEAIKQGLYGETINSGEESLRRAIEEALN  182 (196)
T ss_dssp             EEECSGGGHHHHH-HHHHHTT---CCEEEECHHHHHHHHHTTCEEEECCCCHHHHHHHHHHHHH
T ss_pred             EEECCHHHHHHHH-HHHHHCC---CCEEECCHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHH
T ss_conf             9966889999999-9999869---9899998799999998599789996549999999999999


No 290
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24
Probab=60.12  E-value=0.36  Score=25.93  Aligned_cols=28  Identities=25%  Similarity=0.502  Sum_probs=20.0

Q ss_pred             CEECCCHHHHHHHCCCCCCCEEEECCCCCC
Q ss_conf             085172599897284147118984778761
Q gi|254780466|r   22 KIIKGNSISVLEKLPAKSVDLIFADPPYNL   51 (375)
Q Consensus        22 kI~~GDcl~~l~~Lpd~sVDlI~tDPPYni   51 (375)
                      .|++||.+++  .+|+..-..|+.--|||+
T Consensus        78 ~ii~~D~l~~--~~~~~~~~~vv~NLPY~I  105 (245)
T 1yub_A           78 TLIHQDILQF--QFPNKQRYKIVGNIPYHL  105 (245)
T ss_dssp             EECCSCCTTT--TCCCSSEEEEEEECCSSS
T ss_pred             HHHHCCHHCC--CCCCCCCEEEEECCCHHH
T ss_conf             0220110001--444578656871675787


No 291
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38
Probab=57.79  E-value=9.2  Score=17.39  Aligned_cols=51  Identities=16%  Similarity=0.313  Sum_probs=39.7

Q ss_pred             CCCCCCEEEECCCCCHHHH-HHHHHHCC--EEEEEEECHHHHHHHHHHHHHCCC
Q ss_conf             2899888998688851799-99998098--169997289999999999963056
Q gi|254780466|r  220 STKPGDIILDPFFGSGTSG-AVAKKLRR--SFIGIEMKQDYIDIATKRIASVQP  270 (375)
Q Consensus       220 ~S~~gDiVLDPF~GSGTT~-~aA~~lgR--~~IGiE~~~~Y~~~a~~Rl~~~~~  270 (375)
                      --.+|+.|||..++-|+-. ..|..++.  .-+.+|+++.-++....+++....
T Consensus       115 ~~~~g~~vLD~CAaPGgKt~~l~~~~~~~g~i~a~d~~~~R~~~l~~~l~r~g~  168 (315)
T 1ixk_A          115 DPKPGEIVADMAAAPGGKTSYLAQLMRNDGVIYAFDVDENRLRETRLNLSRLGV  168 (315)
T ss_dssp             CCCTTCEEEECCSSCSHHHHHHHHHTTTCSEEEEECSCHHHHHHHHHHHHHHTC
T ss_pred             CCCCCCEEEECCCCCHHHHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHHCCC
T ss_conf             899999288957771144665333126884478410788999999999987187


No 292
>1i4w_A Mitochondrial replication protein MTF1; mitochondrial transcription factor, transcription initiation; 2.60A {Saccharomyces cerevisiae} SCOP: c.66.1.24
Probab=55.74  E-value=9.9  Score=17.18  Aligned_cols=11  Identities=9%  Similarity=0.229  Sum_probs=3.4

Q ss_pred             EEEEEEECHHH
Q ss_conf             16999728999
Q gi|254780466|r  247 SFIGIEMKQDY  257 (375)
Q Consensus       247 ~~IGiE~~~~Y  257 (375)
                      +-|.+|.|+.+
T Consensus        84 ~~i~iE~D~~~   94 (353)
T 1i4w_A           84 QYSLLEKRSSL   94 (353)
T ss_dssp             EEEEECCCHHH
T ss_pred             EEEEEECCHHH
T ss_conf             69999777889


No 293
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCNACYLATION; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2vsn_A*
Probab=55.72  E-value=6.8  Score=18.19  Aligned_cols=30  Identities=17%  Similarity=0.138  Sum_probs=22.4

Q ss_pred             CCCCEEEECCC-CCHHHHHHHHHHCCEEEEE
Q ss_conf             99888998688-8517999999809816999
Q gi|254780466|r  222 KPGDIILDPFF-GSGTSGAVAKKLRRSFIGI  251 (375)
Q Consensus       222 ~~gDiVLDPF~-GSGTT~~aA~~lgR~~IGi  251 (375)
                      ..-||+||||- |.|||..-|.-+|---|..
T Consensus       452 ~~~Di~LDtfp~~g~tt~~eal~~GvPvvTl  482 (568)
T 2vsy_A          452 RHADLFLDTHPYNAHTTASDALWTGCPVLTT  482 (568)
T ss_dssp             GGCSEEECCSSSCCSHHHHHHHHTTCCEEBC
T ss_pred             HCCCEEEECCCCCCHHHHHHHHHCCCCEEEC
T ss_conf             3586898598979758799999779998977


No 294
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii OT3}
Probab=53.34  E-value=11  Score=16.95  Aligned_cols=51  Identities=12%  Similarity=0.240  Sum_probs=39.4

Q ss_pred             HCCCCCCEEEECCCCCHHHH-HHHHHH--CCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             52899888998688851799-999980--9816999728999999999996305
Q gi|254780466|r  219 SSTKPGDIILDPFFGSGTSG-AVAKKL--RRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       219 ~~S~~gDiVLDPF~GSGTT~-~aA~~l--gR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      ....+|+.|||..+|-|.-. ..|..+  ...-+.+|+++.-++...+|+....
T Consensus       255 L~~~~g~~VLD~CAaPGGKT~~la~~~~~~~~i~a~d~~~~rl~~l~~~l~r~g  308 (450)
T 2yxl_A          255 LDPKPGETVVDLAAAPGGKTTHLAELMKNKGKIYAFDVDKMRMKRLKDFVKRMG  308 (450)
T ss_dssp             HCCCTTCEEEESSCTTCHHHHHHHHHTTTCSEEEEECSCHHHHHHHHHHHHHTT
T ss_pred             HCCCCCCEEEEECCCCCHHHHHHHHHHHHCCCEEECCCCHHHHHHHHHHHHHHC
T ss_conf             345789858750688657999999986513850311254877877899999708


No 295
>2wk1_A NOVP; transferase, O-methyltransferase, novobiocin, TYLF superfamily; HET: SAH; 1.40A {Streptomyces caeruleus}
Probab=52.60  E-value=10  Score=17.11  Aligned_cols=33  Identities=15%  Similarity=0.250  Sum_probs=17.3

Q ss_pred             HHHHHHCCC--CCEEEEECCHHH--HHHHHHHHHHCC
Q ss_conf             999986396--872999834688--899998764057
Q gi|254780466|r   90 LACRRVLKP--NGTLWVIGSYHN--IFRIGTMLQNLN  122 (375)
Q Consensus        90 ~e~~RvLK~--~Gsi~v~~~~~~--i~~i~~~l~~~g  122 (375)
                      ..+..|+++  .|.|.=+|.|+-  ...+..+++..+
T Consensus        96 ~~~~~i~~~~I~GdIVEiGV~rG~S~~~~a~~l~~~~  132 (282)
T 2wk1_A           96 QCVEDVIGNNVPGDLVETGVWRGGACILMRGILRAHD  132 (282)
T ss_dssp             HHHHHHHHTTCCCEEEEECCTTSHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHCCCCEEEEEEECCCCHHHHHHHHHHHHCC
T ss_conf             9999999739981299986878768999999999729


No 296
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ...
Probab=52.55  E-value=11  Score=16.87  Aligned_cols=59  Identities=8%  Similarity=-0.001  Sum_probs=41.6

Q ss_pred             HHHHHHHHHCCCCCCEEEECCCCCHHHH-HHHHHHCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             9999999852899888998688851799-9999809816999728999999999996305
Q gi|254780466|r  211 ALLSRILVSSTKPGDIILDPFFGSGTSG-AVAKKLRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       211 ~LleriI~~~S~~gDiVLDPF~GSGTT~-~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      .-+.++.......|+.|||-=+|+|.-. .+|..--++-+++|.++.-++.+++.+++..
T Consensus        59 ~~l~~~~~~g~~~G~~lLDvG~Gpgi~~~l~a~~~~~~I~~~D~s~~~~~~~~kw~~~~~  118 (289)
T 2g72_A           59 RCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEP  118 (289)
T ss_dssp             HHHHHHHHTSCSCCSEEEEETCTTCCGGGTTGGGGCSEEEEECSCHHHHHHHHHHHTTCT
T ss_pred             HHHHHHHCCCCCCCCEEEEECCCCCHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHCCC
T ss_conf             999998578887898899957471367888756467814885498999999998875287


No 297
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2
Probab=51.77  E-value=12  Score=16.79  Aligned_cols=11  Identities=9%  Similarity=0.244  Sum_probs=5.5

Q ss_pred             CHHHHHHHHHH
Q ss_conf             18999999985
Q gi|254780466|r  209 PEALLSRILVS  219 (375)
Q Consensus       209 P~~LleriI~~  219 (375)
                      |+++.+.||..
T Consensus       159 ~eei~~~Ii~~  169 (173)
T 1kag_A          159 AKVVANQIIHM  169 (173)
T ss_dssp             HHHHHHHHHHH
T ss_pred             HHHHHHHHHHH
T ss_conf             99999999999


No 298
>2f00_A UDP-N-acetylmuramate--L-alanine ligase; amide bond ligase, ATPase, bacterial cell WALL; 2.50A {Escherichia coli}
Probab=51.62  E-value=6.7  Score=18.22  Aligned_cols=31  Identities=10%  Similarity=0.068  Sum_probs=20.3

Q ss_pred             CCEEEECCCCCHHHHHHHHHH-------CCEEEEEEEC
Q ss_conf             888998688851799999980-------9816999728
Q gi|254780466|r  224 GDIILDPFFGSGTSGAVAKKL-------RRSFIGIEMK  254 (375)
Q Consensus       224 gDiVLDPF~GSGTT~~aA~~l-------gR~~IGiE~~  254 (375)
                      +.+|.|-|+-.-+...|+.+.       +|..++++.+
T Consensus       345 ~~~i~DdyahnP~si~a~l~al~~~~~~~~ii~i~~~~  382 (491)
T 2f00_A          345 TAMLVDDYGHHPTEVDATIKAARAGWPDKNLVMLFQPH  382 (491)
T ss_dssp             EEEEEEECCCSHHHHHHHHHHHHTTCCSSEEEEEECCB
T ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEEECCC
T ss_conf             78999846789589999999999658997699997677


No 299
>2e55_A Uracil phosphoribosyltransferase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.15A {Aquifex aeolicus}
Probab=51.02  E-value=12  Score=16.72  Aligned_cols=43  Identities=16%  Similarity=0.201  Sum_probs=28.5

Q ss_pred             CCCEEEECCCCCHHHHHHHHHH-------CCEEEEEEECHHHHHHHHHHH
Q ss_conf             9888998688851799999980-------981699972899999999999
Q gi|254780466|r  223 PGDIILDPFFGSGTSGAVAKKL-------RRSFIGIEMKQDYIDIATKRI  265 (375)
Q Consensus       223 ~gDiVLDPF~GSGTT~~aA~~l-------gR~~IGiE~~~~Y~~~a~~Rl  265 (375)
                      .--++|||..+||.|+.+|.+.       +-.++.+-..++-++...++.
T Consensus       122 ~~vlllDPmlATG~s~~~ai~~L~~~g~~~I~~v~~iaa~~Gl~~l~~~~  171 (208)
T 2e55_A          122 KIVVILDPMLATGGTLEVALREILKHSPLKVKSVHAIAAPEGLKRIEEKF  171 (208)
T ss_dssp             SEEEEECSEESSSHHHHHHHHHHHTTCBSEEEEEEEEECHHHHHHHHHHC
T ss_pred             CCEEEECHHHCCCCHHHHHHHHHHHCCCCEEEEEEEEECHHHHHHHHHHC
T ss_conf             70698346761571599999999844886179999982599999999878


No 300
>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, antibiotic resistance, methyltransferase; 1.44A {Aquifex aeolicus VF5} PDB: 3ftc_A 3fte_A 3ftf_A*
Probab=50.29  E-value=12  Score=16.65  Aligned_cols=31  Identities=13%  Similarity=0.088  Sum_probs=18.5

Q ss_pred             CCEECCCHHHHHHHCCCCCCCEEEECCCCCCC
Q ss_conf             70851725998972841471189847787615
Q gi|254780466|r   21 DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQ   52 (375)
Q Consensus        21 nkI~~GDcl~~l~~Lpd~sVDlI~tDPPYni~   52 (375)
                      -.|+++|.++.--..+ +.-..|+.-.|||+.
T Consensus        78 ~~ii~~D~l~~~~~~~-~~~~~vVgNLPY~Is  108 (249)
T 3ftd_A           78 LEVINEDASKFPFCSL-GKELKVVGNLPYNVA  108 (249)
T ss_dssp             EEEECSCTTTCCGGGS-CSSEEEEEECCTTTH
T ss_pred             EEEEECCHHHCCHHHC-CCCCEEEECCCHHHH
T ss_conf             2899634011786462-976258614421041


No 301
>3dmp_A Uracil phosphoribosyltransferase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.60A {Burkholderia pseudomallei}
Probab=49.62  E-value=6  Score=18.51  Aligned_cols=44  Identities=18%  Similarity=0.255  Sum_probs=29.1

Q ss_pred             CCCCCEEEECCCCCHHHHHHHHHH----C---C--EEEEEEECHHHHHHHHHH
Q ss_conf             899888998688851799999980----9---8--169997289999999999
Q gi|254780466|r  221 TKPGDIILDPFFGSGTSGAVAKKL----R---R--SFIGIEMKQDYIDIATKR  264 (375)
Q Consensus       221 S~~gDiVLDPF~GSGTT~~aA~~l----g---R--~~IGiE~~~~Y~~~a~~R  264 (375)
                      ....-++|||..+||.|+.+|.+.    |   +  .++.+=..++.++...++
T Consensus       128 ~~~~villDPmlATG~s~~~ai~~L~~~Gv~~~~I~~v~~iaa~~Gi~~i~~~  180 (217)
T 3dmp_A          128 EDRIFILCDPMVATGYSAAHAIDVLKRRGVPGERLMFLALVAAPEGVQVFQDA  180 (217)
T ss_dssp             TTCEEEEECSEESSSHHHHHHHHHHHTTTCCGGGEEEECSEECHHHHHHHHHH
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHCCCCCCEEEEEEEEECHHHHHHHHHH
T ss_conf             44609999440257757999999999849984528999987547999999987


No 302
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, shikimate pathway, nucleotide-binding, amino-acid biosynthesis; 2.10A {Aquifex aeolicus VF5}
Probab=48.65  E-value=13  Score=16.49  Aligned_cols=12  Identities=42%  Similarity=0.742  Sum_probs=6.2

Q ss_pred             CCHHHHHHHHHH
Q ss_conf             818999999985
Q gi|254780466|r  208 KPEALLSRILVS  219 (375)
Q Consensus       208 KP~~LleriI~~  219 (375)
                      .|+++.+.||..
T Consensus       149 ~~eeiv~~Il~~  160 (168)
T 2pt5_A          149 PPEEVVKEILLS  160 (168)
T ss_dssp             CHHHHHHHHHHH
T ss_pred             CHHHHHHHHHHH
T ss_conf             999999999999


No 303
>3gi1_A LBP, laminin-binding protein of group A streptococci; zinc-binding receptor, metal-binding, helical backbone, alpha/beta domains; 2.45A {Streptococcus pyogenes} PDB: 3hjt_A
Probab=46.41  E-value=9.8  Score=17.23  Aligned_cols=63  Identities=10%  Similarity=0.149  Sum_probs=31.1

Q ss_pred             CCCCCHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEE-------CHHHHHHHHHHHHHC
Q ss_conf             8778189999999852899888998688851799999980981699972-------899999999999630
Q gi|254780466|r  205 PTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEM-------KQDYIDIATKRIASV  268 (375)
Q Consensus       205 PTqKP~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~-------~~~Y~~~a~~Rl~~~  268 (375)
                      |+.+=+.-+...|+.. +..-++.+|...+-+.-..|+.+|=+.+-++.       ...|+++-++-++.+
T Consensus       212 ps~~~l~~l~~~ik~~-~i~~if~e~~~~~~~~~~la~~~g~~v~~ld~l~~~~~~~~~Y~~~m~~n~~~i  281 (286)
T 3gi1_A          212 PSPRQLKEIQDFVKEY-NVKTIFAEDNVNPKIAHAIAKSTGAKVKTLSPLEAAPSGNKTYLENLRANLEVL  281 (286)
T ss_dssp             CCHHHHHHHHHHHHHT-TCCEEEECTTSCTHHHHHHHHTTTCEEEECCCSCSCCSSSCCHHHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHC-CCCEEEEECCCCHHHHHHHHHHHCCCEEEECCCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             9877899999999975-998999848889199999999829976885777678888677999999999999


No 304
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A*
Probab=43.85  E-value=10  Score=17.16  Aligned_cols=20  Identities=25%  Similarity=0.386  Sum_probs=10.6

Q ss_pred             HHHHHHCCCCCEEEEECCHHH
Q ss_conf             999986396872999834688
Q gi|254780466|r   90 LACRRVLKPNGTLWVIGSYHN  110 (375)
Q Consensus        90 ~e~~RvLK~~Gsi~v~~~~~~  110 (375)
                      .+...-+|| -+|.=+|.++-
T Consensus        74 qeli~~~KP-k~ILEIG~~~G   93 (236)
T 2bm8_A           74 HDMLWELRP-RTIVELGVYNG   93 (236)
T ss_dssp             HHHHHHHCC-SEEEEECCTTS
T ss_pred             HHHHHHHCC-CEEEEEECCCC
T ss_conf             999998597-98999738808


No 305
>1xtt_A Probable uracil phosphoribosyltransferase; tetramer, type 1 phosphoribosyltransferase, UMP complex; HET: U5P; 1.80A {Sulfolobus solfataricus} SCOP: c.61.1.1 PDB: 1vst_A* 1xtu_A* 1xtv_A* 3g6w_A*
Probab=42.95  E-value=13  Score=16.41  Aligned_cols=42  Identities=14%  Similarity=0.143  Sum_probs=27.1

Q ss_pred             CCCEEEECCCCCHHHHHHHHHH-------CCEEEEEEECHHHHHHHHHH
Q ss_conf             9888998688851799999980-------98169997289999999999
Q gi|254780466|r  223 PGDIILDPFFGSGTSGAVAKKL-------RRSFIGIEMKQDYIDIATKR  264 (375)
Q Consensus       223 ~gDiVLDPF~GSGTT~~aA~~l-------gR~~IGiE~~~~Y~~~a~~R  264 (375)
                      ..-++|||.+.||.|+.+|.+.       .-.++.+=..++.++...++
T Consensus       134 ~~villDPmlATG~s~~~ai~~L~~~g~~~I~~v~~ias~~Gi~~l~~~  182 (216)
T 1xtt_A          134 DNVIIADPMIATASTMLKVLEEVVKANPKRIYIVSIISSEYGVNKILSK  182 (216)
T ss_dssp             CEEEEECSEESSSHHHHHHHHHHGGGCCSEEEEECSEEEHHHHHHHHHH
T ss_pred             CEEEEECHHHHCHHHHHHHHHHHHHCCCCEEEEEEEEECHHHHHHHHHH
T ss_conf             3389727477541889999999874599538999999469999999987


No 306
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=42.65  E-value=16  Score=15.93  Aligned_cols=39  Identities=26%  Similarity=0.325  Sum_probs=29.1

Q ss_pred             CCCHHHHHHHHHHCCCCCCEEEECCCC--------CHHHHHHHHHHC
Q ss_conf             781899999998528998889986888--------517999999809
Q gi|254780466|r  207 QKPEALLSRILVSSTKPGDIILDPFFG--------SGTSGAVAKKLR  245 (375)
Q Consensus       207 qKP~~LleriI~~~S~~gDiVLDPF~G--------SGTT~~aA~~lg  245 (375)
                      .||+.|+..+++..+.-|++||--|.+        .|.++.+|.+++
T Consensus        23 ~FDd~l~~~Llq~l~~~GeviLvRfv~d~mwVTF~dG~SAL~al~~~   69 (91)
T 2dnr_A           23 FFDDALIDELLQQFASFGEVILIRFVEDKMWVTFLEGSSALNVLSLN   69 (91)
T ss_dssp             SCCHHHHHHHHHHHHTTCCEEEEEECSSSEEEEESSHHHHHHGGGGT
T ss_pred             CCCHHHHHHHHHHHHHCCCEEEEEEECCEEEEEECCCHHHHHHHCCC
T ss_conf             58889999999998744828999994883999987778799986046


No 307
>1o5o_A Uracil phosphoribosyltransferase; TM0721, structural genomics, JCSG, PSI, protein structure initiative; HET: U5P; 2.30A {Thermotoga maritima} SCOP: c.61.1.1
Probab=41.81  E-value=9.4  Score=17.33  Aligned_cols=23  Identities=26%  Similarity=0.478  Sum_probs=18.8

Q ss_pred             CCCCEEEECCCCCHHHHHHHHHH
Q ss_conf             99888998688851799999980
Q gi|254780466|r  222 KPGDIILDPFFGSGTSGAVAKKL  244 (375)
Q Consensus       222 ~~gDiVLDPF~GSGTT~~aA~~l  244 (375)
                      ...=+++||..+||.|+.+|.+.
T Consensus       136 ~~~VillDPmlATG~s~~~ai~~  158 (221)
T 1o5o_A          136 DKEVFLLDPMLATGVSSIKAIEI  158 (221)
T ss_dssp             TCEEEEECSEESSSHHHHHHHHH
T ss_pred             CCEEEEEHHHHHCCHHHHHHHHH
T ss_conf             67289877886477129999999


No 308
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A*
Probab=40.82  E-value=17  Score=15.75  Aligned_cols=44  Identities=18%  Similarity=0.049  Sum_probs=36.3

Q ss_pred             CEEEECCCCCHHHHHHHHHH--CCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             88998688851799999980--9816999728999999999996305
Q gi|254780466|r  225 DIILDPFFGSGTSGAVAKKL--RRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       225 DiVLDPF~GSGTT~~aA~~l--gR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      ..|||-=+|+|..+.+..+.  +-+++++|+ ++-++.+.+++....
T Consensus       171 ~~vlDvGgG~G~~~~~l~~~~P~~~~~~~Dl-p~~~~~a~~~~~~~~  216 (332)
T 3i53_A          171 GHVVDVGGGSGGLLSALLTAHEDLSGTVLDL-QGPASAAHRRFLDTG  216 (332)
T ss_dssp             SEEEEETCTTSHHHHHHHHHCTTCEEEEEEC-HHHHHHHHHHHHHTT
T ss_pred             CEEEECCCCCCHHHHHHHHHCCCCEEEEEEC-HHHHHHHHHHHHHCC
T ss_conf             4787528997699999999789986999978-438999998756416


No 309
>1i5e_A Uracil phosphoribosyltransferase; salvage pathway; HET: U5P; 3.00A {Bacillus caldolyticus} SCOP: c.61.1.1
Probab=39.43  E-value=11  Score=16.99  Aligned_cols=42  Identities=19%  Similarity=0.275  Sum_probs=26.8

Q ss_pred             CCCEEEECCCCCHHHHHHHHHH----C---CEEEEEEECHHHHHHHHHH
Q ss_conf             9888998688851799999980----9---8169997289999999999
Q gi|254780466|r  223 PGDIILDPFFGSGTSGAVAKKL----R---RSFIGIEMKQDYIDIATKR  264 (375)
Q Consensus       223 ~gDiVLDPF~GSGTT~~aA~~l----g---R~~IGiE~~~~Y~~~a~~R  264 (375)
                      ..-+++||.+.||.|+.+|.+.    |   -.++.+=..++.++...+.
T Consensus       125 ~~villDPmlATG~s~~~ai~~L~~~G~~~I~~vs~ias~~Gl~~l~~~  173 (209)
T 1i5e_A          125 RDFIIVDPMLATGGSAVAAIDALKKRGAKSIKFMCLIAAPEGVKAVETA  173 (209)
T ss_dssp             SEEEEECSEESSSHHHHHHHHHHHHTTCCCEEEECSEECHHHHHHHHHH
T ss_pred             CEEEEECHHHHCCHHHHHHHHHHHHCCCCCEEEEEEECCHHHHHHHHHH
T ss_conf             8689758688647779999999996699857999985079999999987


No 310
>1bd3_D Uprtase, uracil phosphoribosyltransferase; glycosyltransferase; 1.93A {Toxoplasma gondii} SCOP: c.61.1.1 PDB: 1bd4_D 1jlr_A* 1jls_B* 1upf_D 1upu_D*
Probab=36.01  E-value=13  Score=16.46  Aligned_cols=44  Identities=23%  Similarity=0.270  Sum_probs=30.4

Q ss_pred             CCCEEEECCCCCHHHHHHHHHH----C-----CEEEEEEECHHHHHHHHHHHHHCCC
Q ss_conf             9888998688851799999980----9-----8169997289999999999963056
Q gi|254780466|r  223 PGDIILDPFFGSGTSGAVAKKL----R-----RSFIGIEMKQDYIDIATKRIASVQP  270 (375)
Q Consensus       223 ~gDiVLDPF~GSGTT~~aA~~l----g-----R~~IGiE~~~~Y~~~a~~Rl~~~~~  270 (375)
                      ..-+++||...||.|+++|.+.    |     -.++.+=..++-++    ||.+.-|
T Consensus       157 ~~Vll~DPMLATG~S~~~ai~~L~~~Gv~~~~I~~vsvias~~Gi~----~l~~~~P  209 (243)
T 1bd3_D          157 RWVMLLDPMCATAGSVCKAIEVLLRLGVKEERIIFVNILAAPQGIE----RVFKEYP  209 (243)
T ss_dssp             SEEEEECSEESSCHHHHHHHHHHHHHTCCGGGEEEEEEEECHHHHH----HHHHHCT
T ss_pred             CEEEEECCHHHCCHHHHHHHHHHHHCCCCCCEEEEEEEEECHHHHH----HHHHHCC
T ss_conf             4589868055057229999999997199854079999986589999----9998797


No 311
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5
Probab=33.36  E-value=16  Score=15.97  Aligned_cols=66  Identities=6%  Similarity=0.039  Sum_probs=39.0

Q ss_pred             HCCCCCCCCEEECCC-----CCEEEEECCCCCEEECCEECCHHHHHHHHCCCCCCCCEEEEEEEECCEEEEHHHHHHHHH
Q ss_conf             828658776576689-----806999815981786986531999998744981006711467975995712999999999
Q gi|254780466|r  295 ERGLIQPGQILTNAQ-----GNISATVCADGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVR  369 (375)
Q Consensus       295 e~g~l~~g~~L~~~~-----~~~~a~v~~DG~l~~~~~~gsIh~i~a~~~~~~~cNGw~fw~~~~~~~~~~id~lR~~~r  369 (375)
                      ....++++..++|.-     -.+....++-|.-+.++..+-+||..+.         |.+|.    |...|++.+|+.++
T Consensus       216 ~~~~l~~~~~v~D~vY~P~~T~ll~~A~~~G~~~i~Gl~MLv~Qa~~q---------f~lwt----g~~~~~~~~~~~l~  282 (287)
T 1nvt_A          216 KAEKLREDMVVMDLIYNPLETVLLKEAKKVNAKTINGLGMLIYQGAVA---------FKIWT----GVEPNIEVMKNAII  282 (287)
T ss_dssp             CSTTCCSSSEEEECCCSSSSCHHHHHHHTTTCEEECTHHHHHHHHHHH---------HHHHH----SSCCCHHHHHHHHH
T ss_pred             HHHCCCCCCEEEEEECCCCCCHHHHHHHHCCCEEECCHHHHHHHHHHH---------HHHHH----CCCCCHHHHHHHHH
T ss_conf             233168775899853288788999999987692866699999999999---------99984----89999999999999


Q ss_pred             HHHH
Q ss_conf             8761
Q gi|254780466|r  370 KELY  373 (375)
Q Consensus       370 ~~~~  373 (375)
                      ++|.
T Consensus       283 ~~L~  286 (287)
T 1nvt_A          283 DKIT  286 (287)
T ss_dssp             HHHC
T ss_pred             HHHC
T ss_conf             9854


No 312
>2x58_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, lyase, isomerase, peroxisome; HET: ADP COA; 2.80A {Rattus norvegicus}
Probab=33.01  E-value=16  Score=15.87  Aligned_cols=120  Identities=15%  Similarity=0.261  Sum_probs=65.5

Q ss_pred             CCCCHHHH----HHHHHHCCEEEEEEECHHHHHHHHHHHHHCCCCCHHHHCCCCCCCCCCCCCHHHHHHCCCCCCCCEEE
Q ss_conf             88851799----99998098169997289999999999963056876563024443337755234698828658776576
Q gi|254780466|r  231 FFGSGTSG----AVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILT  306 (375)
Q Consensus       231 F~GSGTT~----~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~~~~~~~~~~~~~~~~~~rvpfg~lie~g~l~~g~~L~  306 (375)
                      -.|+|+.|    .++..-|..-+-.|.+++..+.+.+++.....................++.+....+.  +.--+..+
T Consensus       306 ViGaG~MG~gIA~~~a~~G~~V~l~D~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~--l~~~DlVI  383 (727)
T 2x58_A          306 VLGLGTMGRGIAISFARVGISVVAVESDPKQLDAAKKIITFTLEKEASRAHQNGQASAKPKLRFSSSTKE--LSTVDLVV  383 (727)
T ss_dssp             EECCSHHHHHHHHHHHTTTCEEEEECSSHHHHHHHHHHHHHHHHHHHTSSTTTTCCCCCCCEEEESCGGG--GTTCSEEE
T ss_pred             EEEECHHHHHHHHHHHHCCCCCEECHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHCCEEEECCCHHH--HCCCCEEE
T ss_conf             9951788999999998669950322366777777777788877666652132100100020332270776--42047177


Q ss_pred             CC-------CCCEE---EEECCCCCEE-ECCEECCHHHHHHHHCCCCCCCCEEEEEE
Q ss_conf             68-------98069---9981598178-69865319999987449810067114679
Q gi|254780466|r  307 NA-------QGNIS---ATVCADGTLI-SGTELGSIHRVGAKVSGSETCNGWNFWYF  352 (375)
Q Consensus       307 ~~-------~~~~~---a~v~~DG~l~-~~~~~gsIh~i~a~~~~~~~cNGw~fw~~  352 (375)
                      .+       |++..   ..+...++++ ++-...||..+++.++..+.|-|..|+.=
T Consensus       384 Eav~E~l~iK~~lf~~le~~~~~~aIlaSNTSsl~i~~la~~~~~p~r~ig~HffnP  440 (727)
T 2x58_A          384 EAVFEDMNLKKKVFAELSALCKPGAFLCTNTSALNVDDIASSTDRPQLVIGTHFFSP  440 (727)
T ss_dssp             ECCCSCHHHHHHHHHHHHHHSCTTCEEEECCSSSCHHHHHTTSSCGGGEEEEECCSS
T ss_pred             EECCCCHHHHHHHHHHHHHCCCCCCEEEEECCCCCHHHHHHHCCCCCCCCCCCCCCC
T ss_conf             614130666888999998514788358850664674777875578510003665574


No 313
>2km1_A Protein DRE2; yeast, antiapoptotic, protein binding; NMR {Saccharomyces cerevisiae}
Probab=32.39  E-value=10  Score=17.17  Aligned_cols=48  Identities=27%  Similarity=0.607  Sum_probs=33.5

Q ss_pred             HHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHCCCCEE--EEEEEECCC
Q ss_conf             98899999999863968729998346888999987640578601--246873156
Q gi|254780466|r   83 AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWIL--NDIVWRKSN  135 (375)
Q Consensus        83 ~f~~~wl~e~~RvLK~~Gsi~v~~~~~~i~~i~~~l~~~gf~~~--n~IIW~K~n  135 (375)
                      .+.+..+...++-||++|.++-..   ..+.+..+|.  ||.+.  ++--|.|.+
T Consensus        75 ~~p~~l~~~i~~aLk~gG~L~gl~---~~~~ldaLl~--Gf~i~~e~~~~w~Kp~  124 (136)
T 2km1_A           75 KFPKKLISVLADSLKPNGSLIGLS---DIYKVDALIN--GFEIINEPDYCWIKMD  124 (136)
T ss_dssp             CCCHHHHHHHHTTCCTTCCEECCC---HHHHHHHHHH--TEEEECSSSCEEEEC-
T ss_pred             HCCHHHHHHHHHHHCCCCEEECCC---HHHHHHHHHH--CCEEEECCCCEEECCC
T ss_conf             278999999999857797897376---3888899873--5465305788065257


No 314
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in europe; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A*
Probab=31.68  E-value=24  Score=14.86  Aligned_cols=56  Identities=16%  Similarity=-0.030  Sum_probs=40.2

Q ss_pred             HHHHHHCC-CCCCEEEECCCCCHHHHHHHHHH--CCEEEEEEECHHHHHHHHHHHHHCCC
Q ss_conf             99998528-99888998688851799999980--98169997289999999999963056
Q gi|254780466|r  214 SRILVSST-KPGDIILDPFFGSGTSGAVAKKL--RRSFIGIEMKQDYIDIATKRIASVQP  270 (375)
Q Consensus       214 eriI~~~S-~~gDiVLDPF~GSGTT~~aA~~l--gR~~IGiE~~~~Y~~~a~~Rl~~~~~  270 (375)
                      ..++.... .....|||-=||+|..+.+..+.  +-+++++|+ ++-++.+++++.....
T Consensus       172 ~~~~~~~d~~~~~~vlDvG~G~G~~~~~l~~~~P~~~~~~~D~-~~~~~~a~~~~~~~~~  230 (374)
T 1qzz_A          172 EAPADAYDWSAVRHVLDVGGGNGGMLAAIALRAPHLRGTLVEL-AGPAERARRRFADAGL  230 (374)
T ss_dssp             HHHHHTSCCTTCCEEEEETCTTSHHHHHHHHHCTTCEEEEEEC-HHHHHHHHHHHHHTTC
T ss_pred             HHHHHHCCCCCCCEEEEECCCCCHHHHHHHHHCCCEEEEEEEC-HHHHHHHHHHHHHCCC
T ss_conf             9999848965687899979988788999999789728999607-8889999999885588


No 315
>1zod_A DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, cesium, lyase; HET: MES PLP; 1.80A {Burkholderia cepacia} SCOP: c.67.1.4 PDB: 1dka_A* 1m0o_A* 1m0p_A* 1m0n_A* 1zc9_A* 1zob_A* 1m0q_A* 2dkb_A* 1dgd_A* 1dge_A* 1d7u_A* 1d7s_A* 1d7r_A* 1d7v_A* 1z3z_A*
Probab=30.44  E-value=20  Score=15.39  Aligned_cols=14  Identities=14%  Similarity=0.143  Sum_probs=5.0

Q ss_pred             CCCCCHHHHHHHHH
Q ss_conf             68885179999998
Q gi|254780466|r  230 PFFGSGTSGAVAKK  243 (375)
Q Consensus       230 PF~GSGTT~~aA~~  243 (375)
                      .|.|...+++||..
T Consensus       303 T~~g~p~~~aaa~a  316 (433)
T 1zod_A          303 THVSDPLPAAVGLR  316 (433)
T ss_dssp             TTTTCHHHHHHHHH
T ss_pred             CCCCCHHHHHHHHH
T ss_conf             88988599999999


No 316
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, S-adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum tls} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A*
Probab=30.15  E-value=25  Score=14.70  Aligned_cols=56  Identities=16%  Similarity=0.131  Sum_probs=41.3

Q ss_pred             HHHHHHHCCC-CCCEEEECCCCCHHHHHHH-HHH-CCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             9999985289-9888998688851799999-980-9816999728999999999996305
Q gi|254780466|r  213 LSRILVSSTK-PGDIILDPFFGSGTSGAVA-KKL-RRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       213 leriI~~~S~-~gDiVLDPF~GSGTT~~aA-~~l-gR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      ...++..... ....|||-=+|+|..+.+. ++. +-+.+++|+ ++.++.|++++....
T Consensus       179 ~~~~~~~~~~~~~~~vlDiG~G~G~~~~~l~~~~p~~~~~~~Dl-p~~~~~a~~~~~~~~  237 (359)
T 1x19_A          179 IQLLLEEAKLDGVKKMIDVGGGIGDISAAMLKHFPELDSTILNL-PGAIDLVNENAAEKG  237 (359)
T ss_dssp             HHHHHHHCCCTTCCEEEEESCTTCHHHHHHHHHCTTCEEEEEEC-GGGHHHHHHHHHHTT
T ss_pred             HHHHHHHCCCCCCCEEEECCCCCCHHHHHHHHHCCCEEEEEECC-HHHHHHHHHHHHHCC
T ss_conf             99999847876787799767989799999998399228998166-888999998667507


No 317
>2i2c_A Probable inorganic polyphosphate/ATP-NAD kinase 1; NADP bound of lmnadk1, transferase; HET: DTA PG4; 1.85A {Listeria monocytogenes egd-e} PDB: 2i1w_A* 2i2a_A* 2i2b_A* 2i29_A* 2i2d_A* 2i2e_A* 2i2f_A* 2q5f_A*
Probab=30.03  E-value=26  Score=14.69  Aligned_cols=22  Identities=9%  Similarity=0.104  Sum_probs=11.3

Q ss_pred             EEECCEEEEHHHHHHHHHHHHH
Q ss_conf             9759957129999999998761
Q gi|254780466|r  352 FEKLGELHSINTLRILVRKELY  373 (375)
Q Consensus       352 ~~~~~~~~~id~lR~~~r~~~~  373 (375)
                      +-+-...--.+.||.++-++|.
T Consensus       245 l~r~~~~~f~~~l~~k~l~~~~  266 (272)
T 2i2c_A          245 FARFRSFPFWRRVHDSFIEDLE  266 (272)
T ss_dssp             EEECSCCCHHHHHHHHHTCC--
T ss_pred             EEEECCCCHHHHHHHHHHHHHH
T ss_conf             9997999979999997030022


No 318
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca YX}
Probab=29.85  E-value=26  Score=14.67  Aligned_cols=58  Identities=17%  Similarity=0.141  Sum_probs=40.6

Q ss_pred             HHHHHHHHHCC-CCC-CEEEECCCCCHH---HHHHHHHH--CCEEEEEEECHHHHHHHHHHHHHC
Q ss_conf             99999998528-998-889986888517---99999980--981699972899999999999630
Q gi|254780466|r  211 ALLSRILVSST-KPG-DIILDPFFGSGT---SGAVAKKL--RRSFIGIEMKQDYIDIATKRIASV  268 (375)
Q Consensus       211 ~LleriI~~~S-~~g-DiVLDPF~GSGT---T~~aA~~l--gR~~IGiE~~~~Y~~~a~~Rl~~~  268 (375)
                      ..+.|.+.... ..| .=+||-=||.||   |..+|...  +-+.+++|.++..+..++.++...
T Consensus        63 ~fl~Ravr~la~~~GirqfLDlGcG~gt~~~~he~a~~~~P~arVv~vD~dp~~la~ara~l~~~  127 (274)
T 2qe6_A           63 KVLVRGVRFLAGEAGISQFLDLGSGLPTVQNTHEVAQSVNPDARVVYVDIDPMVLTHGRALLAKD  127 (274)
T ss_dssp             HHHHHHHHHHHTTTCCCEEEEETCCSCCSSCHHHHHHHHCTTCEEEEEESSHHHHHHHHHHHTTC
T ss_pred             HHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHCCC
T ss_conf             99999999998745977899947388986419999998789977999959788999987650479


No 319
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1- carboxylic acid, PHZM; 1.80A {Pseudomonas aeruginosa PAO1}
Probab=29.69  E-value=26  Score=14.65  Aligned_cols=55  Identities=15%  Similarity=0.080  Sum_probs=41.8

Q ss_pred             HHHHHHCCCCCCEEEECCCCCHHHHHHHHHH--CCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             9999852899888998688851799999980--9816999728999999999996305
Q gi|254780466|r  214 SRILVSSTKPGDIILDPFFGSGTSGAVAKKL--RRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       214 eriI~~~S~~gDiVLDPF~GSGTT~~aA~~l--gR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      .-+....-..+..|||-=+|+|..+.+..+.  +-+++++|+ ++-++.+.+++....
T Consensus       158 ~~~~~~~d~~~~~vlDvG~G~G~~~~~l~~~~P~l~~~~~Dl-p~~~~~a~~~~~~~~  214 (334)
T 2ip2_A          158 HEIPRLLDFRGRSFVDVGGGSGELTKAILQAEPSARGVMLDR-EGSLGVARDNLSSLL  214 (334)
T ss_dssp             HHHHHHSCCTTCEEEEETCTTCHHHHHHHHHCTTCEEEEEEC-TTCTHHHHHHTHHHH
T ss_pred             HHHHHHHCCCCCEEEECCCCCCHHHHHHHHHCCCEEEEEECC-CCHHHHHHHHHHHCC
T ss_conf             998886077888673038987688888898699649998228-511289987676507


No 320
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A*
Probab=29.31  E-value=26  Score=14.61  Aligned_cols=86  Identities=21%  Similarity=0.345  Sum_probs=44.2

Q ss_pred             EECCCHHH------HHHHCCCCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHH--HHHHHHHHHHHH
Q ss_conf             85172599------8972841471189847787615587133367851300134435778989999--988999999998
Q gi|254780466|r   23 IIKGNSIS------VLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD--AFTRAWLLACRR   94 (375)
Q Consensus        23 I~~GDcl~------~l~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~--~f~~~wl~e~~R   94 (375)
                      .+.||-.+      .........+|+|+.|-.-|....                 +    +.++..  +....-+.-+.+
T Consensus        66 ~~~gd~~~~~~~~~~~~~~~~~~~DlVlSD~ap~~sg~-----------------~----~~d~~~~~~L~~~~l~~a~~  124 (180)
T 1ej0_A           66 FLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGT-----------------P----AVDIPRAMYLVELALEMCRD  124 (180)
T ss_dssp             EEESCTTSHHHHHHHHHHHTTCCEEEEEECCCCCCCSC-----------------H----HHHHHHHHHHHHHHHHHHHH
T ss_pred             EECCCCHHHHHHHHHHHHCCCCCCCEEECCCCCCCCCC-----------------H----HHHHHHHHHHHHHHHHHHHH
T ss_conf             85155002345665543224654248852357776786-----------------8----99999999999999998886


Q ss_pred             HCCCCCEEEE--E-CCHHHHHHHHHHHHHCCCCEEEEEEEECCC
Q ss_conf             6396872999--8-346888999987640578601246873156
Q gi|254780466|r   95 VLKPNGTLWV--I-GSYHNIFRIGTMLQNLNFWILNDIVWRKSN  135 (375)
Q Consensus        95 vLK~~Gsi~v--~-~~~~~i~~i~~~l~~~gf~~~n~IIW~K~n  135 (375)
                      +|+++|++.+  + |....  .+...|...    ...+...|+.
T Consensus       125 ~Lk~gG~fV~K~F~g~~~~--~l~~~l~~~----F~~V~~~KP~  162 (180)
T 1ej0_A          125 VLAPGGSFVVKVFQGEGFD--EYLREIRSL----FTKVKVRKPD  162 (180)
T ss_dssp             HEEEEEEEEEEEESSTTHH--HHHHHHHHH----EEEEEEECCT
T ss_pred             HCCCCCEEEEEEECCCCHH--HHHHHHHHC----CCEEEEECCC
T ss_conf             1367874999997487899--999999830----4989999998


No 321
>2ehj_A Uracil phosphoribosyltransferase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.80A {Escherichia coli}
Probab=29.08  E-value=27  Score=14.59  Aligned_cols=43  Identities=19%  Similarity=0.309  Sum_probs=30.3

Q ss_pred             CCEEEECCCCCHHHHHHHHHH-------CCEEEEEEECHHHHHHHHHHHHHCCC
Q ss_conf             888998688851799999980-------98169997289999999999963056
Q gi|254780466|r  224 GDIILDPFFGSGTSGAVAKKL-------RRSFIGIEMKQDYIDIATKRIASVQP  270 (375)
Q Consensus       224 gDiVLDPF~GSGTT~~aA~~l-------gR~~IGiE~~~~Y~~~a~~Rl~~~~~  270 (375)
                      .=+++||..+||.|+.+|.+.       .-.++.+=..++.++    ||.+.-|
T Consensus       125 ~villDPmlATG~s~~~ai~~L~~~G~~~I~iv~~ias~~Gi~----~l~~~~P  174 (208)
T 2ehj_A          125 MALIVDPMLATGGSVIATIDLLKKAGCSSIKVLVLVAAPEGIA----ALEKAHP  174 (208)
T ss_dssp             EEEEEEEEESSCHHHHHHHHHHHHTTCCEEEEEEEEECHHHHH----HHHHHCT
T ss_pred             EEEEECHHHHCCHHHHHHHHHHHHCCCCCEEEEEEEECHHHHH----HHHHHCC
T ss_conf             6999683674567799999999857998289999985589999----9998794


No 322
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp}
Probab=28.27  E-value=27  Score=14.50  Aligned_cols=66  Identities=20%  Similarity=0.169  Sum_probs=35.8

Q ss_pred             HHHHHHHHHCCCCCEEEEECCHH----------------------HHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCCC
Q ss_conf             99999998639687299983468----------------------88999987640578601246873156777757751
Q gi|254780466|r   87 AWLLACRRVLKPNGTLWVIGSYH----------------------NIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRR  144 (375)
Q Consensus        87 ~wl~e~~RvLK~~Gsi~v~~~~~----------------------~i~~i~~~l~~~gf~~~n~IIW~K~n~~pn~~g~r  144 (375)
                      ..|..+.++|+++|.+.+..-.|                      -+-.+...+.+.||.+.+.+.    .|.+...|+ 
T Consensus       118 ~vlp~~~~~l~~~~~~v~LiKPQFE~g~~~v~k~GvV~d~~~~~~~i~~v~~~~~~~g~~v~~~~~----SpI~G~~GN-  192 (232)
T 3opn_A          118 LILPPLYEILEKNGEVAALIKPQFEAGREQVGKNGIIRDPKVHQMTIEKVLKTATQLGFSVKGLTF----SPIKGGAGN-  192 (232)
T ss_dssp             GTHHHHHHHSCTTCEEEEEECHHHHSCHHHHC-CCCCCCHHHHHHHHHHHHHHHHHHTEEEEEEEE----CSSCBTTTB-
T ss_pred             HHHHHHHHHHCCCCEEEEEECCCCHHCHHHHCCCCEECCHHHHHHHHHHHHHHHHHCCCEEEEEEE----CCCCCCCCC-
T ss_conf             999999998268988999976400113454166985789999999999999999868997858997----889998837-


Q ss_pred             CCCCHHHHHHHHCCCCC
Q ss_conf             76540213221005666
Q gi|254780466|r  145 FQNAHETLIWASPSPKA  161 (375)
Q Consensus       145 ~~~~hE~iiw~~K~~~~  161 (375)
                          .|+++|+.|...+
T Consensus       193 ----~Eyl~~~~k~~~~  205 (232)
T 3opn_A          193 ----VEFLVHLLKDGKA  205 (232)
T ss_dssp             ----CCEEEEEEESSCC
T ss_pred             ----HHHHHHHHHCCCC
T ss_conf             ----9889886116788


No 323
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.79A {Cyanidioschyzon merolae strain 10D}
Probab=28.04  E-value=28  Score=14.48  Aligned_cols=58  Identities=14%  Similarity=0.155  Sum_probs=41.0

Q ss_pred             HHHHHHHHHHC-CCCCCEEEECCCCCHHHHHHHHHHC-CEEEEEEE-CHHHHHHHHHHHHH
Q ss_conf             89999999852-8998889986888517999999809-81699972-89999999999963
Q gi|254780466|r  210 EALLSRILVSS-TKPGDIILDPFFGSGTSGAVAKKLR-RSFIGIEM-KQDYIDIATKRIAS  267 (375)
Q Consensus       210 ~~LleriI~~~-S~~gDiVLDPF~GSGTT~~aA~~lg-R~~IGiE~-~~~Y~~~a~~Rl~~  267 (375)
                      .-|.+.|.... .-+|--||+--+|+|-.+++|..+| ++.+..+. ++..+...+.-++.
T Consensus        65 ~~La~~L~~~~~~~~Gk~VLELGaGtGl~gl~aA~~ga~~Vv~tD~~~~~~~~~l~~Nv~~  125 (281)
T 3bzb_A           65 RALADTLCWQPELIAGKTVCELGAGAGLVSIVAFLAGADQVVATDYPDPEILNSLESNIRE  125 (281)
T ss_dssp             HHHHHHHHHCGGGTTTCEEEETTCTTSHHHHHHHHTTCSEEEEEECSCHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHCHHHCCCCEEEEECCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHH
T ss_conf             9999999839233099829997855229999999858987999976967889999999998


No 324
>2i2w_A Phosphoheptose isomerase; lipopolysaccharide biosynthesis; 1.95A {Escherichia coli} PDB: 2i22_A 1x94_A
Probab=27.76  E-value=28  Score=14.45  Aligned_cols=43  Identities=26%  Similarity=0.368  Sum_probs=32.7

Q ss_pred             HHHHHHHHHCCCCCCEEEECCCCCHHHHH------HHHHHCCEEEEEEEC
Q ss_conf             99999998528998889986888517999------999809816999728
Q gi|254780466|r  211 ALLSRILVSSTKPGDIILDPFFGSGTSGA------VAKKLRRSFIGIEMK  254 (375)
Q Consensus       211 ~LleriI~~~S~~gDiVLDPF~GSGTT~~------aA~~lgR~~IGiE~~  254 (375)
                      ....+.++...++||+|+ -|.+||.+..      .|++.|-+-|++--.
T Consensus       119 ~~f~~ql~~~~~~gDvli-~iS~SG~s~nvi~al~~Ak~~G~~ti~lTg~  167 (212)
T 2i2w_A          119 DIFSRYVEAVGREGDVLL-GISTSGNSANVIKAIAAAREKGMKVITLTGK  167 (212)
T ss_dssp             SHHHHHHHHHCCTTCEEE-EECSSSCCHHHHHHHHHHHHHTCEEEEEEET
T ss_pred             HHHHHHHHHHCCCCCEEE-EEECCCCCCCHHHHHHHHHHCCCEEEEEECC
T ss_conf             999999998578988799-9808999832899999999859989999778


No 325
>2prs_A High-affinity zinc uptake system protein ZNUA; protein consists of two (beta/ALFA)4 domains, metal transport; 1.70A {Escherichia coli} PDB: 2osv_A 2ps0_A 2ps3_A 2ps9_A 2ogw_A
Probab=27.71  E-value=28  Score=14.44  Aligned_cols=64  Identities=16%  Similarity=0.202  Sum_probs=36.3

Q ss_pred             CCCCCHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEE--------CHHHHHHHHHHHHHCC
Q ss_conf             8778189999999852899888998688851799999980981699972--------8999999999996305
Q gi|254780466|r  205 PTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEM--------KQDYIDIATKRIASVQ  269 (375)
Q Consensus       205 PTqKP~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~--------~~~Y~~~a~~Rl~~~~  269 (375)
                      |+++-+.-+...|+.. +..-++.+|...+-+.-..|+++|=+.+-++-        ...|.+.-.+-+.+++
T Consensus       207 ps~~~l~~~~~~ik~~-~i~~i~~e~~~~~~~~~~la~e~~v~~~~ldpl~~~~~~~~~~Y~~~m~~n~~~l~  278 (284)
T 2prs_A          207 PGAQRLHEIRTQLVEQ-KATCVFAEPQFRPAVVESVARGTSVRMGTLDPLGTNIKLGKTSYSEFLSQLANQYA  278 (284)
T ss_dssp             CCHHHHHHHHHHHHHT-TCCEEEECTTSCSHHHHHHTTTSCCEEEECCTTCTTSCCSTTHHHHHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHCC-CCCEEEEECCCCHHHHHHHHHHHCCCEEEECCCCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             8989999999987515-98489985898919999999980997798447766777770429999999999999


No 326
>3ly1_A Putative histidinol-phosphate aminotransferase; structural genomics, joint center for structural genomics, JCSG; HET: MSE PLP CIT; 1.80A {Erwinia carotovora atroseptica}
Probab=27.58  E-value=28  Score=14.43  Aligned_cols=47  Identities=6%  Similarity=-0.121  Sum_probs=22.7

Q ss_pred             CCHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             81899999998528998889986888517999999809816999728999999999996305
Q gi|254780466|r  208 KPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       208 KP~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      -|.++++.+-....        ++..+.....+|.....       +..+.+...+++....
T Consensus       227 ~~~~~i~~l~~~~~--------~~~~~~~~~~~a~~~~~-------~~~~~~~~~~~~~~~r  273 (354)
T 3ly1_A          227 AHPTVIALMGRYVA--------GEKINFSGVDAALASMN-------DSAFITYSKKSNDVSR  273 (354)
T ss_dssp             CCHHHHHHHGGGTT--------CSCCCHHHHHHHHHHTT-------CHHHHHHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHC--------CCCCCHHHHHHHHHHHC-------CHHHHHHHHHHHHHHH
T ss_conf             79999999999726--------58876999999999746-------5899999899999999


No 327
>2qzj_A Two-component response regulator; 11017X, PSI-II, structural genomics, protein structure initiative; 2.89A {Clostridium difficile 630}
Probab=26.52  E-value=22  Score=15.08  Aligned_cols=47  Identities=19%  Similarity=0.185  Sum_probs=31.3

Q ss_pred             CCCCCCCCCCCCCCCHHHHC---------CCEECCCHHHHHHHCCCCCCCEEEECC
Q ss_conf             98654320233324335532---------708517259989728414711898477
Q gi|254780466|r    1 MSQKNSLAINENQNSIFEWK---------DKIIKGNSISVLEKLPAKSVDLIFADP   47 (375)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~---------nkI~~GDcl~~l~~Lpd~sVDlI~tDP   47 (375)
                      ||-+.++++.+.+.......         .-....|.-+.+..+..+.+|||++|-
T Consensus         1 M~~~~kILiVDDd~~~~~~l~~~L~~~g~~v~~a~~~~eal~~l~~~~~dlillD~   56 (136)
T 2qzj_A            1 MSLQTKILIIDGDKDNCQKLKGFLEEKGISIDLAYNCEEAIGKIFSNKYDLIFLEI   56 (136)
T ss_dssp             ---CCEEEEECSCHHHHHHHHHHHHTTTCEEEEESSHHHHHHHHHHCCCSEEEEES
T ss_pred             CCCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCEEEECC
T ss_conf             99677599998999999999999998799999989999999988627999999779


No 328
>3cx3_A Lipoprotein; zinc-binding, transport, lipid binding protein, metal binding protein; 2.40A {Streptococcus pneumoniae}
Probab=25.62  E-value=28  Score=14.48  Aligned_cols=48  Identities=13%  Similarity=0.234  Sum_probs=20.8

Q ss_pred             CCCCCHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             87781899999998528998889986888517999999809816999728999999999996305
Q gi|254780466|r  205 PTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       205 PTqKP~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      -.|.|.+++++|... +...-++|||+.+..                +-.+.|+++-+.-++++.
T Consensus       233 e~~~~~~~~~~la~e-~g~~~~~ld~l~~~~----------------~~~~~Y~~~m~~n~~~l~  280 (284)
T 3cx3_A          233 ESNASSKVAETLVKS-TGVGLKTLNPLESDP----------------QNDKTYLENLEENMSILA  280 (284)
T ss_dssp             CSSSCCHHHHHHHSS-SSCCEEECCCSSSCC----------------CSSCCHHHHHHHHHHHHH
T ss_pred             CCCCCHHHHHHHHHH-CCCCEEEECCCCCCC----------------CCCCCHHHHHHHHHHHHH
T ss_conf             189991999999997-199868856777788----------------886779999999999999


No 329
>2e7u_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.90A {Thermus thermophilus HB8}
Probab=25.47  E-value=26  Score=14.66  Aligned_cols=23  Identities=26%  Similarity=0.514  Sum_probs=10.0

Q ss_pred             HHHHHHHCC-CCCCEEEECCCCCH
Q ss_conf             999998528-99888998688851
Q gi|254780466|r  213 LSRILVSST-KPGDIILDPFFGSG  235 (375)
Q Consensus       213 leriI~~~S-~~gDiVLDPF~GSG  235 (375)
                      ++++|.... +...+|+.|+.|+|
T Consensus       189 le~~i~~~~~~iaa~i~EPi~g~g  212 (424)
T 2e7u_A          189 LREVLKRRGEEIAAIIFEPVVGNA  212 (424)
T ss_dssp             HHHHHHHHGGGEEEEEECSSBCTT
T ss_pred             HHHHHHHCCCCEEEEEEECCCCCC
T ss_conf             999998379957899997777888


No 330
>3hn7_A UDP-N-acetylmuramate-L-alanine ligase; YP_263340.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.65A {Psychrobacter arcticus 273-4}
Probab=25.31  E-value=22  Score=15.08  Aligned_cols=29  Identities=17%  Similarity=0.166  Sum_probs=16.8

Q ss_pred             CCCEEEECCCCCHHHHHHHHH----H--CCEEEEE
Q ss_conf             988899868885179999998----0--9816999
Q gi|254780466|r  223 PGDIILDPFFGSGTSGAVAKK----L--RRSFIGI  251 (375)
Q Consensus       223 ~gDiVLDPF~GSGTT~~aA~~----l--gR~~IGi  251 (375)
                      .|-+|.|-|+-+-+...|+.+    +  +|+-|.+
T Consensus       385 ~~~~viDDYahnP~si~a~l~al~~~~~~~rii~v  419 (524)
T 3hn7_A          385 NDILVFDDFAHHPTAITTTLDGAKKKLADRRLWAI  419 (524)
T ss_dssp             TTEEEEEECCCSHHHHHHHHHHHHHHHTTSCEEEE
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             78159973479989999999999976699859999


No 331
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli}
Probab=24.92  E-value=13  Score=16.43  Aligned_cols=31  Identities=23%  Similarity=0.289  Sum_probs=16.5

Q ss_pred             CCCCEEEECCCCCHHHHHHHHHHCCEEEEEEE
Q ss_conf             99888998688851799999980981699972
Q gi|254780466|r  222 KPGDIILDPFFGSGTSGAVAKKLRRSFIGIEM  253 (375)
Q Consensus       222 ~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~  253 (375)
                      ...++.+-+..|...+.. +.++++....++.
T Consensus       316 ~~~~~~~~~~~g~~~~~~-~~~~~~~~~~~d~  346 (483)
T 3mog_A          316 EIDDVLLIETQGETAQAL-AIRLARPVVVIDK  346 (483)
T ss_dssp             EETTEEEEECSSSCHHHH-HHHHTSCEEEEEC
T ss_pred             HHHHHHHHHHCCCHHHHH-HHHHCCCCCCCCC
T ss_conf             078776665326047777-6653365312354


No 332
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana}
Probab=24.72  E-value=9.6  Score=17.26  Aligned_cols=118  Identities=14%  Similarity=0.226  Sum_probs=69.5

Q ss_pred             CCCHHHH----HHHHHHCCEEEEEEECHHHHHHHHHHHHHCCC--CCHHHHCCCCCCCCCCCCCHHHHHHCCCCCCCCEE
Q ss_conf             8851799----99998098169997289999999999963056--87656302444333775523469882865877657
Q gi|254780466|r  232 FGSGTSG----AVAKKLRRSFIGIEMKQDYIDIATKRIASVQP--LGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQIL  305 (375)
Q Consensus       232 ~GSGTT~----~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~~--~~~~~~~~~~~~~~~~rvpfg~lie~g~l~~g~~L  305 (375)
                      .|+||-|    .++..-|.+-+-.|++++.++-+.+|++....  .....+..........++.+...++  -+..-+..
T Consensus       318 iGaG~MG~gIA~~~a~~G~~V~l~D~~~~~l~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~i~~~~~~~--~l~~~DlV  395 (725)
T 2wtb_A          318 IGGGLMGSGIATALILSNYPVILKEVNEKFLEAGIGRVKANLQSRVRKGSMSQEKFEKTMSLLKGSLDYE--SFRDVDMV  395 (725)
T ss_dssp             ECCSHHHHHHHHHHHTTTCCEEEECSSHHHHHHHHHHHHHHHHHTTC----CTTHHHHTTTSEEEESSSG--GGTTCSEE
T ss_pred             ECCCHHHHHHHHHHHHCCCCEEECCCCHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHCCCCCCCHH--HHCCCCEE
T ss_conf             8976899999999986599815735575788878989999999987613100788999983157767777--74467768


Q ss_pred             ECC-------CCCEEE---EECCCCCEEE-CCEECCHHHHHHHHCCCCCCCCEEEEE
Q ss_conf             668-------980699---9815981786-986531999998744981006711467
Q gi|254780466|r  306 TNA-------QGNISA---TVCADGTLIS-GTELGSIHRVGAKVSGSETCNGWNFWY  351 (375)
Q Consensus       306 ~~~-------~~~~~a---~v~~DG~l~~-~~~~gsIh~i~a~~~~~~~cNGw~fw~  351 (375)
                      +.+       |+...+   .+...+++++ +-...||..+++.+...+.+-|..|++
T Consensus       396 iEav~E~l~iK~~v~~~le~~~~~~aIlasNTS~l~i~~la~~~~~p~R~~g~Hffn  452 (725)
T 2wtb_A          396 IEAVIENISLKQQIFADLEKYCPQHCILASNTSTIDLNKIGERTKSQDRIVGAHFFS  452 (725)
T ss_dssp             EECCCSCHHHHHHHHHHHHHHSCTTCEEEECCSSSCHHHHTTTCSCTTTEEEEEECS
T ss_pred             EEECCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHCCCCHHHEEEEECCC
T ss_conf             870445300125689999864676069983576447898851146713289740358


No 333
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A*
Probab=24.21  E-value=33  Score=14.05  Aligned_cols=13  Identities=23%  Similarity=0.585  Sum_probs=5.7

Q ss_pred             CCCHHHHHHHHHH
Q ss_conf             7818999999985
Q gi|254780466|r  207 QKPEALLSRILVS  219 (375)
Q Consensus       207 qKP~~LleriI~~  219 (375)
                      +.|++....||..
T Consensus       155 ~~~~eiv~~Ii~~  167 (173)
T 1e6c_A          155 QPPAAIVCELMQT  167 (173)
T ss_dssp             SCHHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHH
T ss_conf             9989999999998


No 334
>3etn_A Putative phosphosugar isomerase involved in capsule formation; YP_209877.1, structural genomics; HET: MSE CMK; 1.70A {Bacteroides fragilis nctc 9343}
Probab=24.14  E-value=32  Score=14.11  Aligned_cols=15  Identities=20%  Similarity=0.390  Sum_probs=9.8

Q ss_pred             HHHCCCCCEEEEECC
Q ss_conf             986396872999834
Q gi|254780466|r   93 RRVLKPNGTLWVIGS  107 (375)
Q Consensus        93 ~RvLK~~Gsi~v~~~  107 (375)
                      ..+.+..|.|+++|-
T Consensus        53 ~~i~~~~grI~~~Gv   67 (220)
T 3etn_A           53 EQIHRKKGKLVTSGM   67 (220)
T ss_dssp             HHTTTTCCCEEEECS
T ss_pred             HHHHHCCCEEEEEEE
T ss_conf             999717996999970


No 335
>1mdo_A ARNB aminotransferase; type 1 aminotransferase fold; HET: MSE PMP; 1.70A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1mdx_A* 1mdz_A*
Probab=23.81  E-value=33  Score=14.00  Aligned_cols=10  Identities=0%  Similarity=0.029  Sum_probs=4.1

Q ss_pred             HHHHHHHHHH
Q ss_conf             8999999985
Q gi|254780466|r  210 EALLSRILVS  219 (375)
Q Consensus       210 ~~LleriI~~  219 (375)
                      .++.+++-..
T Consensus       203 ~~~~~~~~~l  212 (393)
T 1mdo_A          203 PQFADKLRSL  212 (393)
T ss_dssp             HHHHHHHHHH
T ss_pred             HHHHHHHHHH
T ss_conf             5889999999


No 336
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A*
Probab=23.14  E-value=29  Score=14.36  Aligned_cols=11  Identities=18%  Similarity=0.066  Sum_probs=4.2

Q ss_pred             HHHHHHHHHCC
Q ss_conf             99998764057
Q gi|254780466|r  112 FRIGTMLQNLN  122 (375)
Q Consensus       112 ~~i~~~l~~~g  122 (375)
                      ..+...|...|
T Consensus        19 ~~la~~L~~~g   29 (144)
T 2hmt_A           19 GSIVKELHRMG   29 (144)
T ss_dssp             HHHHHHHHHTT
T ss_pred             HHHHHHHHHCC
T ss_conf             99999999889


No 337
>1x92_A APC5045, phosphoheptose isomerase; midwest centre for structural genomics, SIS domain, A/B protein, lipopolysaccharide biosynthesis, PSI; HET: M7P; 2.30A {Pseudomonas aeruginosa} SCOP: c.80.1.3 PDB: 3bjz_A
Probab=22.37  E-value=35  Score=13.83  Aligned_cols=44  Identities=20%  Similarity=0.376  Sum_probs=32.4

Q ss_pred             HHHHHHHHHHCCCCCCEEEECCCCCHHHH------HHHHHHCCEEEEEEEC
Q ss_conf             89999999852899888998688851799------9999809816999728
Q gi|254780466|r  210 EALLSRILVSSTKPGDIILDPFFGSGTSG------AVAKKLRRSFIGIEMK  254 (375)
Q Consensus       210 ~~LleriI~~~S~~gDiVLDPF~GSGTT~------~aA~~lgR~~IGiE~~  254 (375)
                      +..+.|-+.+..++||+++ -|.+||.+.      ..|++.|-+.|++-=.
T Consensus       100 ~~~f~~ql~~~~~~gDvli-~iS~SG~S~nii~a~~~Ak~~g~~~i~ltG~  149 (199)
T 1x92_A          100 NEVFSKQIRALGQPGDVLL-AISTSGNSANVIQAIQAAHDREMLVVALTGR  149 (199)
T ss_dssp             GGTTHHHHHHHCCTTCEEE-EECSSSCCHHHHHHHHHHHHTTCEEEEEECT
T ss_pred             HHHHHHHHHHCCCCCCEEE-EEECCCCCCCHHHHHHHHHHCCCEEEEEECC
T ss_conf             9999999996378998899-9847999945789999999869969999817


No 338
>2pju_A Propionate catabolism operon regulatory protein; structural genomics, PRPR, transcriptional regulation, PSI- 2, protein structure initiative; 2.10A {Escherichia coli} SCOP: c.92.3.1
Probab=22.32  E-value=36  Score=13.82  Aligned_cols=56  Identities=16%  Similarity=0.081  Sum_probs=36.6

Q ss_pred             CCCCCCHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHH
Q ss_conf             6877818999999985289988899868885179999998098169997289999999999
Q gi|254780466|r  204 HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKR  264 (375)
Q Consensus       204 HPTqKP~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~R  264 (375)
                      ++-+.++++-..+ +.....|   .|-+.|.|+|.-.|+++|-++|-+. +.+-+..|.+.
T Consensus       135 ~~~~~~~e~~~~v-~~l~~~G---~~vVVG~~~~~~~A~~~Gl~~vli~-SgeSI~~Ai~~  190 (225)
T 2pju_A          135 RSYITEEDARGQI-NELKANG---TEAVVGAGLITDLAEEAGMTGIFIY-SAATVRQAFSD  190 (225)
T ss_dssp             EEESSHHHHHHHH-HHHHHTT---CCEEEESHHHHHHHHHTTSEEEESS-CHHHHHHHHHH
T ss_pred             EEECCHHHHHHHH-HHHHHCC---CCEEECCHHHHHHHHHCCCCEEEEC-CHHHHHHHHHH
T ss_conf             9966889999999-9999869---9799988589999998499789975-88999999999


No 339
>1vdm_A Purine phosphoribosyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Pyrococcus horikoshii} SCOP: c.61.1.1
Probab=22.13  E-value=35  Score=13.85  Aligned_cols=23  Identities=17%  Similarity=0.167  Sum_probs=18.3

Q ss_pred             CCCCEEEECCCCCHHHHHHHHHH
Q ss_conf             99888998688851799999980
Q gi|254780466|r  222 KPGDIILDPFFGSGTSGAVAKKL  244 (375)
Q Consensus       222 ~~gDiVLDPF~GSGTT~~aA~~l  244 (375)
                      .+.=+|.|-...||+|+.+|.++
T Consensus        83 gk~VLiVDDv~~TG~Tl~~~~~~  105 (153)
T 1vdm_A           83 DKRVVIVDDVSDTGKTLEVVIEE  105 (153)
T ss_dssp             TCEEEEEEEEESSCHHHHHHHHH
T ss_pred             CCEEEEEECCCCCCCCHHHHHHH
T ss_conf             99899972531568479999999


No 340
>3oks_A 4-aminobutyrate transaminase; ssgcid, transferase, seattle structural genomics center for infectious disease; HET: LLP; 1.80A {Mycobacterium smegmatis}
Probab=21.97  E-value=36  Score=13.78  Aligned_cols=14  Identities=21%  Similarity=0.164  Sum_probs=6.1

Q ss_pred             CCCCCHHHHHHHHH
Q ss_conf             68885179999998
Q gi|254780466|r  230 PFFGSGTSGAVAKK  243 (375)
Q Consensus       230 PF~GSGTT~~aA~~  243 (375)
                      .|.|.-..++||..
T Consensus       325 Tf~gnp~~~aAala  338 (451)
T 3oks_A          325 TYGGNPIACAAALA  338 (451)
T ss_dssp             SSSSCHHHHHHHHH
T ss_pred             CCCCCHHHHHHHHH
T ss_conf             99989899987776


No 341
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis}
Probab=21.97  E-value=36  Score=13.78  Aligned_cols=46  Identities=20%  Similarity=0.066  Sum_probs=36.0

Q ss_pred             CCCEEEECCCCCHHHHHHHHHH--CCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             9888998688851799999980--9816999728999999999996305
Q gi|254780466|r  223 PGDIILDPFFGSGTSGAVAKKL--RRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       223 ~gDiVLDPF~GSGTT~~aA~~l--gR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
                      ....|||-=+|+|..+....+.  +-+++++|+ +..++.|++++....
T Consensus       179 ~~~~vlDvGgG~G~~~~~l~~~~p~~~~~~~Dl-p~~~~~a~~~~~~~~  226 (352)
T 3mcz_A          179 RARTVIDLAGGHGTYLAQVLRRHPQLTGQIWDL-PTTRDAARKTIHAHD  226 (352)
T ss_dssp             TCCEEEEETCTTCHHHHHHHHHCTTCEEEEEEC-GGGHHHHHHHHHHTT
T ss_pred             CCCEEEEECCCCCHHHHHHHHHCCEEEEEEEEC-HHHHHHHHHHHHHCC
T ss_conf             799899988988799999997598348999601-999999999998638


No 342
>1914_A Signal recognition particle 9/14 fusion protein; ALU domain, RNA binding, signal recognition particle (SRP), translation regulation; 2.53A {Mus musculus} SCOP: d.49.1.1 d.49.1.1 PDB: 1e8o_A* 1e8s_A 1ry1_C*
Probab=21.81  E-value=36  Score=13.76  Aligned_cols=23  Identities=13%  Similarity=0.242  Sum_probs=15.1

Q ss_pred             HHHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             988999999998639687299983
Q gi|254780466|r   83 AFTRAWLLACRRVLKPNGTLWVIG  106 (375)
Q Consensus        83 ~f~~~wl~e~~RvLK~~Gsi~v~~  106 (375)
                      +|+.+ |.+++.--+..||+||-.
T Consensus        27 ~FLte-LtkLf~k~r~~GSV~lT~   49 (232)
T 1914_A           27 QFLTE-LTRLFQKCRSSGSVFITL   49 (232)
T ss_dssp             HHHHH-HHHHHHHTSSSCCEEEEE
T ss_pred             HHHHH-HHHHHHHCCCCCEEEEEE
T ss_conf             99999-999997278885089998


No 343
>1aqu_A EST, estrogen sulfotransferase; PAP, sulfonation, 17-beta estradiol, steroid-binding; HET: A3P EST; 1.60A {Mus musculus} SCOP: c.37.1.5 PDB: 1aqy_A* 1bo6_A* 1hy3_A* 1g3m_A*
Probab=21.50  E-value=37  Score=13.72  Aligned_cols=22  Identities=27%  Similarity=0.310  Sum_probs=12.1

Q ss_pred             CHHHHHHHCCCCCCCEEEECCC
Q ss_conf             2599897284147118984778
Q gi|254780466|r   27 NSISVLEKLPAKSVDLIFADPP   48 (375)
Q Consensus        27 Dcl~~l~~Lpd~sVDlI~tDPP   48 (375)
                      +.++.+..++..-=|.++++-|
T Consensus        28 ~~~~~~~~f~~R~~DV~I~SyP   49 (297)
T 1aqu_A           28 KYWEDVEMFLARPDDLVIATYP   49 (297)
T ss_dssp             TTHHHHHTCCCCTTCEEEEECT
T ss_pred             HHHHHHHCCCCCCCCEEEECCC
T ss_conf             8999742788899999998999


No 344
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1
Probab=21.26  E-value=23  Score=14.95  Aligned_cols=38  Identities=18%  Similarity=0.218  Sum_probs=22.9

Q ss_pred             CCCHHHHHHHHHHCCCCCCEEEECCCC--------CHHHHHHHHHH
Q ss_conf             781899999998528998889986888--------51799999980
Q gi|254780466|r  207 QKPEALLSRILVSSTKPGDIILDPFFG--------SGTSGAVAKKL  244 (375)
Q Consensus       207 qKP~~LleriI~~~S~~gDiVLDPF~G--------SGTT~~aA~~l  244 (375)
                      .||+.|+..+++..+.-|++||--|.+        .|..+.+|.++
T Consensus        32 ~FDe~l~~eLLq~l~~~GeViLVRfv~d~MwVTF~dG~SAL~al~l   77 (95)
T 1ufw_A           32 EFPEDLRTELMQTLGSYGTIVLVRINQGQMLVTFADSHSALSVLDV   77 (95)
T ss_dssp             SCCHHHHHHHHHHHHHHSCCSEEEEETTEEEEECSCSHHHHHHHHG
T ss_pred             CCCHHHHHHHHHHHHHCCEEEEEEEECCEEEEEECCCHHHHHHHCC
T ss_conf             4887999999998641663999999488299998777879987535


No 345
>2cjg_A L-lysine-epsilon aminotransferase; internal aldimine, pyridoxal phosphate, PLP, RV3290C, lysine amino transferase; HET: PMP; 1.95A {Mycobacterium tuberculosis} PDB: 2cjd_A* 2cin_A* 2cjh_A* 2jjg_A* 2jje_A* 2jjh_A* 2jjf_A
Probab=21.12  E-value=34  Score=13.90  Aligned_cols=10  Identities=30%  Similarity=0.833  Sum_probs=4.4

Q ss_pred             EEEECCCCCH
Q ss_conf             8998688851
Q gi|254780466|r  226 IILDPFFGSG  235 (375)
Q Consensus       226 iVLDPF~GSG  235 (375)
                      +|+.|..|+|
T Consensus       235 vi~EPi~g~g  244 (449)
T 2cjg_A          235 FVAEPIQGEG  244 (449)
T ss_dssp             EEECSEETTT
T ss_pred             EEEECCCCCC
T ss_conf             9980665788


No 346
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A
Probab=20.53  E-value=39  Score=13.59  Aligned_cols=40  Identities=8%  Similarity=-0.223  Sum_probs=20.1

Q ss_pred             EEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHH
Q ss_conf             8998688851799999980981699972899999999999
Q gi|254780466|r  226 IILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRI  265 (375)
Q Consensus       226 iVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl  265 (375)
                      -||--=+|+|.|+..+.+..-+-..+|+|++-+++|++.+
T Consensus        75 ~VLiIGgG~G~~~re~lk~~~~v~~VEiD~~Vi~~a~~~f  114 (262)
T 2cmg_A           75 EVLIVDGFDLELAHQLFKYDTHIDFVQADEKILDSFISFF  114 (262)
T ss_dssp             EEEEESSCCHHHHHHHTTSSCEEEEECSCHHHHGGGTTTS
T ss_pred             EEEEECCCCHHHHHHHHCCCCEEEEEEECHHHHHHHHHHC
T ss_conf             7999459966999998458974799983899999999868


No 347
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleotide binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A*
Probab=20.48  E-value=39  Score=13.59  Aligned_cols=45  Identities=18%  Similarity=0.176  Sum_probs=18.7

Q ss_pred             CCCCEEEECCCCCHHHHHH---HHHHCCEEEEEEECHHHHHHHHHHHHH
Q ss_conf             9988899868885179999---998098169997289999999999963
Q gi|254780466|r  222 KPGDIILDPFFGSGTSGAV---AKKLRRSFIGIEMKQDYIDIATKRIAS  267 (375)
Q Consensus       222 ~~gDiVLDPF~GSGTT~~a---A~~lgR~~IGiE~~~~Y~~~a~~Rl~~  267 (375)
                      ...++++|.++........   +...+..++-+.+... .+.+.+|+.+
T Consensus        85 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~V~l~~~-~~~~~~R~~~  132 (178)
T 1qhx_A           85 AGARIIIDDVFLGGAAAQERWRSFVGDLDVLWVGVRCD-GAVAEGRETA  132 (178)
T ss_dssp             TTCEEEEEECCTTTHHHHHHHHHHHTTCCEEEEEEECC-HHHHHHHHHH
T ss_pred             CCCCCEEEEEECCHHHHHHHHHHHCCCCEEEEEEECCC-HHHHHHHHHH
T ss_conf             28972688772447889999886313770789994598-8999999870


No 348
>2jov_A Hypothetical protein CPE0013; alpha + beta sandwich, structural genomics, PSI-2, protein structure initiative; NMR {Clostridium perfringens} SCOP: d.349.1.1
Probab=20.23  E-value=4.8  Score=19.08  Aligned_cols=42  Identities=14%  Similarity=0.191  Sum_probs=30.8

Q ss_pred             CCHHHHHHHHHH--------CCCCCCEEEECCCCCHHHHHHHHHHCCEEE
Q ss_conf             818999999985--------289988899868885179999998098169
Q gi|254780466|r  208 KPEALLSRILVS--------STKPGDIILDPFFGSGTSGAVAKKLRRSFI  249 (375)
Q Consensus       208 KP~~LleriI~~--------~S~~gDiVLDPF~GSGTT~~aA~~lgR~~I  249 (375)
                      -|.+++..+++.        --+.||+|+.-.+|+|.-.+|++.+.|+-+
T Consensus        29 IPK~~i~e~m~~l~~i~V~APV~~GdVI~~ni~gTGvdiIATr~v~k~~~   78 (85)
T 2jov_A           29 VEISKWIDFSNVLSRLYVGVPTKSGNVVCKNIMNTGVDIICTKNLPKDSL   78 (85)
T ss_dssp             ECHHHHHHHHHHHTTCEECCCCCSSEEEEESTTSSSCEEEECSCCCSSCC
T ss_pred             CCHHHHHHHHHHHHCCEECCCCCCCCEEEECCCCCCCCEEEECCCCHHHH
T ss_conf             88899999999973879928844588998536689986999454554332


Done!