BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780466|ref|YP_003064879.1| putative modification
methylase [Candidatus Liberibacter asiaticus str. psy62]
         (375 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780466|ref|YP_003064879.1| putative modification methylase [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040143|gb|ACT56939.1| putative modification methylase [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 375

 Score =  775 bits (2001), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/375 (100%), Positives = 375/375 (100%)

Query: 1   MSQKNSLAINENQNSIFEWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRP 60
           MSQKNSLAINENQNSIFEWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRP
Sbjct: 1   MSQKNSLAINENQNSIFEWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRP 60

Query: 61  DHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQN 120
           DHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQN
Sbjct: 61  DHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQN 120

Query: 121 LNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQM 180
           LNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQM
Sbjct: 121 LNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQM 180

Query: 181 RSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAV 240
           RSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAV
Sbjct: 181 RSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAV 240

Query: 241 AKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQ 300
           AKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQ
Sbjct: 241 AKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQ 300

Query: 301 PGQILTNAQGNISATVCADGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHS 360
           PGQILTNAQGNISATVCADGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHS
Sbjct: 301 PGQILTNAQGNISATVCADGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHS 360

Query: 361 INTLRILVRKELYNC 375
           INTLRILVRKELYNC
Sbjct: 361 INTLRILVRKELYNC 375


>gi|315122079|ref|YP_004062568.1| putative modification methylase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495481|gb|ADR52080.1| putative modification methylase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 380

 Score =  683 bits (1763), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/373 (86%), Positives = 351/373 (94%)

Query: 1   MSQKNSLAINENQNSIFEWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRP 60
           M++K+ L I++N+NSI  WKDKIIKGNSISVLEKLPAKSVDL+FADPPYNLQLNG+L+RP
Sbjct: 1   MNKKSRLVIDQNKNSILSWKDKIIKGNSISVLEKLPAKSVDLVFADPPYNLQLNGKLHRP 60

Query: 61  DHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQN 120
           D+SLV+AVTDSWDKFSSFEAYDAFTRAWLLAC+RVLKP+GTLWVIGSYHNIFRIG MLQN
Sbjct: 61  DNSLVNAVTDSWDKFSSFEAYDAFTRAWLLACQRVLKPSGTLWVIGSYHNIFRIGAMLQN 120

Query: 121 LNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQM 180
           LNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPK+KGYTFNYDALKAANEDVQM
Sbjct: 121 LNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKSKGYTFNYDALKAANEDVQM 180

Query: 181 RSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAV 240
           RSDWL PICSG+ERLRNKDGEKLH TQKPE+LLSRIL SSTKPGD +LDPFFGSGT+GAV
Sbjct: 181 RSDWLFPICSGAERLRNKDGEKLHATQKPESLLSRILTSSTKPGDFVLDPFFGSGTTGAV 240

Query: 241 AKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQ 300
           AKKL RSF+GIEM+QDYIDIATKRI SV+PLGNIELTVLTGK+ EPRVAFNLLVERG+IQ
Sbjct: 241 AKKLGRSFLGIEMEQDYIDIATKRIESVKPLGNIELTVLTGKKAEPRVAFNLLVERGIIQ 300

Query: 301 PGQILTNAQGNISATVCADGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHS 360
            GQ+LTNAQ NISA V  DGTL+SG E GSIHRVGAKVSG ETCNGWNFWYFEK G+LHS
Sbjct: 301 AGQVLTNAQRNISAIVRVDGTLVSGVESGSIHRVGAKVSGLETCNGWNFWYFEKYGKLHS 360

Query: 361 INTLRILVRKELY 373
           I+TLR LVRKELY
Sbjct: 361 IDTLRSLVRKELY 373


>gi|325292178|ref|YP_004278042.1| adenine DNA methyltransferase [Agrobacterium sp. H13-3]
 gi|325060031|gb|ADY63722.1| adenine DNA methyltransferase [Agrobacterium sp. H13-3]
          Length = 380

 Score =  573 bits (1477), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 259/354 (73%), Positives = 307/354 (86%)

Query: 19  WKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSF 78
           WKD IIKG+ ++ L+ LP++SVD IFADPPYNLQL G L+RPD SLVDAV D WD+FSSF
Sbjct: 24  WKDSIIKGDCVAALDALPSQSVDAIFADPPYNLQLGGTLHRPDQSLVDAVDDEWDQFSSF 83

Query: 79  EAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
           EAYDAFTRAWLLACRRVLKPNGT+WVIGSYHNIFR+G+MLQNL+FWILNDIVWRK+NPMP
Sbjct: 84  EAYDAFTRAWLLACRRVLKPNGTIWVIGSYHNIFRVGSMLQNLDFWILNDIVWRKTNPMP 143

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
           NF+GRRFQNAHET+IWAS  PKAKGYTFNY+ALKA+N+DVQMRSDWL PICSG ERL+  
Sbjct: 144 NFKGRRFQNAHETMIWASRDPKAKGYTFNYEALKASNDDVQMRSDWLFPICSGHERLKGD 203

Query: 199 DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYI 258
           DG+K+HPTQKPEALL+RI+++STKPGDI+LDPFFGSGT+GAVAK+L R F+GIE +QDYI
Sbjct: 204 DGKKVHPTQKPEALLARIIMASTKPGDIVLDPFFGSGTTGAVAKRLGRHFVGIEREQDYI 263

Query: 259 DIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCA 318
           D A+ RIA+V+PLG  ELTV+TGKR EPRVAFN LVE GL++PGQ+LT+A+   SA + A
Sbjct: 264 DAASARIAAVEPLGKAELTVMTGKRAEPRVAFNTLVESGLVRPGQVLTDAKRRYSAIIRA 323

Query: 319 DGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           DGT+ SG   GSIHR+GAKV G + CNGW FW+FE   +L  I+ LR ++R EL
Sbjct: 324 DGTIASGGTAGSIHRLGAKVQGLDACNGWTFWHFEDGDQLKPIDDLRTIIRSEL 377


>gi|116250848|ref|YP_766686.1| modification methylase [Rhizobium leguminosarum bv. viciae 3841]
 gi|115255496|emb|CAK06572.1| putative modification methylase [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 380

 Score =  566 bits (1459), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 257/354 (72%), Positives = 305/354 (86%)

Query: 19  WKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSF 78
           W D IIKG+ +S LE LP+ SVD+IFADPPYNLQL G L+RPD SLVDAV D WD+F+SF
Sbjct: 23  WVDTIIKGDCVSALEALPSHSVDIIFADPPYNLQLGGTLHRPDQSLVDAVDDDWDQFASF 82

Query: 79  EAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
           EAYDAFTRAWLLACRRVLKP G++WVIGSYHNIFR+G  LQ+LNFWILNDI+WRK+NPMP
Sbjct: 83  EAYDAFTRAWLLACRRVLKPTGSIWVIGSYHNIFRVGATLQDLNFWILNDIIWRKTNPMP 142

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
           NF+GRRFQNAHET+IWASPS KAKGYTFNYDALKAAN+DVQMRSDWL PIC+GSERL+ +
Sbjct: 143 NFKGRRFQNAHETMIWASPSAKAKGYTFNYDALKAANDDVQMRSDWLFPICNGSERLKGE 202

Query: 199 DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYI 258
           DG+K HPTQKPEALL+R++++STKPGDI+LDPFFGSGT+GAVAK+L R F+GIE +QDYI
Sbjct: 203 DGKKAHPTQKPEALLARVIMASTKPGDIVLDPFFGSGTTGAVAKRLGRHFVGIEREQDYI 262

Query: 259 DIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCA 318
           D A+ RIA+V+PLG  ELTV+TGK+ E RVAFN+LVE GLI+PGQ+LT+A+   SA V A
Sbjct: 263 DAASARIAAVEPLGKAELTVMTGKKAEVRVAFNVLVESGLIKPGQVLTDARRRYSAIVRA 322

Query: 319 DGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           DGT+ SG E GSIHR+GAKV G + CNGW FW+FE    L  I+ LR ++R +L
Sbjct: 323 DGTVASGGEAGSIHRLGAKVQGLDACNGWTFWHFEDGQSLRPIDDLRSVIRSDL 376


>gi|241203450|ref|YP_002974546.1| DNA methylase N-4/N-6 domain protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240857340|gb|ACS55007.1| DNA methylase N-4/N-6 domain protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 379

 Score =  566 bits (1459), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 257/354 (72%), Positives = 305/354 (86%)

Query: 19  WKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSF 78
           W D IIKG+ +S LE LP+ SVD+IFADPPYNLQL G L+RPD SLVDAV D WD+F+SF
Sbjct: 23  WVDTIIKGDCVSALEALPSHSVDIIFADPPYNLQLGGTLHRPDQSLVDAVDDEWDQFASF 82

Query: 79  EAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
           EAYDAFTRAWLLACRRVLKP G++WVIGSYHNIFR+G  LQ+LNFWILNDI+WRK+NPMP
Sbjct: 83  EAYDAFTRAWLLACRRVLKPTGSIWVIGSYHNIFRVGATLQDLNFWILNDIIWRKTNPMP 142

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
           NF+GRRFQNAHET+IWASPS KAKGYTFNYDALKAAN+DVQMRSDWL PIC+GSERL+ +
Sbjct: 143 NFKGRRFQNAHETMIWASPSAKAKGYTFNYDALKAANDDVQMRSDWLFPICNGSERLKGE 202

Query: 199 DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYI 258
           DG+K HPTQKPEALL+R++++STKPGDI+LDPFFGSGT+GAVAK+L R F+GIE +QDYI
Sbjct: 203 DGKKAHPTQKPEALLARVIMASTKPGDIVLDPFFGSGTTGAVAKRLGRHFVGIEREQDYI 262

Query: 259 DIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCA 318
           D A+ RIA+V+PLG  ELTV+TGK+ E RVAFN+LVE GLI+PGQ+LT+A+   SA V A
Sbjct: 263 DAASARIAAVEPLGKAELTVMTGKKAEVRVAFNVLVESGLIKPGQVLTDARRRYSAIVRA 322

Query: 319 DGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           DGT+ SG E GSIHR+GAKV G + CNGW FW+FE    L  I+ LR ++R +L
Sbjct: 323 DGTVASGGEAGSIHRLGAKVQGLDACNGWTFWHFEDGQSLRPIDDLRSVIRSDL 376


>gi|159184467|ref|NP_353817.2| cell cycle regulated site-specific DNA-methyltransferase protein
           [Agrobacterium tumefaciens str. C58]
 gi|159139778|gb|AAK86602.2| cell cycle regulated site-specific DNA-methyltransferase protein
           [Agrobacterium tumefaciens str. C58]
          Length = 381

 Score =  566 bits (1458), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 255/354 (72%), Positives = 303/354 (85%)

Query: 19  WKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSF 78
           WKD IIKG+ ++ L+ LP++SVD IFADPPYNLQL G L+RPD SLVDAV D WD+F+SF
Sbjct: 24  WKDSIIKGDCVAALDALPSQSVDAIFADPPYNLQLGGTLHRPDQSLVDAVDDEWDQFASF 83

Query: 79  EAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
           +AYDAFTRAWLLACRRVLKPNGT+WVIGSYHNIFR+G MLQNL+FWILNDIVWRK+NPMP
Sbjct: 84  DAYDAFTRAWLLACRRVLKPNGTIWVIGSYHNIFRVGAMLQNLDFWILNDIVWRKTNPMP 143

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
           NF+GRRFQNAHET+IWAS  PKAK YTFNYDALKA+N+DVQMRSDWL PICSG ERL+  
Sbjct: 144 NFKGRRFQNAHETMIWASRDPKAKSYTFNYDALKASNDDVQMRSDWLFPICSGHERLKGD 203

Query: 199 DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYI 258
           DG+K+HPTQKPEALL+RI+++STKPGDI+LDPFFGSGT+GAVAK+L R F+GIE +QDYI
Sbjct: 204 DGKKVHPTQKPEALLARIIMASTKPGDIVLDPFFGSGTTGAVAKRLGRHFVGIEREQDYI 263

Query: 259 DIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCA 318
           D A+ RI +V+PLG  ELTV+TGK+ EPRVAFN LVE GL++PGQ+LT+A+   SA + A
Sbjct: 264 DAASARITAVEPLGKAELTVMTGKKAEPRVAFNTLVESGLVRPGQVLTDARRRYSAIIRA 323

Query: 319 DGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           DGTL SG   GSIHR+GAKV G + CNGW FW+FE    L  I+ LR ++R E+
Sbjct: 324 DGTLASGGTAGSIHRLGAKVQGLDACNGWTFWHFEDGDALKPIDDLRTIIRSEM 377


>gi|14091014|gb|AAK53552.1|AF327563_1 cell cycle-regulated methyltransferase CcrM [Agrobacterium
           tumefaciens]
          Length = 381

 Score =  565 bits (1455), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 254/354 (71%), Positives = 302/354 (85%)

Query: 19  WKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSF 78
           WKD IIKG+ ++ L+ LP++SVD IFADPPYNLQL G L+RPD SLVDAV D WD+F+SF
Sbjct: 24  WKDSIIKGDCVAALDALPSQSVDAIFADPPYNLQLGGTLHRPDQSLVDAVDDEWDQFASF 83

Query: 79  EAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
           +AYDAFTRAWLLACRRVLKPNGT+WVIGSYHNIFR+G MLQNL+FWILNDIVWRK+NPMP
Sbjct: 84  DAYDAFTRAWLLACRRVLKPNGTIWVIGSYHNIFRVGAMLQNLDFWILNDIVWRKTNPMP 143

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
           NF+GRRFQNAHET+IWAS  PKAK YTFNYDALKA+N+DVQMRSDWL PICSG ERL+  
Sbjct: 144 NFKGRRFQNAHETMIWASRDPKAKSYTFNYDALKASNDDVQMRSDWLFPICSGHERLKGD 203

Query: 199 DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYI 258
           DG+K+HPTQKPEALL+RI+++STKPGDI+LDPFFGSGT+GAVAK+L R F+GIE +QDYI
Sbjct: 204 DGKKVHPTQKPEALLARIIMASTKPGDIVLDPFFGSGTTGAVAKRLGRHFVGIEREQDYI 263

Query: 259 DIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCA 318
           D A+ RI +V+PLG  ELTV+TGK+ EPRVAFN LVE G ++PGQ+LT+A+   SA + A
Sbjct: 264 DAASARITAVEPLGKAELTVMTGKKAEPRVAFNTLVESGFVRPGQVLTDARRRYSAIIRA 323

Query: 319 DGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           DGTL SG   GSIHR+GAKV G + CNGW FW+FE    L  I+ LR ++R E+
Sbjct: 324 DGTLASGGTAGSIHRLGAKVQGLDACNGWTFWHFEDGDALKPIDDLRTIIRSEM 377


>gi|86356641|ref|YP_468533.1| site-specific DNA-methyltransferase (adenine-specific) protein
           [Rhizobium etli CFN 42]
 gi|86280743|gb|ABC89806.1| site-specific DNA-methyltransferase (adenine-specific) protein
           [Rhizobium etli CFN 42]
          Length = 380

 Score =  562 bits (1449), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 254/354 (71%), Positives = 305/354 (86%)

Query: 19  WKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSF 78
           W D IIKG+ +S LE LP  SVD+IFADPPYNLQL G L+RPD SLVDAV D WD+F+SF
Sbjct: 23  WVDTIIKGDCVSALEALPTHSVDVIFADPPYNLQLGGTLHRPDQSLVDAVDDEWDQFASF 82

Query: 79  EAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
           EAYDAFTRAWLLACRRVLKP G++WVIGSYHNIFR+G  LQ+LNFWILNDI+WRK+NPMP
Sbjct: 83  EAYDAFTRAWLLACRRVLKPTGSIWVIGSYHNIFRVGATLQDLNFWILNDIIWRKTNPMP 142

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
           NF+GRRFQNAHET+IWASP+ KAKGYTFNYDA+KAAN+DVQMRSDWL PIC+G+ERL+ +
Sbjct: 143 NFKGRRFQNAHETMIWASPNAKAKGYTFNYDAMKAANDDVQMRSDWLFPICNGNERLKGE 202

Query: 199 DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYI 258
           DG+K+HPTQKPEALL+R++++STKPGDI+LDPFFGSGT+GAVAK+L R F+GIE +QDYI
Sbjct: 203 DGKKVHPTQKPEALLARVIMASTKPGDIVLDPFFGSGTTGAVAKRLGRHFVGIEREQDYI 262

Query: 259 DIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCA 318
           D A+ RIA+V+PLG  ELTV+TGK+ E RVAFN+LVE GLI+PGQ+LT+A+   SA V A
Sbjct: 263 DAASARIAAVEPLGKAELTVMTGKKAEVRVAFNVLVESGLIKPGQVLTDAKRRYSAIVRA 322

Query: 319 DGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           DGT+ SG E GSIHR+GAKV G + CNGW FW+FE    L  I+ LR ++R +L
Sbjct: 323 DGTVASGGEAGSIHRLGAKVQGLDACNGWTFWHFEDGQSLRPIDDLRSVIRSDL 376


>gi|218510491|ref|ZP_03508369.1| site-specific DNA-methyltransferase (adenine-specific) protein
           [Rhizobium etli Brasil 5]
 gi|327191944|gb|EGE58926.1| site-specific DNA-methyltransferase (adenine-specific) protein
           [Rhizobium etli CNPAF512]
          Length = 380

 Score =  562 bits (1449), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 254/354 (71%), Positives = 305/354 (86%)

Query: 19  WKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSF 78
           W D IIKG+ +S LE LP  SVD+IFADPPYNLQL G L+RPD SLVDAV D WD+F+SF
Sbjct: 23  WIDTIIKGDCVSALEALPTHSVDVIFADPPYNLQLGGTLHRPDQSLVDAVDDEWDQFASF 82

Query: 79  EAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
           EAYDAFTRAWLLACRRVLKP G++WVIGSYHNIFR+G  LQ+LNFWILNDI+WRK+NPMP
Sbjct: 83  EAYDAFTRAWLLACRRVLKPTGSIWVIGSYHNIFRVGATLQDLNFWILNDIIWRKTNPMP 142

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
           NF+GRRFQNAHET+IWASP+ KAKGYTFNYDA+KAAN+DVQMRSDWL PIC+G+ERL+ +
Sbjct: 143 NFKGRRFQNAHETMIWASPNAKAKGYTFNYDAMKAANDDVQMRSDWLFPICNGNERLKGE 202

Query: 199 DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYI 258
           DG+K+HPTQKPEALL+R++++STKPGDI+LDPFFGSGT+GAVAK+L R F+GIE +QDYI
Sbjct: 203 DGKKVHPTQKPEALLARVIMASTKPGDIVLDPFFGSGTTGAVAKRLGRHFVGIEREQDYI 262

Query: 259 DIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCA 318
           D A+ RIA+V+PLG  ELTV+TGK+ E RVAFN+LVE GLI+PGQ+LT+A+   SA V A
Sbjct: 263 DAASARIAAVEPLGKAELTVMTGKKAEVRVAFNVLVESGLIKPGQVLTDAKRRYSAIVRA 322

Query: 319 DGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           DGT+ SG E GSIHR+GAKV G + CNGW FW+FE    L  I+ LR ++R +L
Sbjct: 323 DGTVASGGEAGSIHRLGAKVQGLDACNGWTFWHFEDGQSLRPIDDLRSVIRSDL 376


>gi|190890705|ref|YP_001977247.1| site-specific DNA-methyltransferase (adenine-specific) protein
           [Rhizobium etli CIAT 652]
 gi|190695984|gb|ACE90069.1| site-specific DNA-methyltransferase (adenine-specific) protein
           [Rhizobium etli CIAT 652]
          Length = 380

 Score =  562 bits (1449), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 254/354 (71%), Positives = 305/354 (86%)

Query: 19  WKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSF 78
           W D IIKG+ +S LE LP  SVD+IFADPPYNLQL G L+RPD SLVDAV D WD+F+SF
Sbjct: 23  WIDTIIKGDCVSALEALPTHSVDVIFADPPYNLQLGGTLHRPDQSLVDAVDDEWDQFASF 82

Query: 79  EAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
           EAYDAFTRAWLLACRRVLKP G++WVIGSYHNIFR+G  LQ+LNFWILNDI+WRK+NPMP
Sbjct: 83  EAYDAFTRAWLLACRRVLKPTGSIWVIGSYHNIFRVGATLQDLNFWILNDIIWRKTNPMP 142

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
           NF+GRRFQNAHET+IWASP+ KAKGYTFNYDA+KAAN+DVQMRSDWL PIC+G+ERL+ +
Sbjct: 143 NFKGRRFQNAHETMIWASPNAKAKGYTFNYDAMKAANDDVQMRSDWLFPICNGNERLKGE 202

Query: 199 DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYI 258
           DG+K+HPTQKPEALL+R++++STKPGDI+LDPFFGSGT+GAVAK+L R F+GIE +QDYI
Sbjct: 203 DGKKVHPTQKPEALLARVIMASTKPGDIVLDPFFGSGTTGAVAKRLGRHFVGIEREQDYI 262

Query: 259 DIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCA 318
           D A+ RIA+V+PLG  ELTV+TGK+ E RVAFN+LVE GLI+PGQ+LT+A+   SA V A
Sbjct: 263 DAASARIAAVEPLGKAELTVMTGKKAEVRVAFNVLVESGLIKPGQVLTDAKRRYSAIVRA 322

Query: 319 DGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           DGT+ SG E GSIHR+GAKV G + CNGW FW+FE    L  I+ LR ++R +L
Sbjct: 323 DGTVASGGEAGSIHRLGAKVQGLDACNGWTFWHFEDGQSLRPIDDLRSVIRSDL 376


>gi|209548255|ref|YP_002280172.1| DNA methylase N-4/N-6 [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209534011|gb|ACI53946.1| DNA methylase N-4/N-6 domain protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 380

 Score =  561 bits (1445), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 253/354 (71%), Positives = 305/354 (86%)

Query: 19  WKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSF 78
           W D IIKG+ +S LE LP  SVD+IFADPPYNLQL G L+RPD SLVDAV D WD+F+SF
Sbjct: 23  WVDTIIKGDCVSALEALPTHSVDVIFADPPYNLQLGGTLHRPDQSLVDAVDDEWDQFASF 82

Query: 79  EAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
           EAYDAFTRAWLLACRRVLKP G++WVIGSYHNIFR+G  LQ+LNFWILNDI+WRK+NPMP
Sbjct: 83  EAYDAFTRAWLLACRRVLKPTGSIWVIGSYHNIFRVGATLQDLNFWILNDIIWRKTNPMP 142

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
           NF+GRRFQNAHET+IWASP+ KAKGYTFNYDA+KAAN+DVQMRSDWL PIC+G+ERL+ +
Sbjct: 143 NFKGRRFQNAHETMIWASPNAKAKGYTFNYDAMKAANDDVQMRSDWLFPICNGNERLKGE 202

Query: 199 DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYI 258
           DG+K+HPTQKPEALL+R++++STKPGDI+LDPFFGSGT+GAVAK+L R F+GIE +QDYI
Sbjct: 203 DGKKVHPTQKPEALLARVIMASTKPGDIVLDPFFGSGTTGAVAKRLGRHFVGIEREQDYI 262

Query: 259 DIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCA 318
           D A+ RIA+V+PLG  ELTV+TGK+ E RVAFN+LVE GLI+PGQ+LT+A+   SA V A
Sbjct: 263 DAASARIAAVEPLGKAELTVMTGKKAEVRVAFNVLVESGLIKPGQVLTDAKRRYSAIVRA 322

Query: 319 DGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           DGT+ SG + GSIHR+GAKV G + CNGW FW+FE    L  I+ LR ++R +L
Sbjct: 323 DGTVASGGDAGSIHRLGAKVQGLDACNGWTFWHFEDGQSLRPIDDLRSVIRSDL 376


>gi|227821131|ref|YP_002825101.1| modification methylase SmeIP [Sinorhizobium fredii NGR234]
 gi|227340130|gb|ACP24348.1| modification methylase SmeIP [Sinorhizobium fredii NGR234]
          Length = 376

 Score =  560 bits (1444), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 257/372 (69%), Positives = 307/372 (82%)

Query: 1   MSQKNSLAINENQNSIFEWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRP 60
           MS   SLA          W D IIKG+ ++ L  LP  SVD++FADPPYNLQL G L+RP
Sbjct: 1   MSSVVSLAEISRAARPLSWLDSIIKGDCVAALNALPDNSVDVVFADPPYNLQLGGMLHRP 60

Query: 61  DHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQN 120
           D SLVDAV D WD+F+SFEAYDAFTRAWLLACRRVLKP GTLWVIGSYHNIFR+G +LQ+
Sbjct: 61  DQSLVDAVDDEWDQFASFEAYDAFTRAWLLACRRVLKPTGTLWVIGSYHNIFRVGAILQD 120

Query: 121 LNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQM 180
           L+FWILNDI+WRK+NPMPNF+GRRFQNAHETLIWA+P+ KAKGYTFNY+A+KAAN+DVQM
Sbjct: 121 LHFWILNDIIWRKTNPMPNFKGRRFQNAHETLIWATPNAKAKGYTFNYEAMKAANDDVQM 180

Query: 181 RSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAV 240
           RSDWL PICSG ERL+  DG+K+HPTQKPEALL+RIL++STKPGD++LDPFFGSGT+GAV
Sbjct: 181 RSDWLFPICSGGERLKGDDGKKVHPTQKPEALLARILMASTKPGDVVLDPFFGSGTTGAV 240

Query: 241 AKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQ 300
           AK+L R F+GIE +QDYID A +RIA+V+PLG   L+V+TGK+ EPRVAFN L+E GLI+
Sbjct: 241 AKRLGRHFVGIEREQDYIDAAAERIAAVEPLGKATLSVMTGKKAEPRVAFNTLIESGLIK 300

Query: 301 PGQILTNAQGNISATVCADGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHS 360
           PG +LT+A+   SA V ADGTL SG E GSIHR+GAKV G + CNGW FW+FE  G L  
Sbjct: 301 PGTVLTDAKRRYSAIVRADGTLASGGEAGSIHRLGAKVQGLDACNGWTFWHFEAGGTLKP 360

Query: 361 INTLRILVRKEL 372
           I+ LR ++R +L
Sbjct: 361 IDELRSVIRNDL 372


>gi|15964679|ref|NP_385032.1| adenine DNA methyltransferase protein [Sinorhizobium meliloti 1021]
 gi|307304257|ref|ZP_07584009.1| DNA methylase N-4/N-6 domain protein [Sinorhizobium meliloti
           BL225C]
 gi|307320562|ref|ZP_07599977.1| DNA methylase N-4/N-6 domain protein [Sinorhizobium meliloti AK83]
 gi|7387561|sp|O30569|MTS1_RHIME RecName: Full=Modification methylase SmeI; Short=M.SmeI; AltName:
           Full=Adenine-specific methyltransferase SmeIP; AltName:
           Full=M.CcrMI ortholog; AltName: Full=Modification
           methylase SmeIP; Short=M.SmeIP
 gi|15073857|emb|CAC45498.1| Adenine DNA methyltransferase [Sinorhizobium meliloti 1021]
 gi|306893838|gb|EFN24609.1| DNA methylase N-4/N-6 domain protein [Sinorhizobium meliloti AK83]
 gi|306902725|gb|EFN33318.1| DNA methylase N-4/N-6 domain protein [Sinorhizobium meliloti
           BL225C]
          Length = 376

 Score =  560 bits (1443), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 257/372 (69%), Positives = 308/372 (82%)

Query: 1   MSQKNSLAINENQNSIFEWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRP 60
           MS   SLA          W D IIKG+ ++ L  LP  SVD++FADPPYNLQL G L+RP
Sbjct: 1   MSSVVSLAEISRAARPLNWLDSIIKGDCVAALNALPDHSVDVVFADPPYNLQLGGTLHRP 60

Query: 61  DHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQN 120
           D SLVDAV D WD+F+SFEAYDAFTRAWLLACRRVLKP GTLWVIGSYHNIFR+G +LQ+
Sbjct: 61  DQSLVDAVDDDWDQFASFEAYDAFTRAWLLACRRVLKPTGTLWVIGSYHNIFRVGAILQD 120

Query: 121 LNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQM 180
           L+FW+LNDI+WRK+NPMPNF+GRRFQNAHETLIWA+P+ KAKGYTFNY+A+KAAN+DVQM
Sbjct: 121 LHFWVLNDIIWRKTNPMPNFKGRRFQNAHETLIWATPNAKAKGYTFNYEAMKAANDDVQM 180

Query: 181 RSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAV 240
           RSDWL PICSGSERL+  DG+K+HPTQKPEALL+RIL++STKPGD++LDPFFGSGT+GAV
Sbjct: 181 RSDWLFPICSGSERLKGDDGKKVHPTQKPEALLARILMASTKPGDVVLDPFFGSGTTGAV 240

Query: 241 AKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQ 300
           AK+L R F+GIE +QDYID A +RIA+V+PLG   L+V+TGK+ EPRVAFN LVE GLI+
Sbjct: 241 AKRLGRHFVGIEREQDYIDAAAERIAAVEPLGKATLSVMTGKKAEPRVAFNTLVESGLIK 300

Query: 301 PGQILTNAQGNISATVCADGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHS 360
           PG +LT+A+   SA V ADGTL SG E GSIHR+GAKV G + CNGW FW+FE+   L  
Sbjct: 301 PGTVLTDAKRRYSAIVRADGTLASGGEAGSIHRLGAKVQGLDACNGWTFWHFEEGSVLKP 360

Query: 361 INTLRILVRKEL 372
           I+ LR ++R +L
Sbjct: 361 IDELRSVIRNDL 372


>gi|222147821|ref|YP_002548778.1| cell cycle regulated site-specific DNA-methyltransferase protein
           [Agrobacterium vitis S4]
 gi|221734809|gb|ACM35772.1| cell cycle regulated site-specific DNA-methyltransferase protein
           [Agrobacterium vitis S4]
          Length = 377

 Score =  558 bits (1439), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 254/372 (68%), Positives = 311/372 (83%)

Query: 1   MSQKNSLAINENQNSIFEWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRP 60
           M+    LA     N  F W + IIKG+ ++ LE LP +SVD IFADPPYNLQL G L+RP
Sbjct: 1   MASVFPLADLRRSNDPFAWMNSIIKGDCVAALEALPDQSVDAIFADPPYNLQLGGMLHRP 60

Query: 61  DHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQN 120
           D S+VDAV D+WD+F+SFEAYDAFTRAWLLACRRVLKP+GT+WVIGSYHNIFR+G  LQ+
Sbjct: 61  DQSVVDAVDDAWDQFASFEAYDAFTRAWLLACRRVLKPHGTIWVIGSYHNIFRVGATLQD 120

Query: 121 LNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQM 180
           LNFWILNDIVWRK+NPMPNF+GRRFQNAHET+IWAS   KAK YTFNYDALKA+N+DVQM
Sbjct: 121 LNFWILNDIVWRKTNPMPNFKGRRFQNAHETMIWASRDAKAKSYTFNYDALKASNDDVQM 180

Query: 181 RSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAV 240
           RSDWL PICSG ERL+ +DG+K+HPTQKPEALL+R++++STKPGD++LDPFFGSGT+GAV
Sbjct: 181 RSDWLFPICSGGERLKGEDGKKIHPTQKPEALLARVILASTKPGDVVLDPFFGSGTTGAV 240

Query: 241 AKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQ 300
           AK+L R+F+GIE +QDYID A+ RI +V+ LG +ELTVLTGK++EPRVAFN L++ GL+Q
Sbjct: 241 AKRLGRNFVGIEREQDYIDAASARIDAVEALGKVELTVLTGKKSEPRVAFNTLLDSGLLQ 300

Query: 301 PGQILTNAQGNISATVCADGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHS 360
           PGQ+L+  +   SA + ADGTL+SGT+ GSIHRVGAKV G + CNGW FW++E  G+L  
Sbjct: 301 PGQVLSCEKRRHSAIIRADGTLVSGTQAGSIHRVGAKVRGLDACNGWTFWHYEDAGKLKP 360

Query: 361 INTLRILVRKEL 372
           I+ LR LVR  +
Sbjct: 361 IDDLRSLVRASM 372


>gi|222085157|ref|YP_002543687.1| cell cycle regulated site-specific DNA-methyltransferase protein
           [Agrobacterium radiobacter K84]
 gi|221722605|gb|ACM25761.1| cell cycle regulated site-specific DNA-methyltransferase protein
           [Agrobacterium radiobacter K84]
          Length = 376

 Score =  557 bits (1436), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 251/354 (70%), Positives = 302/354 (85%)

Query: 19  WKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSF 78
           W D IIKG+ ++ LE LP  SVD+IFADPPYNLQL G L+RPD SLVDAV D WD+F+SF
Sbjct: 19  WVDTIIKGDCVAALEALPTHSVDVIFADPPYNLQLGGTLHRPDQSLVDAVDDEWDQFASF 78

Query: 79  EAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
           EAYDAFTRAWLLACRRVLKP GT+WVIGSYHNIFR+G  +Q+LNFWILNDIVWRK+NPMP
Sbjct: 79  EAYDAFTRAWLLACRRVLKPTGTIWVIGSYHNIFRVGATMQDLNFWILNDIVWRKTNPMP 138

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
           NF+GRRFQNAHET+IWASP+ K KGYTFNYDA+KAAN+DVQMRSDWL PIC+G ERL+  
Sbjct: 139 NFKGRRFQNAHETMIWASPNAKTKGYTFNYDAMKAANDDVQMRSDWLFPICNGGERLKGD 198

Query: 199 DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYI 258
           DG+K+HPTQKPEALL+R++++S+KPGDIILDPFFGSGT+GAVAK+L R F+GIE +QDYI
Sbjct: 199 DGKKVHPTQKPEALLARVIMASSKPGDIILDPFFGSGTTGAVAKRLGRHFVGIEREQDYI 258

Query: 259 DIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCA 318
           D A+ RIASV+PLG  ELTV+TGK+ E RVAFN+LVE GLI+PGQ+LT+A+   SA V A
Sbjct: 259 DAASARIASVEPLGKAELTVMTGKKAEARVAFNVLVESGLIKPGQVLTDARRRHSAIVRA 318

Query: 319 DGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           DGT+ +G E GSIHR+GAKV G + CNGW FW+F+    L  I+ LR ++R ++
Sbjct: 319 DGTVAAGGEAGSIHRLGAKVQGLDACNGWTFWHFDDGQSLRPIDELRAIIRNDM 372


>gi|150395765|ref|YP_001326232.1| DNA methylase N-4/N-6 domain-containing protein [Sinorhizobium
           medicae WSM419]
 gi|150027280|gb|ABR59397.1| DNA methylase N-4/N-6 domain protein [Sinorhizobium medicae WSM419]
          Length = 398

 Score =  557 bits (1436), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 256/372 (68%), Positives = 307/372 (82%)

Query: 1   MSQKNSLAINENQNSIFEWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRP 60
           MS   SLA          W D IIKG+ ++ L  LP  SVD++FADPPYNLQL G L+RP
Sbjct: 23  MSSVVSLAEISRAARPLNWLDSIIKGDCVAALNALPDNSVDVVFADPPYNLQLGGTLHRP 82

Query: 61  DHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQN 120
           D SLVDAV D WD+F+SFEAYDAFTRAWLLACRRVLKP GTLWVIGSYHNIFR+G +LQ+
Sbjct: 83  DQSLVDAVDDDWDQFASFEAYDAFTRAWLLACRRVLKPTGTLWVIGSYHNIFRVGAILQD 142

Query: 121 LNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQM 180
           L+FW+LNDI+WRK+NPMPNF+GRRFQNAHETLIWA+P+ KAKGYTFNY+A+KAAN+DVQM
Sbjct: 143 LHFWVLNDIIWRKTNPMPNFKGRRFQNAHETLIWATPNAKAKGYTFNYEAMKAANDDVQM 202

Query: 181 RSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAV 240
           RSDWL PICSGSERL+  DG+K+HPTQKPEALL+RIL++STKPGD++LDPFFGSGT+GAV
Sbjct: 203 RSDWLFPICSGSERLKGDDGKKVHPTQKPEALLARILMASTKPGDVVLDPFFGSGTTGAV 262

Query: 241 AKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQ 300
           AK+L R F+GIE +QDYID A +RIA+V+PLG   L+V+TGK+ EPRVAFN L+E GLI+
Sbjct: 263 AKRLGRHFVGIEREQDYIDAAAERIAAVEPLGKATLSVMTGKKAEPRVAFNTLIESGLIK 322

Query: 301 PGQILTNAQGNISATVCADGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHS 360
           PG +LT+A+   SA V ADGTL SG E GSIHR+GAKV G + CNGW FW+FE    L  
Sbjct: 323 PGTVLTDAKRRYSAIVRADGTLASGGEAGSIHRLGAKVQGLDACNGWTFWHFEDGSVLKP 382

Query: 361 INTLRILVRKEL 372
           I+ LR ++R +L
Sbjct: 383 IDELRSVIRNDL 394


>gi|218682477|ref|ZP_03530078.1| site-specific DNA-methyltransferase (adenine-specific) protein
           [Rhizobium etli CIAT 894]
          Length = 380

 Score =  554 bits (1428), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 251/354 (70%), Positives = 302/354 (85%)

Query: 19  WKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSF 78
           W D IIKG+ +S LE LP  SVD+IFADPPYNLQL G L+RPD SLVDAV D WD+F+S 
Sbjct: 23  WVDTIIKGDCVSALEALPNHSVDVIFADPPYNLQLGGSLHRPDQSLVDAVDDEWDQFASL 82

Query: 79  EAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
           EAYDAFTRAWLLACRRVLKP G++WVIGSYHNIFR+G  LQ+LNFWILNDI+WRK+NPMP
Sbjct: 83  EAYDAFTRAWLLACRRVLKPTGSIWVIGSYHNIFRVGATLQDLNFWILNDIIWRKTNPMP 142

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
           NF+GRRFQNAHET+IWASP+ KAKGYTFNYDA+KAAN+DVQMRSDWL PIC+G+ERL+ +
Sbjct: 143 NFKGRRFQNAHETMIWASPNAKAKGYTFNYDAMKAANDDVQMRSDWLFPICNGNERLKGE 202

Query: 199 DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYI 258
           DG+K+HPTQKPEALL+R++++STKPGDI+LDPFFGSGT+GAVAK+L R F+GIE +QDYI
Sbjct: 203 DGKKVHPTQKPEALLARVIMASTKPGDIVLDPFFGSGTTGAVAKRLGRHFVGIEREQDYI 262

Query: 259 DIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCA 318
           D A+ RIA+V+PLG  ELTV+TGK+ E RVAFN+LVE GLI+ GQ+LT+ +   SA V A
Sbjct: 263 DAASARIAAVEPLGKAELTVMTGKKAEVRVAFNVLVESGLIKAGQVLTDVRRRYSAIVRA 322

Query: 319 DGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           DGT+ SG E GSIHR+GAKV G + CNGW FW+FE    L  I+ LR ++R +L
Sbjct: 323 DGTVASGGEAGSIHRLGAKVQGLDACNGWTFWHFEDGQSLRPIDDLRSVIRSDL 376


>gi|2305232|gb|AAB71350.1| adenine DNA methyltransferase [Sinorhizobium meliloti]
          Length = 376

 Score =  544 bits (1402), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 251/372 (67%), Positives = 302/372 (81%)

Query: 1   MSQKNSLAINENQNSIFEWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRP 60
           MS   SLA          W D IIKG+ ++ L  LP  SVD++FADPPYNLQL G L+RP
Sbjct: 1   MSSVVSLAEISRAARPLNWLDSIIKGDCVAALNALPDHSVDVVFADPPYNLQLGGTLHRP 60

Query: 61  DHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQN 120
           D SLVDAV D WD+F+SFEAYDAFTRAWLLACRRVLKP GTLWVIGSYHNIFR+G +LQ+
Sbjct: 61  DQSLVDAVDDDWDQFASFEAYDAFTRAWLLACRRVLKPTGTLWVIGSYHNIFRVGAILQD 120

Query: 121 LNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQM 180
           L+FW+LNDI+WRK+ P    +GRRFQNAHETLIWA+ + KAKGYTFNY+A+KAAN+DVQM
Sbjct: 121 LHFWVLNDIIWRKTQPDAELQGRRFQNAHETLIWATANAKAKGYTFNYEAMKAANDDVQM 180

Query: 181 RSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAV 240
           RSDWL PICSGSERL+  DG+K+HPTQKPEALL+RIL++STKPGD++LDPFFGSGT+GAV
Sbjct: 181 RSDWLFPICSGSERLKGDDGKKVHPTQKPEALLARILMASTKPGDVVLDPFFGSGTTGAV 240

Query: 241 AKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQ 300
           AK+L R F+GIE +QDYID A +RIA+V+PLG   L+V+TGK+ EPRVAFN LVE GLI+
Sbjct: 241 AKRLGRHFVGIEREQDYIDAAAERIAAVEPLGKATLSVMTGKKAEPRVAFNTLVESGLIK 300

Query: 301 PGQILTNAQGNISATVCADGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHS 360
           PG +LT+A+   SA V ADGTL SG E GSIHR+GAKV G + CNGW FW+FE+   L  
Sbjct: 301 PGTVLTDAKRRYSAIVRADGTLASGGEAGSIHRLGAKVQGLDACNGWTFWHFEEGSVLKP 360

Query: 361 INTLRILVRKEL 372
           I+ LR ++R +L
Sbjct: 361 IDELRSVIRNDL 372


>gi|237814961|ref|ZP_04593959.1| Modification methylase HinfI [Brucella abortus str. 2308 A]
 gi|237789798|gb|EEP64008.1| Modification methylase HinfI [Brucella abortus str. 2308 A]
          Length = 403

 Score =  542 bits (1396), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 243/354 (68%), Positives = 299/354 (84%)

Query: 19  WKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSF 78
           W D IIKG+ +S LE+LP  SVD+IFADPPYNLQL G L+RPD S+V AV D WD+F SF
Sbjct: 45  WLDSIIKGDCVSALERLPDHSVDVIFADPPYNLQLGGDLHRPDQSMVSAVDDHWDQFESF 104

Query: 79  EAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
           +AYDAFTRAWLLACRRVLKPNGT+WVIGSYHNIFR+GT LQ+L FW+LNDIVWRK+NPMP
Sbjct: 105 QAYDAFTRAWLLACRRVLKPNGTIWVIGSYHNIFRVGTQLQDLGFWLLNDIVWRKTNPMP 164

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
           NFRGRRFQNAHETLIWAS   K KGYTFNY+A+KAAN+DVQMRSDWL PIC+GSERL+++
Sbjct: 165 NFRGRRFQNAHETLIWASREQKGKGYTFNYEAMKAANDDVQMRSDWLFPICTGSERLKDE 224

Query: 199 DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYI 258
           +G+K+HPTQKPEALL+RI+++S+KPGD+ILDPFFGSGT+GAVAK+L R F+GIE +Q YI
Sbjct: 225 NGDKVHPTQKPEALLARIMMASSKPGDVILDPFFGSGTTGAVAKRLGRHFVGIEREQPYI 284

Query: 259 DIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCA 318
           D AT RI +V+PLG  ELTV+TGKR EPRVAF  ++E GL++PG +L + +   +A V A
Sbjct: 285 DAATARINAVEPLGKAELTVMTGKRAEPRVAFTSVMEAGLLRPGTVLCDERRRFAAIVRA 344

Query: 319 DGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           DGTL +  E GSIHR+GA+V G + CNGW FW+FE+ G L  I+ LR ++R+++
Sbjct: 345 DGTLTANGEAGSIHRIGARVQGFDACNGWTFWHFEENGVLKPIDALRKIIREQM 398


>gi|240850100|ref|YP_002971493.1| adenine DNA methyltransferase [Bartonella grahamii as4aup]
 gi|240267223|gb|ACS50811.1| adenine DNA methyltransferase [Bartonella grahamii as4aup]
          Length = 378

 Score =  542 bits (1396), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 245/358 (68%), Positives = 299/358 (83%)

Query: 15  SIFEWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDK 74
           S   W++KI KG+ +SVLEKLP  SVD+IFADPPYNLQL+G LYRPDHSLVDAV D+WD+
Sbjct: 15  SQMPWRNKIFKGDCVSVLEKLPKHSVDMIFADPPYNLQLDGALYRPDHSLVDAVDDAWDQ 74

Query: 75  FSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKS 134
           F SF AYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFR+GT LQ+L FW+LNDI+WRK+
Sbjct: 75  FESFAAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRVGTALQDLGFWMLNDIIWRKN 134

Query: 135 NPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSER 194
           NPMPNFRGRRFQNAHETLIWA    K K YTFNYDALKAANED+QMRSDWL P+C+G+ER
Sbjct: 135 NPMPNFRGRRFQNAHETLIWAVRDQKDKKYTFNYDALKAANEDLQMRSDWLFPLCTGAER 194

Query: 195 LRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMK 254
           L++  G KLHPTQKP+ALL+RI+++S+KPGD+ILDPFFGSGT+GAVAK L R F+GIE +
Sbjct: 195 LKDDSGRKLHPTQKPQALLARIIMASSKPGDVILDPFFGSGTTGAVAKLLGRDFVGIERE 254

Query: 255 QDYIDIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISA 314
           QDYID A +RIA+V+PL   EL +L  K+ EPRVAFN L+E GL+ PG++L + +  +SA
Sbjct: 255 QDYIDAACERIAAVKPLAQPELAILDRKKAEPRVAFNSLLEAGLLYPGEVLYDRKKQVSA 314

Query: 315 TVCADGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
            V ADGT++ G E GSIH +G K   S++CNGW FWY+E+ G L SI+ LR+++R ++
Sbjct: 315 IVRADGTIMHGGEAGSIHAMGRKAQDSQSCNGWTFWYYEENGRLKSIDHLRMIIRSQM 372


>gi|189023721|ref|YP_001934489.1| Adenine-specific methyltransferase [Brucella abortus S19]
 gi|260754270|ref|ZP_05866618.1| DNA methylase N-4/N-6 domain-containing protein [Brucella abortus
           bv. 6 str. 870]
 gi|260757489|ref|ZP_05869837.1| DNA methylase N-4/N-6 domain-containing protein [Brucella abortus
           bv. 4 str. 292]
 gi|260761313|ref|ZP_05873656.1| DNA methylase N-4/N-6 domain-containing protein [Brucella abortus
           bv. 2 str. 86/8/59]
 gi|260883294|ref|ZP_05894908.1| modification methylase BabI [Brucella abortus bv. 9 str. C68]
 gi|261213516|ref|ZP_05927797.1| DNA methylase N-4/N-6 domain-containing protein [Brucella abortus
           bv. 3 str. Tulya]
 gi|297247885|ref|ZP_06931603.1| adenine-specific DNA-methyltransferase [Brucella abortus bv. 5 str.
           B3196]
 gi|223635297|sp|B2S9Y5|MTB1_BRUA1 RecName: Full=Modification methylase BabI; Short=M.BabI; AltName:
           Full=Adenine-specific methyltransferase BabI; AltName:
           Full=DNA methyltransferase CcrM; AltName: Full=M.CcrMI
           ortholog
 gi|189019293|gb|ACD72015.1| Adenine-specific methyltransferase [Brucella abortus S19]
 gi|260667807|gb|EEX54747.1| DNA methylase N-4/N-6 domain-containing protein [Brucella abortus
           bv. 4 str. 292]
 gi|260671745|gb|EEX58566.1| DNA methylase N-4/N-6 domain-containing protein [Brucella abortus
           bv. 2 str. 86/8/59]
 gi|260674378|gb|EEX61199.1| DNA methylase N-4/N-6 domain-containing protein [Brucella abortus
           bv. 6 str. 870]
 gi|260872822|gb|EEX79891.1| modification methylase BabI [Brucella abortus bv. 9 str. C68]
 gi|260915123|gb|EEX81984.1| DNA methylase N-4/N-6 domain-containing protein [Brucella abortus
           bv. 3 str. Tulya]
 gi|297175054|gb|EFH34401.1| adenine-specific DNA-methyltransferase [Brucella abortus bv. 5 str.
           B3196]
          Length = 386

 Score =  542 bits (1396), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 243/354 (68%), Positives = 299/354 (84%)

Query: 19  WKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSF 78
           W D IIKG+ +S LE+LP  SVD+IFADPPYNLQL G L+RPD S+V AV D WD+F SF
Sbjct: 28  WLDSIIKGDCVSALERLPDHSVDVIFADPPYNLQLGGDLHRPDQSMVSAVDDHWDQFESF 87

Query: 79  EAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
           +AYDAFTRAWLLACRRVLKPNGT+WVIGSYHNIFR+GT LQ+L FW+LNDIVWRK+NPMP
Sbjct: 88  QAYDAFTRAWLLACRRVLKPNGTIWVIGSYHNIFRVGTQLQDLGFWLLNDIVWRKTNPMP 147

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
           NFRGRRFQNAHETLIWAS   K KGYTFNY+A+KAAN+DVQMRSDWL PIC+GSERL+++
Sbjct: 148 NFRGRRFQNAHETLIWASREQKGKGYTFNYEAMKAANDDVQMRSDWLFPICTGSERLKDE 207

Query: 199 DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYI 258
           +G+K+HPTQKPEALL+RI+++S+KPGD+ILDPFFGSGT+GAVAK+L R F+GIE +Q YI
Sbjct: 208 NGDKVHPTQKPEALLARIMMASSKPGDVILDPFFGSGTTGAVAKRLGRHFVGIEREQPYI 267

Query: 259 DIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCA 318
           D AT RI +V+PLG  ELTV+TGKR EPRVAF  ++E GL++PG +L + +   +A V A
Sbjct: 268 DAATARINAVEPLGKAELTVMTGKRAEPRVAFTSVMEAGLLRPGTVLCDERRRFAAIVRA 327

Query: 319 DGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           DGTL +  E GSIHR+GA+V G + CNGW FW+FE+ G L  I+ LR ++R+++
Sbjct: 328 DGTLTANGEAGSIHRIGARVQGFDACNGWTFWHFEENGVLKPIDALRKIIREQM 381


>gi|148560742|ref|YP_001258505.1| modification methylase BabI [Brucella ovis ATCC 25840]
 gi|223635317|sp|A5VP58|MTB1_BRUO2 RecName: Full=Modification methylase BabI; Short=M.BabI; AltName:
           Full=Adenine-specific methyltransferase BabI; AltName:
           Full=DNA methyltransferase CcrM; AltName: Full=M.CcrMI
           ortholog
 gi|148371999|gb|ABQ61978.1| modification methylase BabI [Brucella ovis ATCC 25840]
          Length = 386

 Score =  542 bits (1396), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 243/354 (68%), Positives = 299/354 (84%)

Query: 19  WKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSF 78
           W D IIKG+ +S LE+LP  SVD+IFADPPYNLQL G L+RPD S+V AV D WD+F SF
Sbjct: 28  WLDSIIKGDCVSALERLPDHSVDVIFADPPYNLQLGGDLHRPDQSMVSAVDDHWDQFESF 87

Query: 79  EAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
           +AYDAFTRAWLLACRRVLKPNGT+WVIGSYHNIFR+GT LQ+L FW+LNDIVWRK+NPMP
Sbjct: 88  QAYDAFTRAWLLACRRVLKPNGTIWVIGSYHNIFRVGTQLQDLGFWLLNDIVWRKTNPMP 147

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
           NFRGRRFQNAHETLIWAS   K KGYTFNY+A+KAAN+DVQMRSDWL PIC+GSERL+++
Sbjct: 148 NFRGRRFQNAHETLIWASRDQKGKGYTFNYEAMKAANDDVQMRSDWLFPICTGSERLKDE 207

Query: 199 DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYI 258
           +G+K+HPTQKPEALL+RI+++S+KPGD+ILDPFFGSGT+GAVAK+L R F+GIE +Q YI
Sbjct: 208 NGDKVHPTQKPEALLARIMMASSKPGDVILDPFFGSGTTGAVAKRLGRHFVGIEREQPYI 267

Query: 259 DIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCA 318
           D AT RI +V+PLG  ELTV+TGKR EPRVAF  ++E GL++PG +L + +   +A V A
Sbjct: 268 DAATARINAVEPLGKAELTVMTGKRAEPRVAFTSVMEAGLLRPGTVLCDERRRFAAIVRA 327

Query: 319 DGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           DGTL +  E GSIHR+GA+V G + CNGW FW+FE+ G L  I+ LR ++R+++
Sbjct: 328 DGTLTANGEAGSIHRIGARVQGFDACNGWTFWHFEENGVLKPIDALRKIIREQM 381


>gi|225626998|ref|ZP_03785037.1| Modification methylase HinfI [Brucella ceti str. Cudo]
 gi|225618655|gb|EEH15698.1| Modification methylase HinfI [Brucella ceti str. Cudo]
          Length = 403

 Score =  542 bits (1396), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 243/354 (68%), Positives = 299/354 (84%)

Query: 19  WKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSF 78
           W D IIKG+ +S LE+LP  SVD+IFADPPYNLQL G L+RPD S+V AV D WD+F SF
Sbjct: 45  WLDSIIKGDCVSALERLPDHSVDVIFADPPYNLQLGGDLHRPDQSMVSAVDDHWDQFESF 104

Query: 79  EAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
           +AYDAFTRAWLLACRRVLKPNGT+WVIGSYHNIFR+GT LQ+L FW+LNDIVWRK+NPMP
Sbjct: 105 QAYDAFTRAWLLACRRVLKPNGTIWVIGSYHNIFRVGTQLQDLGFWLLNDIVWRKTNPMP 164

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
           NFRGRRFQNAHETLIWAS   K KGYTFNY+A+KAAN+DVQMRSDWL PIC+GSERL+++
Sbjct: 165 NFRGRRFQNAHETLIWASRDQKGKGYTFNYEAMKAANDDVQMRSDWLFPICTGSERLKDE 224

Query: 199 DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYI 258
           +G+K+HPTQKPEALL+RI+++S+KPGD+ILDPFFGSGT+GAVAK+L R F+GIE +Q YI
Sbjct: 225 NGDKVHPTQKPEALLARIMMASSKPGDVILDPFFGSGTTGAVAKRLGRHFVGIEREQPYI 284

Query: 259 DIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCA 318
           D AT RI +V+PLG  ELTV+TGKR EPRVAF  ++E GL++PG +L + +   +A V A
Sbjct: 285 DAATARINAVEPLGKAELTVMTGKRAEPRVAFTSVMEAGLLRPGTVLCDERRRFAAIVRA 344

Query: 319 DGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           DGTL +  E GSIHR+GA+V G + CNGW FW+FE+ G L  I+ LR ++R+++
Sbjct: 345 DGTLTANGEAGSIHRIGARVQGFDACNGWTFWHFEENGVLKPIDALRKIIREQM 398


>gi|62289472|ref|YP_221265.1| modification methylase BabI [Brucella abortus bv. 1 str. 9-941]
 gi|82699397|ref|YP_413971.1| cytosine-N4-specific DNA-methyltransferase [Brucella melitensis
           biovar Abortus 2308]
 gi|254688783|ref|ZP_05152037.1| cytosine-N4-specific DNA-methyltransferase [Brucella abortus bv. 6
           str. 870]
 gi|254693266|ref|ZP_05155094.1| cytosine-N4-specific DNA-methyltransferase [Brucella abortus bv. 3
           str. Tulya]
 gi|254696912|ref|ZP_05158740.1| cytosine-N4-specific DNA-methyltransferase [Brucella abortus bv. 2
           str. 86/8/59]
 gi|254729815|ref|ZP_05188393.1| cytosine-N4-specific DNA-methyltransferase [Brucella abortus bv. 4
           str. 292]
 gi|256257029|ref|ZP_05462565.1| cytosine-N4-specific DNA-methyltransferase [Brucella abortus bv. 9
           str. C68]
 gi|260545776|ref|ZP_05821517.1| modification methylase BabI [Brucella abortus NCTC 8038]
 gi|88913544|sp|Q2YMK2|MTB1_BRUA2 RecName: Full=Modification methylase BabI; Short=M.BabI; AltName:
           Full=Adenine-specific methyltransferase BabI; AltName:
           Full=DNA methyltransferase CcrM; AltName: Full=M.CcrMI
           ortholog
 gi|90109766|sp|P0C116|MTB1_BRUAB RecName: Full=Modification methylase BabI; Short=M.BabI; AltName:
           Full=Adenine-specific methyltransferase BabI; AltName:
           Full=DNA methyltransferase CcrM; AltName: Full=M.CcrMI
           ortholog
 gi|2305234|gb|AAB71351.1| adenine DNA methyltransferase [Brucella abortus]
 gi|62195604|gb|AAX73904.1| BabI, modification methylase BabI [Brucella abortus bv. 1 str.
           9-941]
 gi|82615498|emb|CAJ10472.1| SAM (and some other nucleotide) binding motif:Site-specific
           DNA-methyltransferase (cytosine-N4-specific):N-6
           Adenine-specific [Brucella melitensis biovar Abortus
           2308]
 gi|260097183|gb|EEW81058.1| modification methylase BabI [Brucella abortus NCTC 8038]
          Length = 377

 Score =  541 bits (1394), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 243/354 (68%), Positives = 299/354 (84%)

Query: 19  WKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSF 78
           W D IIKG+ +S LE+LP  SVD+IFADPPYNLQL G L+RPD S+V AV D WD+F SF
Sbjct: 19  WLDSIIKGDCVSALERLPDHSVDVIFADPPYNLQLGGDLHRPDQSMVSAVDDHWDQFESF 78

Query: 79  EAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
           +AYDAFTRAWLLACRRVLKPNGT+WVIGSYHNIFR+GT LQ+L FW+LNDIVWRK+NPMP
Sbjct: 79  QAYDAFTRAWLLACRRVLKPNGTIWVIGSYHNIFRVGTQLQDLGFWLLNDIVWRKTNPMP 138

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
           NFRGRRFQNAHETLIWAS   K KGYTFNY+A+KAAN+DVQMRSDWL PIC+GSERL+++
Sbjct: 139 NFRGRRFQNAHETLIWASREQKGKGYTFNYEAMKAANDDVQMRSDWLFPICTGSERLKDE 198

Query: 199 DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYI 258
           +G+K+HPTQKPEALL+RI+++S+KPGD+ILDPFFGSGT+GAVAK+L R F+GIE +Q YI
Sbjct: 199 NGDKVHPTQKPEALLARIMMASSKPGDVILDPFFGSGTTGAVAKRLGRHFVGIEREQPYI 258

Query: 259 DIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCA 318
           D AT RI +V+PLG  ELTV+TGKR EPRVAF  ++E GL++PG +L + +   +A V A
Sbjct: 259 DAATARINAVEPLGKAELTVMTGKRAEPRVAFTSVMEAGLLRPGTVLCDERRRFAAIVRA 318

Query: 319 DGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           DGTL +  E GSIHR+GA+V G + CNGW FW+FE+ G L  I+ LR ++R+++
Sbjct: 319 DGTLTANGEAGSIHRIGARVQGFDACNGWTFWHFEENGVLKPIDALRKIIREQM 372


>gi|23501392|ref|NP_697519.1| modification methylase BabI [Brucella suis 1330]
 gi|161618464|ref|YP_001592351.1| modification methylase HinfI [Brucella canis ATCC 23365]
 gi|163842773|ref|YP_001627177.1| modification methylase HinfI [Brucella suis ATCC 23445]
 gi|254701294|ref|ZP_05163122.1| modification methylase HinfI [Brucella suis bv. 5 str. 513]
 gi|254703839|ref|ZP_05165667.1| modification methylase HinfI [Brucella suis bv. 3 str. 686]
 gi|254707782|ref|ZP_05169610.1| modification methylase HinfI [Brucella pinnipedialis M163/99/10]
 gi|254709634|ref|ZP_05171445.1| modification methylase HinfI [Brucella pinnipedialis B2/94]
 gi|254712950|ref|ZP_05174761.1| modification methylase HinfI [Brucella ceti M644/93/1]
 gi|254716696|ref|ZP_05178507.1| modification methylase HinfI [Brucella ceti M13/05/1]
 gi|254718664|ref|ZP_05180475.1| modification methylase HinfI [Brucella sp. 83/13]
 gi|256031127|ref|ZP_05444741.1| modification methylase HinfI [Brucella pinnipedialis M292/94/1]
 gi|256159203|ref|ZP_05457014.1| modification methylase HinfI [Brucella ceti M490/95/1]
 gi|256254530|ref|ZP_05460066.1| modification methylase HinfI [Brucella ceti B1/94]
 gi|256368944|ref|YP_003106450.1| modification methylase BabI [Brucella microti CCM 4915]
 gi|260168258|ref|ZP_05755069.1| modification methylase BabI [Brucella sp. F5/99]
 gi|260566907|ref|ZP_05837377.1| modification methylase BabI [Brucella suis bv. 4 str. 40]
 gi|261218502|ref|ZP_05932783.1| modification methylase BabI [Brucella ceti M13/05/1]
 gi|261221708|ref|ZP_05935989.1| modification methylase BabI [Brucella ceti B1/94]
 gi|261315268|ref|ZP_05954465.1| modification methylase BabI [Brucella pinnipedialis M163/99/10]
 gi|261317167|ref|ZP_05956364.1| modification methylase BabI [Brucella pinnipedialis B2/94]
 gi|261320648|ref|ZP_05959845.1| modification methylase BabI [Brucella ceti M644/93/1]
 gi|261751836|ref|ZP_05995545.1| modification methylase BabI [Brucella suis bv. 5 str. 513]
 gi|261754491|ref|ZP_05998200.1| modification methylase BabI [Brucella suis bv. 3 str. 686]
 gi|261757722|ref|ZP_06001431.1| modification methylase BabI [Brucella sp. F5/99]
 gi|265983646|ref|ZP_06096381.1| modification methylase BabI [Brucella sp. 83/13]
 gi|265988205|ref|ZP_06100762.1| modification methylase BabI [Brucella pinnipedialis M292/94/1]
 gi|265997671|ref|ZP_06110228.1| modification methylase BabI [Brucella ceti M490/95/1]
 gi|294851866|ref|ZP_06792539.1| modification methylase BabI [Brucella sp. NVSL 07-0026]
 gi|306837787|ref|ZP_07470651.1| modification methylase BabI [Brucella sp. NF 2653]
 gi|306845119|ref|ZP_07477699.1| modification methylase BabI [Brucella sp. BO1]
 gi|81847171|sp|Q8G242|MTB1_BRUSU RecName: Full=Modification methylase BabI; Short=M.BabI; AltName:
           Full=Adenine-specific methyltransferase BabI; AltName:
           Full=DNA methyltransferase CcrM; AltName: Full=M.CcrMI
           ortholog
 gi|223635299|sp|B0CKH7|MTB1_BRUSI RecName: Full=Modification methylase BabI; Short=M.BabI; AltName:
           Full=Adenine-specific methyltransferase BabI; AltName:
           Full=DNA methyltransferase CcrM; AltName: Full=M.CcrMI
           ortholog
 gi|223635316|sp|A9M916|MTB1_BRUC2 RecName: Full=Modification methylase BabI; Short=M.BabI; AltName:
           Full=Adenine-specific methyltransferase BabI; AltName:
           Full=DNA methyltransferase CcrM; AltName: Full=M.CcrMI
           ortholog
 gi|23347288|gb|AAN29434.1| modification methylase BabI [Brucella suis 1330]
 gi|161335275|gb|ABX61580.1| Modification methylase HinfI [Brucella canis ATCC 23365]
 gi|163673496|gb|ABY37607.1| Modification methylase HinfI [Brucella suis ATCC 23445]
 gi|255999102|gb|ACU47501.1| modification methylase BabI [Brucella microti CCM 4915]
 gi|260156425|gb|EEW91505.1| modification methylase BabI [Brucella suis bv. 4 str. 40]
 gi|260920292|gb|EEX86945.1| modification methylase BabI [Brucella ceti B1/94]
 gi|260923591|gb|EEX90159.1| modification methylase BabI [Brucella ceti M13/05/1]
 gi|261293338|gb|EEX96834.1| modification methylase BabI [Brucella ceti M644/93/1]
 gi|261296390|gb|EEX99886.1| modification methylase BabI [Brucella pinnipedialis B2/94]
 gi|261304294|gb|EEY07791.1| modification methylase BabI [Brucella pinnipedialis M163/99/10]
 gi|261737706|gb|EEY25702.1| modification methylase BabI [Brucella sp. F5/99]
 gi|261741589|gb|EEY29515.1| modification methylase BabI [Brucella suis bv. 5 str. 513]
 gi|261744244|gb|EEY32170.1| modification methylase BabI [Brucella suis bv. 3 str. 686]
 gi|262552139|gb|EEZ08129.1| modification methylase BabI [Brucella ceti M490/95/1]
 gi|264660402|gb|EEZ30663.1| modification methylase BabI [Brucella pinnipedialis M292/94/1]
 gi|264662238|gb|EEZ32499.1| modification methylase BabI [Brucella sp. 83/13]
 gi|294820455|gb|EFG37454.1| modification methylase BabI [Brucella sp. NVSL 07-0026]
 gi|306274534|gb|EFM56329.1| modification methylase BabI [Brucella sp. BO1]
 gi|306407128|gb|EFM63343.1| modification methylase BabI [Brucella sp. NF 2653]
          Length = 377

 Score =  541 bits (1394), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 243/354 (68%), Positives = 299/354 (84%)

Query: 19  WKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSF 78
           W D IIKG+ +S LE+LP  SVD+IFADPPYNLQL G L+RPD S+V AV D WD+F SF
Sbjct: 19  WLDSIIKGDCVSALERLPDHSVDVIFADPPYNLQLGGDLHRPDQSMVSAVDDHWDQFESF 78

Query: 79  EAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
           +AYDAFTRAWLLACRRVLKPNGT+WVIGSYHNIFR+GT LQ+L FW+LNDIVWRK+NPMP
Sbjct: 79  QAYDAFTRAWLLACRRVLKPNGTIWVIGSYHNIFRVGTQLQDLGFWLLNDIVWRKTNPMP 138

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
           NFRGRRFQNAHETLIWAS   K KGYTFNY+A+KAAN+DVQMRSDWL PIC+GSERL+++
Sbjct: 139 NFRGRRFQNAHETLIWASRDQKGKGYTFNYEAMKAANDDVQMRSDWLFPICTGSERLKDE 198

Query: 199 DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYI 258
           +G+K+HPTQKPEALL+RI+++S+KPGD+ILDPFFGSGT+GAVAK+L R F+GIE +Q YI
Sbjct: 199 NGDKVHPTQKPEALLARIMMASSKPGDVILDPFFGSGTTGAVAKRLGRHFVGIEREQPYI 258

Query: 259 DIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCA 318
           D AT RI +V+PLG  ELTV+TGKR EPRVAF  ++E GL++PG +L + +   +A V A
Sbjct: 259 DAATARINAVEPLGKAELTVMTGKRAEPRVAFTSVMEAGLLRPGTVLCDERRRFAAIVRA 318

Query: 319 DGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           DGTL +  E GSIHR+GA+V G + CNGW FW+FE+ G L  I+ LR ++R+++
Sbjct: 319 DGTLTANGEAGSIHRIGARVQGFDACNGWTFWHFEENGVLKPIDALRKIIREQM 372


>gi|256060624|ref|ZP_05450790.1| modification methylase BabI [Brucella neotomae 5K33]
 gi|261324621|ref|ZP_05963818.1| modification methylase BabI [Brucella neotomae 5K33]
 gi|261300601|gb|EEY04098.1| modification methylase BabI [Brucella neotomae 5K33]
          Length = 377

 Score =  540 bits (1392), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 243/354 (68%), Positives = 299/354 (84%)

Query: 19  WKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSF 78
           W D IIKG+ +S LE+LP  SVD+IFADPPYNLQL G L+RPD S+V AV D WD+F SF
Sbjct: 19  WLDSIIKGDCVSALERLPDHSVDVIFADPPYNLQLGGDLHRPDQSMVSAVDDHWDQFESF 78

Query: 79  EAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
           +AYDAFTRAWLLACRRVLKPNGT+WVIGSYHNIFR+GT LQ+L FW+LNDIVWRK+NPMP
Sbjct: 79  QAYDAFTRAWLLACRRVLKPNGTIWVIGSYHNIFRVGTQLQDLGFWLLNDIVWRKTNPMP 138

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
           NFRGRRFQNAHETLIWAS   K KGYTFNY+A+KAAN+DVQMRSDWL PIC+GSERL+++
Sbjct: 139 NFRGRRFQNAHETLIWASRDQKGKGYTFNYEAMKAANDDVQMRSDWLFPICTGSERLKDE 198

Query: 199 DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYI 258
           +G+K+HPTQKPEALL+RI+++S+KPGD+ILDPFFGSGT+GAVAK+L R F+GIE +Q YI
Sbjct: 199 NGDKVHPTQKPEALLARIMMASSKPGDVILDPFFGSGTTGAVAKRLGRHFVGIEREQPYI 258

Query: 259 DIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCA 318
           D AT RI +V+PLG  ELTV+TGKR EPRVAF  ++E GL++PG +L + +   +A V A
Sbjct: 259 DAATARINAVEPLGKAELTVMTGKRAEPRVAFTSVMEAGLLRPGIVLCDERRRFAAIVRA 318

Query: 319 DGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           DGTL +  E GSIHR+GA+V G + CNGW FW+FE+ G L  I+ LR ++R+++
Sbjct: 319 DGTLTANGEAGSIHRIGARVQGFDACNGWTFWHFEENGVLKPIDALRKIIREQM 372


>gi|163867893|ref|YP_001609097.1| adenine DNA methyltransferase protein CcrM [Bartonella tribocorum
           CIP 105476]
 gi|161017544|emb|CAK01102.1| adenine DNA methyltransferase protein CcrM [Bartonella tribocorum
           CIP 105476]
          Length = 378

 Score =  540 bits (1390), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 243/358 (67%), Positives = 298/358 (83%)

Query: 15  SIFEWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDK 74
           S   W++KI KG+ ++VLEKLP  SVD+IFADPPYNLQL G LYRPDHSLVDAV D+WD+
Sbjct: 15  SQMPWRNKIFKGDCVAVLEKLPKHSVDMIFADPPYNLQLEGALYRPDHSLVDAVDDAWDQ 74

Query: 75  FSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKS 134
           F SF AYDAFTRAWLLACRRVLKPNGT+WVIGSYHNIFR+GT LQ+L FW+LNDI+WRK+
Sbjct: 75  FESFAAYDAFTRAWLLACRRVLKPNGTIWVIGSYHNIFRVGTALQDLGFWMLNDIIWRKN 134

Query: 135 NPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSER 194
           NPMPNFRGRRFQNAHETLIWA    K K YTFNYDALKAANED+QMRSDWL P+C+G+ER
Sbjct: 135 NPMPNFRGRRFQNAHETLIWAVRDQKDKKYTFNYDALKAANEDLQMRSDWLFPLCTGAER 194

Query: 195 LRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMK 254
           L++  G KLHPTQKP+ALL+RI+++S+KPGD+ILDPFFGSGT+GAVAK L R F+GIE +
Sbjct: 195 LKDDSGRKLHPTQKPQALLARIIMASSKPGDVILDPFFGSGTTGAVAKLLGRDFVGIERE 254

Query: 255 QDYIDIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISA 314
           QDYID A +RIA+V+PL   EL +L  K+ EPRVAFN L+E GL+ PG++L + +  +SA
Sbjct: 255 QDYIDAACERIAAVKPLAQPELAILDRKKAEPRVAFNSLLEAGLLYPGEVLYDRKKQVSA 314

Query: 315 TVCADGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
            V ADGT++ G E GSIH +G K   S++CNGW FWY+E+ G L SI+ LR+++R ++
Sbjct: 315 IVRADGTIMHGGEAGSIHAMGRKAQDSQSCNGWTFWYYEENGRLKSIDHLRMIIRSQM 372


>gi|239831358|ref|ZP_04679687.1| Modification methylase HinfI [Ochrobactrum intermedium LMG 3301]
 gi|239823625|gb|EEQ95193.1| Modification methylase HinfI [Ochrobactrum intermedium LMG 3301]
          Length = 443

 Score =  539 bits (1389), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 239/354 (67%), Positives = 299/354 (84%)

Query: 19  WKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSF 78
           W D IIKG+ ++ LE+LP  SVD+IFADPPYNLQL G L+RPD S+V AV D WD+F SF
Sbjct: 85  WLDSIIKGDCVAALERLPDHSVDVIFADPPYNLQLGGDLHRPDQSMVSAVDDHWDQFESF 144

Query: 79  EAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
           +AYDAFTRAWL+ACRRVLKPNGT+WVIGSYHNIFR+G+ LQ+L FW+LNDI+WRK+NPMP
Sbjct: 145 QAYDAFTRAWLMACRRVLKPNGTIWVIGSYHNIFRVGSQLQDLGFWLLNDIIWRKTNPMP 204

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
           NFRGRRFQNAHETLIWAS   K KGYTFNY+A+KAAN+DVQMRSDWL PIC+GSERL+++
Sbjct: 205 NFRGRRFQNAHETLIWASRDQKGKGYTFNYEAMKAANDDVQMRSDWLFPICTGSERLKDE 264

Query: 199 DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYI 258
           +G+K+HPTQKPEALL+RI+++S+KPGD+ILDPFFGSGT+GAVAK+L R F+GIE +Q YI
Sbjct: 265 NGDKVHPTQKPEALLARIMMASSKPGDVILDPFFGSGTTGAVAKRLGRHFVGIEREQSYI 324

Query: 259 DIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCA 318
           D AT RI +V+PLG  ELTV+TGKR EPRVAF  ++E GL++PG +L++ +   +A V A
Sbjct: 325 DAATARIDAVEPLGKAELTVMTGKRAEPRVAFTSVIEAGLLRPGTVLSDERRRFAAIVRA 384

Query: 319 DGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           DGTL +  E GSIHR+GAKV G + CNGW FW++E+ G L  I+ LR ++R ++
Sbjct: 385 DGTLAANGEAGSIHRMGAKVQGFDACNGWTFWHYEENGTLKPIDALRKVIRDQM 438


>gi|17987727|ref|NP_540361.1| adenine-specific methyltransferase [Brucella melitensis bv. 1 str.
           16M]
 gi|81851486|sp|Q8YFS6|MTB1_BRUME RecName: Full=Modification methylase BabI; Short=M.BabI; AltName:
           Full=Adenine-specific methyltransferase BabI; AltName:
           Full=DNA methyltransferase CcrM; AltName: Full=M.CcrMI
           ortholog
 gi|17983446|gb|AAL52625.1| adenine-specific methyltransferase [Brucella melitensis bv. 1 str.
           16M]
          Length = 403

 Score =  539 bits (1389), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 242/354 (68%), Positives = 298/354 (84%)

Query: 19  WKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSF 78
           W D IIKG+ +S LE+L   SVD+IFADPPYNLQL G L+RPD S+V AV D WD+F SF
Sbjct: 45  WLDSIIKGDCVSALERLSDHSVDVIFADPPYNLQLGGDLHRPDQSMVSAVDDHWDQFESF 104

Query: 79  EAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
           +AYDAFTRAWLLACRRVLKPNGT+WVIGSYHNIFR+GT LQ+L FW+LNDIVWRK+NPMP
Sbjct: 105 QAYDAFTRAWLLACRRVLKPNGTIWVIGSYHNIFRVGTQLQDLGFWLLNDIVWRKTNPMP 164

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
           NFRGRRFQNAHETLIWAS   K KGYTFNY+A+KAAN+DVQMRSDWL PIC+GSERL+++
Sbjct: 165 NFRGRRFQNAHETLIWASRDQKGKGYTFNYEAMKAANDDVQMRSDWLFPICTGSERLKDE 224

Query: 199 DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYI 258
           +G+K+HPTQKPEALL+RI+++S+KPGD+ILDPFFGSGT+GAVAK+L R F+GIE +Q YI
Sbjct: 225 NGDKVHPTQKPEALLARIMMASSKPGDVILDPFFGSGTTGAVAKRLGRHFVGIEREQPYI 284

Query: 259 DIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCA 318
           D AT RI +V+PLG  ELTV+TGKR EPRVAF  ++E GL++PG +L + +   +A V A
Sbjct: 285 DAATARINAVEPLGKAELTVMTGKRAEPRVAFTSVMEAGLLRPGTVLCDERRRFAAIVRA 344

Query: 319 DGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           DGTL +  E GSIHR+GA+V G + CNGW FW+FE+ G L  I+ LR ++R+++
Sbjct: 345 DGTLTANGEAGSIHRIGARVQGFDACNGWTFWHFEENGVLKPIDALRKIIREQM 398


>gi|225852027|ref|YP_002732260.1| modification methylase HinfI [Brucella melitensis ATCC 23457]
 gi|256044204|ref|ZP_05447111.1| adenine-specific methyltransferase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256113019|ref|ZP_05453916.1| adenine-specific methyltransferase [Brucella melitensis bv. 3 str.
           Ether]
 gi|256264469|ref|ZP_05467001.1| modification methylase BabI [Brucella melitensis bv. 2 str. 63/9]
 gi|260563563|ref|ZP_05834049.1| modification methylase BabI [Brucella melitensis bv. 1 str. 16M]
 gi|265990620|ref|ZP_06103177.1| modification methylase BabI [Brucella melitensis bv. 1 str. Rev.1]
 gi|265994452|ref|ZP_06107009.1| modification methylase BabI [Brucella melitensis bv. 3 str. Ether]
 gi|225640392|gb|ACO00306.1| Modification methylase HinfI [Brucella melitensis ATCC 23457]
 gi|260153579|gb|EEW88671.1| modification methylase BabI [Brucella melitensis bv. 1 str. 16M]
 gi|262765565|gb|EEZ11354.1| modification methylase BabI [Brucella melitensis bv. 3 str. Ether]
 gi|263001404|gb|EEZ13979.1| modification methylase BabI [Brucella melitensis bv. 1 str. Rev.1]
 gi|263094800|gb|EEZ18538.1| modification methylase BabI [Brucella melitensis bv. 2 str. 63/9]
          Length = 377

 Score =  538 bits (1387), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 242/354 (68%), Positives = 298/354 (84%)

Query: 19  WKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSF 78
           W D IIKG+ +S LE+L   SVD+IFADPPYNLQL G L+RPD S+V AV D WD+F SF
Sbjct: 19  WLDSIIKGDCVSALERLSDHSVDVIFADPPYNLQLGGDLHRPDQSMVSAVDDHWDQFESF 78

Query: 79  EAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
           +AYDAFTRAWLLACRRVLKPNGT+WVIGSYHNIFR+GT LQ+L FW+LNDIVWRK+NPMP
Sbjct: 79  QAYDAFTRAWLLACRRVLKPNGTIWVIGSYHNIFRVGTQLQDLGFWLLNDIVWRKTNPMP 138

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
           NFRGRRFQNAHETLIWAS   K KGYTFNY+A+KAAN+DVQMRSDWL PIC+GSERL+++
Sbjct: 139 NFRGRRFQNAHETLIWASRDQKGKGYTFNYEAMKAANDDVQMRSDWLFPICTGSERLKDE 198

Query: 199 DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYI 258
           +G+K+HPTQKPEALL+RI+++S+KPGD+ILDPFFGSGT+GAVAK+L R F+GIE +Q YI
Sbjct: 199 NGDKVHPTQKPEALLARIMMASSKPGDVILDPFFGSGTTGAVAKRLGRHFVGIEREQPYI 258

Query: 259 DIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCA 318
           D AT RI +V+PLG  ELTV+TGKR EPRVAF  ++E GL++PG +L + +   +A V A
Sbjct: 259 DAATARINAVEPLGKAELTVMTGKRAEPRVAFTSVMEAGLLRPGTVLCDERRRFAAIVRA 318

Query: 319 DGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           DGTL +  E GSIHR+GA+V G + CNGW FW+FE+ G L  I+ LR ++R+++
Sbjct: 319 DGTLTANGEAGSIHRIGARVQGFDACNGWTFWHFEENGVLKPIDALRKIIREQM 372


>gi|326408521|gb|ADZ65586.1| modification methylase HinfI [Brucella melitensis M28]
 gi|326538238|gb|ADZ86453.1| modification methylase HinfI [Brucella melitensis M5-90]
          Length = 368

 Score =  538 bits (1386), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 242/354 (68%), Positives = 298/354 (84%)

Query: 19  WKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSF 78
           W D IIKG+ +S LE+L   SVD+IFADPPYNLQL G L+RPD S+V AV D WD+F SF
Sbjct: 10  WLDSIIKGDCVSALERLSDHSVDVIFADPPYNLQLGGDLHRPDQSMVSAVDDHWDQFESF 69

Query: 79  EAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
           +AYDAFTRAWLLACRRVLKPNGT+WVIGSYHNIFR+GT LQ+L FW+LNDIVWRK+NPMP
Sbjct: 70  QAYDAFTRAWLLACRRVLKPNGTIWVIGSYHNIFRVGTQLQDLGFWLLNDIVWRKTNPMP 129

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
           NFRGRRFQNAHETLIWAS   K KGYTFNY+A+KAAN+DVQMRSDWL PIC+GSERL+++
Sbjct: 130 NFRGRRFQNAHETLIWASRDQKGKGYTFNYEAMKAANDDVQMRSDWLFPICTGSERLKDE 189

Query: 199 DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYI 258
           +G+K+HPTQKPEALL+RI+++S+KPGD+ILDPFFGSGT+GAVAK+L R F+GIE +Q YI
Sbjct: 190 NGDKVHPTQKPEALLARIMMASSKPGDVILDPFFGSGTTGAVAKRLGRHFVGIEREQPYI 249

Query: 259 DIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCA 318
           D AT RI +V+PLG  ELTV+TGKR EPRVAF  ++E GL++PG +L + +   +A V A
Sbjct: 250 DAATARINAVEPLGKAELTVMTGKRAEPRVAFTSVMEAGLLRPGTVLCDERRRFAAIVRA 309

Query: 319 DGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           DGTL +  E GSIHR+GA+V G + CNGW FW+FE+ G L  I+ LR ++R+++
Sbjct: 310 DGTLTANGEAGSIHRIGARVQGFDACNGWTFWHFEENGVLKPIDALRKIIREQM 363


>gi|153007950|ref|YP_001369165.1| DNA methylase N-4/N-6 domain-containing protein [Ochrobactrum
           anthropi ATCC 49188]
 gi|223635322|sp|A6WWI2|MTB1_OCHA4 RecName: Full=Modification methylase BabI; Short=M.BabI; AltName:
           Full=Adenine-specific methyltransferase BabI; AltName:
           Full=DNA methyltransferase CcrM; AltName: Full=M.CcrMI
           ortholog
 gi|151559838|gb|ABS13336.1| DNA methylase N-4/N-6 domain protein [Ochrobactrum anthropi ATCC
           49188]
          Length = 377

 Score =  538 bits (1386), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 238/354 (67%), Positives = 298/354 (84%)

Query: 19  WKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSF 78
           W D IIKG+ ++ LE+LP  SVD+IFADPPYNLQL G L+RPD S+V AV D WD+F SF
Sbjct: 19  WLDSIIKGDCVAALERLPDHSVDVIFADPPYNLQLGGDLHRPDQSMVSAVDDHWDQFESF 78

Query: 79  EAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
           +AYDAFTRAWL+ACRRVLKPNGT+WVIGSYHNIFR+G+ LQ+L FW+LND++WRK+NPMP
Sbjct: 79  QAYDAFTRAWLMACRRVLKPNGTIWVIGSYHNIFRVGSQLQDLGFWLLNDVIWRKTNPMP 138

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
           NFRGRRFQNAHETLIWAS   K KGYTFNY+A+KAAN+DVQMRSDWL PIC+GSERL+++
Sbjct: 139 NFRGRRFQNAHETLIWASRDQKGKGYTFNYEAMKAANDDVQMRSDWLFPICTGSERLKDE 198

Query: 199 DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYI 258
           +G+K+HPTQKPEALL+RI+++S+KPGD+ILDPFFGSGT+GAVAK+L R F+GIE +Q YI
Sbjct: 199 NGDKVHPTQKPEALLARIMMASSKPGDVILDPFFGSGTTGAVAKRLGRHFVGIEREQSYI 258

Query: 259 DIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCA 318
           D AT RI +V+PLG  ELTV+TGKR EPRVAF  ++E GL++PG +L + +   +A V A
Sbjct: 259 DAATARIDAVEPLGKAELTVMTGKRAEPRVAFTSVLEAGLLRPGTVLCDERRRFAAIVRA 318

Query: 319 DGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           DGTL +  E GSIHR+GAKV G + CNGW FW++E+ G L  I+ LR ++R ++
Sbjct: 319 DGTLAANGEAGSIHRIGAKVQGFDACNGWTFWHYEENGALKPIDALRKVIRDQM 372


>gi|49475250|ref|YP_033291.1| adenine DNA methyltransferase protein [Bartonella henselae str.
           Houston-1]
 gi|49238055|emb|CAF27262.1| Adenine DNA methyltransferase protein [Bartonella henselae str.
           Houston-1]
          Length = 378

 Score =  537 bits (1384), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 243/354 (68%), Positives = 296/354 (83%)

Query: 19  WKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSF 78
           W++KI+KG+ ++VLEKLP  SVD+IFADPPYNLQL G LYRPDHSLVDAV D+WD+F +F
Sbjct: 19  WRNKILKGDCVAVLEKLPKHSVDMIFADPPYNLQLEGALYRPDHSLVDAVDDAWDQFENF 78

Query: 79  EAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            AYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFR+GT LQ+L FWILNDI+WRK+NPMP
Sbjct: 79  AAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRVGTALQDLGFWILNDIIWRKNNPMP 138

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
           NFRGRRFQNAHETLIWA    K K YTFNYDALKAANED+QMRSDWL P+C+G+ERL+++
Sbjct: 139 NFRGRRFQNAHETLIWAVRDQKDKKYTFNYDALKAANEDIQMRSDWLFPLCTGAERLKDE 198

Query: 199 DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYI 258
            G KLHPTQKP+ LL+RI+++S+KPGDIILDPFFGSGT+GAVAK L R F+GIE +Q YI
Sbjct: 199 AGRKLHPTQKPQPLLARIIIASSKPGDIILDPFFGSGTTGAVAKLLGRDFVGIEREQQYI 258

Query: 259 DIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCA 318
           D A +RIA ++PL   EL +L  K+ EPRVAFN L+E GLI PG++L + +  +SA V A
Sbjct: 259 DAAYERIAKIKPLNEPELAILDRKKAEPRVAFNSLLEAGLICPGEVLYDRKKQVSAIVRA 318

Query: 319 DGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           DGTL+ G E GSIH +G K    ++CNGW FWY+E+ G+L SIN LR+++R ++
Sbjct: 319 DGTLMYGGEAGSIHAMGRKAQDLQSCNGWTFWYYEEDGQLKSINELRMVIRSQM 372


>gi|49474012|ref|YP_032054.1| adenine DNA methyltransferase protein [Bartonella quintana str.
           Toulouse]
 gi|49239515|emb|CAF25872.1| Adenine DNA methyltransferase protein [Bartonella quintana str.
           Toulouse]
          Length = 378

 Score =  532 bits (1370), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 241/354 (68%), Positives = 295/354 (83%)

Query: 19  WKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSF 78
           W++KI+KG+ ++VLEKLP  SVD+IFADPPYNLQL+G LYRPDHSLVDAV D+WD+F SF
Sbjct: 19  WRNKILKGDCVAVLEKLPKHSVDVIFADPPYNLQLDGALYRPDHSLVDAVDDAWDQFESF 78

Query: 79  EAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            AYDAFTRAWLLACRRVLKP+GTLWVIGSYHNIFR+GT LQ+L FW+LNDI+WRK+NPMP
Sbjct: 79  AAYDAFTRAWLLACRRVLKPHGTLWVIGSYHNIFRVGTALQDLGFWMLNDIIWRKNNPMP 138

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
           NFRGRRFQNAHETLIWA    K K YTFNYDALKA NEDVQMRSDWL P+C+G+ERL+++
Sbjct: 139 NFRGRRFQNAHETLIWAVRDQKDKKYTFNYDALKAGNEDVQMRSDWLFPLCTGAERLKDE 198

Query: 199 DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYI 258
            G KLHPTQKP+ LL+RI+++S+KPGDIILDPFFGSGT+GAVAK L R F+GIE +Q YI
Sbjct: 199 AGRKLHPTQKPQTLLTRIIMASSKPGDIILDPFFGSGTTGAVAKLLGRDFVGIEREQQYI 258

Query: 259 DIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCA 318
           D A +RIA+V+PL   EL +L  K+ EPRVAFN L+E GL+ PG++L + +  +SA V A
Sbjct: 259 DAAYERIAAVEPLNKPELAILDRKKAEPRVAFNSLLEAGLLCPGEVLYDRKKRVSAIVRA 318

Query: 319 DGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           DGTL+   E GSIH +G K   S++CNGW FWY+E+ G L SI+ LR+++R  +
Sbjct: 319 DGTLMYSGEAGSIHAMGRKAQDSQSCNGWTFWYYEENGRLKSIDGLRMIIRSRM 372


>gi|163760352|ref|ZP_02167434.1| modification methylase BabI [Hoeflea phototrophica DFL-43]
 gi|162282303|gb|EDQ32592.1| modification methylase BabI [Hoeflea phototrophica DFL-43]
          Length = 377

 Score =  529 bits (1362), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 235/354 (66%), Positives = 291/354 (82%)

Query: 19  WKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSF 78
           W D IIKG+ ++ LE LP  SVD+IFADPPYNLQL G L RPD S+VDAV D WD+F SF
Sbjct: 20  WLDTIIKGDCVAALEALPENSVDVIFADPPYNLQLGGDLARPDQSVVDAVNDHWDQFESF 79

Query: 79  EAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            AYDAFTRAWL+ACRRVLKPNGT+WVIGSYHNIFR+G+ LQ++ FW+LNDIVWRK+NPMP
Sbjct: 80  AAYDAFTRAWLMACRRVLKPNGTIWVIGSYHNIFRVGSQLQDIGFWLLNDIVWRKTNPMP 139

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
           NFRGRRFQNAHET+IWAS    AK YTFNY+A+KA+N+DVQMRSDWL PIC+G+ERL+  
Sbjct: 140 NFRGRRFQNAHETMIWASRDQNAKSYTFNYEAMKASNDDVQMRSDWLFPICTGAERLKGD 199

Query: 199 DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYI 258
           DG+K+HPTQKPEALL+R+L++S+KPGD++LDPFFGSGT+GAVA++L R F+GIE +QDYI
Sbjct: 200 DGKKVHPTQKPEALLARVLMASSKPGDVVLDPFFGSGTTGAVARRLGRHFVGIEREQDYI 259

Query: 259 DIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCA 318
           D A  RI +V+PLG  ELTV+TGKR EPRVAFN+L+E G ++PG +L +A+    A V A
Sbjct: 260 DAARARIDAVEPLGKNELTVMTGKRAEPRVAFNVLIEAGHVKPGDVLHDAKRKHQAIVRA 319

Query: 319 DGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           DGTL++  + GSIH+VGA V G + CNGW FW+ E    L  I+  R ++RKE+
Sbjct: 320 DGTLVANGQAGSIHKVGAHVQGFDACNGWTFWHLETSDGLTVIDEFRSVIRKEM 373


>gi|319406873|emb|CBI80508.1| adenine DNA methyltransferase protein CcrM [Bartonella sp. 1-1C]
          Length = 378

 Score =  528 bits (1359), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 237/355 (66%), Positives = 297/355 (83%)

Query: 18  EWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSS 77
           +W++KI KG+ ++VLEKLP  SVD+IFADPPYNLQL G LYRPD+S VDAV D+WD+F S
Sbjct: 18  QWRNKIFKGDCVAVLEKLPKHSVDVIFADPPYNLQLEGVLYRPDYSRVDAVDDAWDQFES 77

Query: 78  FEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPM 137
           F AYDAFTRAWLLACRRVLKPNGT+WVIGSYHNIFR+GT LQ+L FW+LNDI+WRK+NPM
Sbjct: 78  FAAYDAFTRAWLLACRRVLKPNGTIWVIGSYHNIFRVGTALQDLGFWMLNDIIWRKNNPM 137

Query: 138 PNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRN 197
           PNFRGRRFQNAHETLIWA    K K YTFNYDALKAANED QMRSDWL P+C+G+ERL++
Sbjct: 138 PNFRGRRFQNAHETLIWAVRDQKDKKYTFNYDALKAANEDRQMRSDWLFPLCTGAERLKD 197

Query: 198 KDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDY 257
           K G KLHPTQKP++LL+RI+++S+KPGD+ILDPFFGSGT+GAVAK L R+F+GIE +Q Y
Sbjct: 198 KIGRKLHPTQKPQSLLARIIMASSKPGDVILDPFFGSGTTGAVAKLLGRNFVGIEREQHY 257

Query: 258 IDIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVC 317
           ID A++RIA+V+PL   EL +L  K+ EPR+AF+ L++ GL+ PG IL + +  +SA V 
Sbjct: 258 IDAASERIAAVKPLAKSELEILKTKKAEPRIAFSSLLDAGLLYPGSILYDKKKEVSALVR 317

Query: 318 ADGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           ADGT++   E GSIH +G K   S++CNGW FWY+E+ G L SI++LR++VR ++
Sbjct: 318 ADGTIMYDGEAGSIHMIGRKAQASQSCNGWTFWYYEENGLLKSIDSLRMMVRSQM 372


>gi|319898539|ref|YP_004158632.1| adenine DNA methyltransferase protein CcrM [Bartonella clarridgeiae
           73]
 gi|319402503|emb|CBI76046.1| adenine DNA methyltransferase protein CcrM [Bartonella clarridgeiae
           73]
          Length = 386

 Score =  527 bits (1358), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 239/370 (64%), Positives = 300/370 (81%), Gaps = 4/370 (1%)

Query: 3   QKNSLAINENQNSIFEWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDH 62
           QKN +  +       +W++KI KG+ ++VLEKLP  SVD+IFADPPYNLQL G LYRPDH
Sbjct: 15  QKNQVCTSSQT----QWRNKIFKGDCVAVLEKLPKHSVDMIFADPPYNLQLEGVLYRPDH 70

Query: 63  SLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLN 122
           S V+AV D+WD+F SF AYDAFTRAWLLACRRVLKPNGT+WVIGSYHNIFR+GT LQ+L 
Sbjct: 71  SRVNAVDDAWDQFESFSAYDAFTRAWLLACRRVLKPNGTIWVIGSYHNIFRVGTALQDLG 130

Query: 123 FWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRS 182
           FW+LNDI+WRK+NPMPNFRGRRFQNAHETLIWA    K K YTFNY+ALKAANED QMRS
Sbjct: 131 FWMLNDIIWRKNNPMPNFRGRRFQNAHETLIWAVRDQKDKKYTFNYNALKAANEDRQMRS 190

Query: 183 DWLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAK 242
           DWL P+C+G+ERL++K G KLHPTQKP++LL+RI+++S+KPGD+ILDPFFGSGT+GAVAK
Sbjct: 191 DWLFPLCTGAERLKDKVGRKLHPTQKPQSLLARIIIASSKPGDVILDPFFGSGTTGAVAK 250

Query: 243 KLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPG 302
              R F+GIE +Q YID A +RIA+++PL   EL +L  K+TEPRVAF+ L++ GL+ PG
Sbjct: 251 LFGRDFVGIEREQHYIDAACERIAAIKPLAESELEILKTKKTEPRVAFSSLLDLGLLYPG 310

Query: 303 QILTNAQGNISATVCADGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSIN 362
            +L + +  ISA V ADGT++ G E GSIH +G K   S++CNGW FWY+E+ G L SI+
Sbjct: 311 SVLYDKKKEISAIVRADGTIMYGGEAGSIHMIGRKAQASQSCNGWTFWYYEENGLLKSID 370

Query: 363 TLRILVRKEL 372
            LR+++R ++
Sbjct: 371 DLRMMIRSQM 380


>gi|319408230|emb|CBI81883.1| adenine DNA methyltransferase protein CcrM [Bartonella
           schoenbuchensis R1]
          Length = 378

 Score =  527 bits (1357), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 239/355 (67%), Positives = 294/355 (82%)

Query: 18  EWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSS 77
           +W +KI+KG+ +++LEKLP  SVD+IFADPPYNLQL   LYRPD+S VDAV D+WD+F +
Sbjct: 18  QWCNKILKGDCVAMLEKLPKHSVDMIFADPPYNLQLENTLYRPDYSRVDAVNDAWDQFEN 77

Query: 78  FEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPM 137
           F AYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFR+GT LQ+L FW+LNDI+WRK+NPM
Sbjct: 78  FAAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRVGTALQDLGFWLLNDIIWRKNNPM 137

Query: 138 PNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRN 197
           PNFRGRRFQNAHETLIWA    K K YTFNY ALKAANEDVQMRSDWL P+C+G+ERL++
Sbjct: 138 PNFRGRRFQNAHETLIWAVRDQKDKKYTFNYKALKAANEDVQMRSDWLFPLCTGAERLKD 197

Query: 198 KDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDY 257
           + G KLHPTQKP+ LL+RI+++S+KPGDIILDPFFGSGT+GAVAK L R+F+GIE +Q Y
Sbjct: 198 EIGRKLHPTQKPQTLLARIIMASSKPGDIILDPFFGSGTTGAVAKLLGRNFVGIEREQSY 257

Query: 258 IDIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVC 317
           ID A +RIA V+PL   ELTVL  K+ EPRVAF  L+E GL+ PG IL + +  +SA V 
Sbjct: 258 IDAAHERIAMVKPLAESELTVLANKKAEPRVAFTNLLEAGLLHPGMILYDRKKRVSAIVK 317

Query: 318 ADGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           ADGT++ G E GSIH +G K   S++CNGW FWY+E+ G+L SI+ LR+++R ++
Sbjct: 318 ADGTIMYGGEAGSIHMMGRKAQASQSCNGWTFWYYEEDGQLKSIDDLRMVIRSQM 372


>gi|121602378|ref|YP_988732.1| modification methylase CcrMI [Bartonella bacilliformis KC583]
 gi|120614555|gb|ABM45156.1| modification methylase CcrMI [Bartonella bacilliformis KC583]
          Length = 378

 Score =  526 bits (1355), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 239/361 (66%), Positives = 298/361 (82%)

Query: 12  NQNSIFEWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDS 71
           N  S   W ++I KG+ ++VLEKLP  SVD+IFADPPYNLQL G LYRPDHSLVDAV D+
Sbjct: 12  NSPSQIPWCNQIFKGDCVAVLEKLPKHSVDMIFADPPYNLQLEGVLYRPDHSLVDAVDDA 71

Query: 72  WDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVW 131
           WD+F SF AYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFR+GT LQ+L FW+LNDI+W
Sbjct: 72  WDQFESFAAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRVGTTLQDLGFWVLNDIIW 131

Query: 132 RKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSG 191
           RK+NPMPNFRGRRFQNAHETLIWA    K K YTFNYD+LKAAN+DVQMRSDWL P+C+G
Sbjct: 132 RKNNPMPNFRGRRFQNAHETLIWAVRDQKDKKYTFNYDSLKAANDDVQMRSDWLFPLCTG 191

Query: 192 SERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGI 251
           +ERL+++ G+KLHPTQKP+ALL+RI+++++K GD+ILDPFFGSGT+GAVAK L R+F+GI
Sbjct: 192 AERLKDEAGDKLHPTQKPQALLARIIMAASKSGDVILDPFFGSGTTGAVAKLLGRNFVGI 251

Query: 252 EMKQDYIDIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGN 311
           E +Q YID A +RIA+V+PL   EL ++ GK+ EPRVAF  L+E GL+ PG +L + +  
Sbjct: 252 EREQRYIDAAHERIAAVKPLAKSELEIIKGKKAEPRVAFINLLEAGLLCPGSVLYDKKKR 311

Query: 312 ISATVCADGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKE 371
           +SA V ADGT++   E GSIH +G KV  S++CNGW FWY+E  G+L SI+ LR+++R +
Sbjct: 312 VSAIVRADGTIMCDNEAGSIHAIGRKVQVSQSCNGWTFWYYEDNGKLKSIDDLRMVIRSQ 371

Query: 372 L 372
           +
Sbjct: 372 I 372


>gi|319405302|emb|CBI78916.1| adenine DNA methyltransferase protein CcrM [Bartonella sp. AR 15-3]
          Length = 378

 Score =  525 bits (1353), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 239/355 (67%), Positives = 293/355 (82%)

Query: 18  EWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSS 77
           +W++KI KG+ ++VLEKLP  SVD+IFADPPYNLQL G LYRPD+S VDAV D+WD+F S
Sbjct: 18  QWRNKIFKGDCVAVLEKLPKHSVDVIFADPPYNLQLEGVLYRPDYSRVDAVDDAWDQFES 77

Query: 78  FEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPM 137
           F AYDAFTRAWLLACRRVLKPNGT+WVIGSYHNIFR+GT LQ+L FW+LNDI+WRK+NPM
Sbjct: 78  FSAYDAFTRAWLLACRRVLKPNGTIWVIGSYHNIFRVGTALQDLGFWMLNDIIWRKNNPM 137

Query: 138 PNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRN 197
           PNFRGRRFQNAHETLIWA    K K YTFNYDALKAANED QMRSDWL P+C+G+ERL++
Sbjct: 138 PNFRGRRFQNAHETLIWAVRDQKDKKYTFNYDALKAANEDRQMRSDWLFPLCTGAERLKD 197

Query: 198 KDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDY 257
           K G KLHPTQKP++LL+RI+++S+KPGD+ILDPFFGSGT+GAVAK L R F+GIE +Q Y
Sbjct: 198 KVGRKLHPTQKPQSLLARIIMASSKPGDVILDPFFGSGTTGAVAKLLGRDFVGIEREQHY 257

Query: 258 IDIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVC 317
           ID A +RIA V+PL   EL +L  KRTEPRVAF+ L++  L+ PG IL + +  ISA V 
Sbjct: 258 IDAACERIAVVKPLAKSELEILKTKRTEPRVAFSSLLDARLLYPGSILYDKKKEISAIVR 317

Query: 318 ADGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           ADGT++   E GSIH +G K   S++CNGW FWY+E+ G L SI+ LR+++R ++
Sbjct: 318 ADGTIMYDGEAGSIHMIGRKAQASQSCNGWTFWYYEENGLLKSIDDLRMMIRSQM 372


>gi|319784679|ref|YP_004144155.1| DNA methylase N-4/N-6 domain protein [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317170567|gb|ADV14105.1| DNA methylase N-4/N-6 domain protein [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 377

 Score =  524 bits (1350), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 235/352 (66%), Positives = 291/352 (82%)

Query: 18  EWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSS 77
           EW D I+KG+ ++ L++LP KS+D+IFADPPYNLQL+G L+RPD S VDAV D WD+F S
Sbjct: 18  EWLDTILKGDCVAALDRLPEKSIDVIFADPPYNLQLDGDLHRPDQSKVDAVDDDWDQFES 77

Query: 78  FEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPM 137
           FEAYDAFTRAWLLA RRVLKPNGT+WVIGSYHNIFR+G  +Q+L FWILND+VWRK+NPM
Sbjct: 78  FEAYDAFTRAWLLAARRVLKPNGTIWVIGSYHNIFRVGAKMQDLGFWILNDVVWRKTNPM 137

Query: 138 PNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRN 197
           PNFRGRRFQNAHET+IWA+   K KGYTFNY+A+KA+N+D+QMRSDWL PIC+G ERL+N
Sbjct: 138 PNFRGRRFQNAHETMIWATRDQKGKGYTFNYEAMKASNDDIQMRSDWLFPICTGGERLKN 197

Query: 198 KDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDY 257
            +G+KLHPTQKPEALL+RI+++STKPGDI+LDPFFGSGT+GAVAK+L R F+GIE +Q Y
Sbjct: 198 DNGDKLHPTQKPEALLARIMMASTKPGDIVLDPFFGSGTTGAVAKRLGRHFVGIEREQAY 257

Query: 258 IDIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVC 317
           ID A +RI +V+PL   +LTVLTGKR EPRVAF  L++ GL+ PG  L +A+   +A V 
Sbjct: 258 IDAANERIDAVRPLDGADLTVLTGKRAEPRVAFVSLIDTGLMMPGATLYDAKKRWAAKVR 317

Query: 318 ADGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVR 369
           ADGT+  G   GSIH+VGA+V G + CNGW FW++E+ G L  I+ LR + R
Sbjct: 318 ADGTVAIGDSAGSIHKVGAEVQGLDACNGWTFWHYERSGGLTPIDELRRIAR 369


>gi|260460279|ref|ZP_05808531.1| DNA methylase N-4/N-6 domain protein [Mesorhizobium opportunistum
           WSM2075]
 gi|259033924|gb|EEW35183.1| DNA methylase N-4/N-6 domain protein [Mesorhizobium opportunistum
           WSM2075]
          Length = 377

 Score =  524 bits (1350), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 236/352 (67%), Positives = 292/352 (82%)

Query: 18  EWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSS 77
           EW D I+KG+ ++ L++LP KS+D+IFADPPYNLQL+G L+RPD S VDAV D WD+F S
Sbjct: 18  EWLDTILKGDCVAALDRLPEKSIDVIFADPPYNLQLDGDLHRPDQSKVDAVDDDWDRFES 77

Query: 78  FEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPM 137
           FEAYDAFTRAWLLA RRVLKPNGT+WVIGSYHNIFR+G  +Q+L FWILND+VWRK+NPM
Sbjct: 78  FEAYDAFTRAWLLAARRVLKPNGTIWVIGSYHNIFRVGAKMQDLGFWILNDVVWRKTNPM 137

Query: 138 PNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRN 197
           PNFRGRRFQNAHET+IWAS   K KGYTFNY+ALKA+N+D+QMRSDWL PIC+G ERL+N
Sbjct: 138 PNFRGRRFQNAHETMIWASRDQKGKGYTFNYEALKASNDDIQMRSDWLFPICTGGERLKN 197

Query: 198 KDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDY 257
            +G+KLHPTQKPEALL+RI+++STKPGDI+LDPFFGSGT+GAVAK+L R F+GIE +Q Y
Sbjct: 198 DNGDKLHPTQKPEALLARIMMASTKPGDIVLDPFFGSGTTGAVAKRLGRHFVGIEREQAY 257

Query: 258 IDIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVC 317
           ID A +RI +V+PL + +LTVLTGKR EPRVAF  L++ GL+ PG  L +A+   +A V 
Sbjct: 258 IDAANERIDAVRPLEDADLTVLTGKRAEPRVAFVSLIDTGLMVPGATLYDAKKRWAAKVR 317

Query: 318 ADGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVR 369
           ADGT+  G   GSIH++GA+V G + CNGW FW++E+ G L  I+ LR + R
Sbjct: 318 ADGTVAIGDSAGSIHKIGAEVQGLDACNGWTFWHYERSGGLTPIDELRRIAR 369


>gi|319403861|emb|CBI77447.1| adenine DNA methyltransferase protein CcrM [Bartonella rochalimae
           ATCC BAA-1498]
          Length = 378

 Score =  523 bits (1347), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 234/355 (65%), Positives = 294/355 (82%)

Query: 18  EWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSS 77
           +W++KI KG+ ++VLEKLP  SVD+IFADPPYNLQL   LYRPD+S VDAV D+WD+F S
Sbjct: 18  QWRNKIFKGDCVAVLEKLPKHSVDVIFADPPYNLQLESVLYRPDYSRVDAVDDAWDQFES 77

Query: 78  FEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPM 137
           F AYDAFTRAWLLACRRVLKPNGT+WVIGSYHNIFR+GT LQ+L FW+LNDI+WRK+NPM
Sbjct: 78  FAAYDAFTRAWLLACRRVLKPNGTIWVIGSYHNIFRVGTALQDLGFWMLNDIIWRKNNPM 137

Query: 138 PNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRN 197
           PNFRGRRFQNAHETLIWA    K K Y FNYDALKAANED QMRSDWL P+C+G+ERL++
Sbjct: 138 PNFRGRRFQNAHETLIWAVRDQKDKKYIFNYDALKAANEDRQMRSDWLFPLCTGAERLKD 197

Query: 198 KDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDY 257
           K G KLHPTQKP++LL+RI+++S+KPGD+ILDPFFGSGT+GAVAK L R F+GIE +Q Y
Sbjct: 198 KIGRKLHPTQKPQSLLARIIMASSKPGDVILDPFFGSGTTGAVAKLLGRDFVGIEREQHY 257

Query: 258 IDIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVC 317
           ID A++RIA+V+PL   EL +L  K+ EPR+AF+ L++ GL+ PG IL + +  +SA V 
Sbjct: 258 IDAASERIAAVKPLAKSELEILKTKKAEPRIAFSSLLDAGLLYPGSILYDKKKEVSALVR 317

Query: 318 ADGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           ADGT++   E GSIH +G K   S++CNGW FWY+E+ G L SI++LR+++R ++
Sbjct: 318 ADGTIMYDGEAGSIHMIGRKAQASQSCNGWTFWYYEENGLLKSIDSLRMMIRSQM 372


>gi|13476248|ref|NP_107818.1| adenine DNA methyltransferase [Mesorhizobium loti MAFF303099]
 gi|14027009|dbj|BAB53963.1| adenine DNA methyltransferase [Mesorhizobium loti MAFF303099]
          Length = 377

 Score =  520 bits (1339), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 235/352 (66%), Positives = 291/352 (82%)

Query: 18  EWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSS 77
           EW D I+KG+ ++ L++LP KSVD+IFADPPYNLQL+G L+RPD S VDAV D WD+F +
Sbjct: 18  EWLDTILKGDCVAALDRLPEKSVDVIFADPPYNLQLDGDLHRPDQSKVDAVDDHWDQFEN 77

Query: 78  FEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPM 137
           FEAYDAFTRAWLLA RRVLKPNGT+WVIGSYHNIFR+G  +Q+L FWILND+VWRK+NPM
Sbjct: 78  FEAYDAFTRAWLLAARRVLKPNGTIWVIGSYHNIFRVGAKMQDLGFWILNDVVWRKTNPM 137

Query: 138 PNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRN 197
           PNFRGRRFQNAHET+IWAS   K KGYTFNY+ALKA+N+D+QMRSDWL PIC+G ERL+N
Sbjct: 138 PNFRGRRFQNAHETMIWASRDQKGKGYTFNYEALKASNDDIQMRSDWLFPICTGGERLKN 197

Query: 198 KDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDY 257
            +G+KLHPTQKPEALL+RI+++STKPGDI+LDPFFGSGT+GAVAK+L R F+GIE +Q Y
Sbjct: 198 DNGDKLHPTQKPEALLARIMMASTKPGDIVLDPFFGSGTTGAVAKRLGRHFVGIEREQAY 257

Query: 258 IDIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVC 317
           ID A +RI +V+PL + +LTVLTGKR EPRVAF  L++ GL+ PG  L +A+   +  V 
Sbjct: 258 IDAANERIDAVRPLEDADLTVLTGKRAEPRVAFVSLIDTGLMTPGVTLYDAKKRWAVKVR 317

Query: 318 ADGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVR 369
           ADGT+  G   GSIH++GA+V G + CNGW FW++E+ G L  I+ LR + R
Sbjct: 318 ADGTVAIGDSAGSIHKIGAEVQGLDACNGWTFWHYERSGGLTPIDELRRIAR 369


>gi|114707681|ref|ZP_01440576.1| adenine DNA methyltransferase [Fulvimarina pelagi HTCC2506]
 gi|114536925|gb|EAU40054.1| adenine DNA methyltransferase [Fulvimarina pelagi HTCC2506]
          Length = 378

 Score =  516 bits (1329), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 233/372 (62%), Positives = 296/372 (79%)

Query: 1   MSQKNSLAINENQNSIFEWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRP 60
           M +   + ++       +W+++I++G+ ++ +E+LPA+SVD+IFADPPYNLQL G L RP
Sbjct: 1   MKRSGPVLVHSQPFPEIDWRNQILQGHCVTEMERLPAESVDVIFADPPYNLQLGGDLMRP 60

Query: 61  DHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQN 120
           DHS VDAV D+WD+F SF+AYDAFTRAWLLA RRVLKPNGTLWVIGSYHNIFR+G  LQ+
Sbjct: 61  DHSKVDAVDDAWDQFESFQAYDAFTRAWLLAARRVLKPNGTLWVIGSYHNIFRVGASLQD 120

Query: 121 LNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQM 180
           L +WILNDIVWRK+NPMPNFRG+RFQNAHETLIWAS   KAK YTFNY+ALKA+N+DVQM
Sbjct: 121 LGYWILNDIVWRKTNPMPNFRGKRFQNAHETLIWASRDAKAKSYTFNYEALKASNDDVQM 180

Query: 181 RSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAV 240
           RSDWL PICSG ERL+N+DG K HPTQKPEALL+RIL++STKPGD++LDPFFG+GT+GAV
Sbjct: 181 RSDWLFPICSGGERLKNEDGAKAHPTQKPEALLARILLASTKPGDVVLDPFFGTGTTGAV 240

Query: 241 AKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQ 300
           AK+L R F+GIE +++Y+ IA +RIA V+PL + +L +  GKR EPRV F  LVE GL+ 
Sbjct: 241 AKRLGRDFVGIEREEEYVKIAQQRIADVEPLDDDDLKMAAGKRAEPRVPFASLVEAGLVT 300

Query: 301 PGQILTNAQGNISATVCADGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHS 360
           PG  LT+++    A V ADGT+  G +  SIHR+GA+V G + CNGW FW+ ++   L  
Sbjct: 301 PGTELTDSKRRYRARVRADGTIAVGDDAASIHRIGARVQGLDACNGWTFWHVKEGKNLTP 360

Query: 361 INTLRILVRKEL 372
           I+ LR L R+ +
Sbjct: 361 IDELRQLARQRM 372


>gi|306842226|ref|ZP_07474890.1| Modification methylase HinfI [Brucella sp. BO2]
 gi|306287668|gb|EFM59112.1| Modification methylase HinfI [Brucella sp. BO2]
          Length = 338

 Score =  514 bits (1325), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 230/333 (69%), Positives = 284/333 (85%)

Query: 40  VDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPN 99
           +D+IFADPPYNLQL G L+RPD S+V AV D WD+F SF+AYDAFTRAWLLACRRVLKPN
Sbjct: 1   MDVIFADPPYNLQLGGDLHRPDQSMVSAVDDHWDQFESFQAYDAFTRAWLLACRRVLKPN 60

Query: 100 GTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSP 159
           GT+WVIGSYHNIFR+GT LQ+L FW+LNDIVWRK+NPMPNFRGRRFQNAHETLIWAS   
Sbjct: 61  GTIWVIGSYHNIFRVGTQLQDLGFWLLNDIVWRKTNPMPNFRGRRFQNAHETLIWASRDQ 120

Query: 160 KAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVS 219
           K KGYTFNY+A+KAAN+DVQMRSDWL PIC+GSERL++++G+K+HPTQKPEALL+RI+++
Sbjct: 121 KGKGYTFNYEAMKAANDDVQMRSDWLFPICTGSERLKDENGDKVHPTQKPEALLARIMMA 180

Query: 220 STKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVL 279
           S+KPGD+ILDPFFGSGT+GAVAK+L R F+GIE +Q YID AT RI +V+PLG  ELTV+
Sbjct: 181 SSKPGDVILDPFFGSGTTGAVAKRLGRHFVGIEREQPYIDAATARINAVEPLGKAELTVM 240

Query: 280 TGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTLISGTELGSIHRVGAKVS 339
           TGKR EPRVAF  ++E GL++PG +L + +   +A V ADGTL +  E GSIHR+GA+V 
Sbjct: 241 TGKRAEPRVAFTSVMEAGLLRPGTVLCDERRRFAAIVRADGTLTANGEAGSIHRIGARVQ 300

Query: 340 GSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           G + CNGW FW+FE+ G L  I+ LR ++R+++
Sbjct: 301 GFDACNGWTFWHFEENGVLKPIDALRKIIREQM 333


>gi|304393522|ref|ZP_07375450.1| modification methylase BabI [Ahrensia sp. R2A130]
 gi|303294529|gb|EFL88901.1| modification methylase BabI [Ahrensia sp. R2A130]
          Length = 416

 Score =  506 bits (1302), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 225/352 (63%), Positives = 280/352 (79%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           D II+G+ ++ + +LPA SVD+IFADPPYNLQL G+L RPD S VDA  D WD+F +F A
Sbjct: 61  DSIIQGDCVAAMSRLPANSVDVIFADPPYNLQLGGELSRPDQSTVDACDDHWDQFDTFAA 120

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YDAF+RAWL A RRVLKPNGT+WVIGSYHNIFR+GTMLQ++ FWILNDIVWRK+NPMPNF
Sbjct: 121 YDAFSRAWLTAARRVLKPNGTIWVIGSYHNIFRVGTMLQDMQFWILNDIVWRKTNPMPNF 180

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           RGRRF NAHET+IWASP PK KGYTFNYDALK AN+DVQMRSDW+ PIC+G ERL+ +DG
Sbjct: 181 RGRRFTNAHETMIWASPDPKGKGYTFNYDALKMANDDVQMRSDWVFPICTGGERLKGEDG 240

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
           +K+HPTQKPEALL R+L+SSTKPGD++LDPFFG+GT+GAVAK+L R FIGIE + DYI+ 
Sbjct: 241 KKVHPTQKPEALLHRVLMSSTKPGDVVLDPFFGTGTTGAVAKRLGRHFIGIERETDYIEA 300

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADG 320
           A  RI +++P    +LTV TGKR  PRV F  ++E GL+  G +LT+++    A + ADG
Sbjct: 301 ARARIDAIEPGQAAQLTVTTGKRALPRVPFGAIIENGLLSAGDVLTDSKRRWKAMIRADG 360

Query: 321 TLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           +LI   E  SIH+ GA+V G + CNGW FW+ E+ G+L  I+ LR + R  +
Sbjct: 361 SLIESGEAASIHKTGARVQGLDACNGWTFWHVEREGKLVCIDDLRAIYRDAM 412


>gi|110633120|ref|YP_673328.1| DNA adenine methylase CcrM [Mesorhizobium sp. BNC1]
 gi|110284104|gb|ABG62163.1| DNA adenine methylase CcrM [Chelativorans sp. BNC1]
          Length = 372

 Score =  505 bits (1301), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 234/355 (65%), Positives = 288/355 (81%)

Query: 18  EWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSS 77
           +W D I+KG+ ++ LE+LP KSVD+IFADPPYNLQL G L+RPD SLVDAV D WD+F S
Sbjct: 18  DWLDDILKGDCVAALERLPEKSVDVIFADPPYNLQLEGALHRPDQSLVDAVDDEWDQFES 77

Query: 78  FEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPM 137
           F AYDAFTRAWLLA RRVLKPNGT+WVIGSYHNIFR+G ++Q+L FWILNDIVWRK+NPM
Sbjct: 78  FAAYDAFTRAWLLAARRVLKPNGTVWVIGSYHNIFRVGAIMQDLGFWILNDIVWRKTNPM 137

Query: 138 PNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRN 197
           PNFRGRRFQNAHET+IWAS    AKGYTFNY+A+KAAN+D+QMRSDWL PIC+G ERL++
Sbjct: 138 PNFRGRRFQNAHETMIWASRDRNAKGYTFNYEAMKAANDDLQMRSDWLFPICTGKERLKD 197

Query: 198 KDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDY 257
            DG K+HPTQKPEALL+R+L+SSTKPGD++LDPFFGSGT+GAVAK+L R F+GIE   DY
Sbjct: 198 ADGNKVHPTQKPEALLARVLLSSTKPGDVVLDPFFGSGTTGAVAKRLGRHFVGIERDPDY 257

Query: 258 IDIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVC 317
           I  A +RIA+V+PL    L  +  KR EPR+AF  L++ GL++PG  L +++   +A V 
Sbjct: 258 IAAARERIAAVEPLDQAALAPMAAKREEPRIAFASLLDSGLVKPGMQLYDSKRRWAAHVR 317

Query: 318 ADGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           ADGTL  G E GSIHR+GA+V G + CNGW FW++E+ G L  I+ LR + R+ L
Sbjct: 318 ADGTLAVGPETGSIHRLGARVQGLDACNGWTFWHYEEKGALKPIDELRQVARRGL 372


>gi|154245121|ref|YP_001416079.1| DNA methylase N-4/N-6 domain-containing protein [Xanthobacter
           autotrophicus Py2]
 gi|154159206|gb|ABS66422.1| DNA methylase N-4/N-6 domain protein [Xanthobacter autotrophicus
           Py2]
          Length = 389

 Score =  503 bits (1295), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 235/354 (66%), Positives = 280/354 (79%), Gaps = 3/354 (0%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           D+I+ G+SI ++  LPA SVDL+FADPPYNLQL G+L RPD SLVDAV D WD+F SF  
Sbjct: 32  DQILLGDSIQMMAGLPAGSVDLVFADPPYNLQLGGELKRPDESLVDAVDDDWDRFDSFAT 91

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YDAFTRAWLLA RR LKPNGTL+VIGSYHNIFR+G M+Q+L FWILNDIVWRK+NPMPNF
Sbjct: 92  YDAFTRAWLLAARRALKPNGTLFVIGSYHNIFRVGAMMQDLGFWILNDIVWRKANPMPNF 151

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           RGRRF NAHETLIWA+ S  AK YTFNY+ALKA NEDVQ+RSDWL P+C+G ERL++  G
Sbjct: 152 RGRRFTNAHETLIWAARSADAK-YTFNYEALKAGNEDVQVRSDWLFPLCTGQERLKDGAG 210

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
           +KLHPTQKPEALL+R+L+S+TKPGD++LDPFFGSGT+GAVAK+LRRSFIGIE ++ Y   
Sbjct: 211 KKLHPTQKPEALLARVLLSATKPGDVVLDPFFGSGTTGAVAKRLRRSFIGIEREEAYAQA 270

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADG 320
           A  RI +V+PL    L      R  PRVAF++LVERGL+ PG  LT+A+G   A V ADG
Sbjct: 271 ARARIDAVEPLPEDALVAPPSAREAPRVAFSVLVERGLVTPGAELTDAKGRFRAVVRADG 330

Query: 321 T--LISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           T  L  G  +GSIHRVGA   G+E CNGW FW+ E+ G  H I+TLR  +R E+
Sbjct: 331 TLALAGGQNVGSIHRVGALAQGAEACNGWTFWHVEEQGRRHPIDTLRARLRAEM 384


>gi|298294362|ref|YP_003696301.1| DNA methylase N-4/N-6 domain protein [Starkeya novella DSM 506]
 gi|296930873|gb|ADH91682.1| DNA methylase N-4/N-6 domain protein [Starkeya novella DSM 506]
          Length = 395

 Score =  502 bits (1293), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 230/357 (64%), Positives = 282/357 (78%), Gaps = 5/357 (1%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           D I++G+ ++ L KLPA+SVD++FADPPYNLQL G+L RPD S VDAV D+WDKF SF+A
Sbjct: 34  DTILRGDCVAELSKLPARSVDMVFADPPYNLQLQGELKRPDDSRVDAVDDAWDKFESFQA 93

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YDAFTRAWLLA RRVLKP GTLWVIGSYHNIFR+G +LQ+L+FWILNDIVWRK+NPMPNF
Sbjct: 94  YDAFTRAWLLAVRRVLKPTGTLWVIGSYHNIFRVGALLQDLDFWILNDIVWRKTNPMPNF 153

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           RGRRF NAHETLIWA+  P AKGYTFNY+ALKAANEDVQMRSDWL PICSG ERL+++DG
Sbjct: 154 RGRRFTNAHETLIWAAREPGAKGYTFNYEALKAANEDVQMRSDWLFPICSGGERLKDEDG 213

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
            KLHPTQKPEALL+R+++S++KPGD++LDPF GSGT+ AVA++L R F+GIE    Y D 
Sbjct: 214 RKLHPTQKPEALLARVILSASKPGDVVLDPFLGSGTTAAVARRLGRHFVGIERDPTYADA 273

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADG 320
           A  RI +V+PL ++ L +    R  PRVAFN L+ERGL+ PG +LT+A+    A V ADG
Sbjct: 274 AQARIDAVEPLPDLALALAPTAREAPRVAFNSLIERGLLAPGTLLTDAKARTRALVRADG 333

Query: 321 TLISGT-----ELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           TL   T     ++GSIHR GA   G + CNGW +W+ E    L  I+TLR ++R E+
Sbjct: 334 TLSLETAPGLGQIGSIHRAGALAQGLDACNGWTYWHVETREGLKPIDTLRAVMRSEM 390


>gi|328544989|ref|YP_004305098.1| adenine dna methyltransferase protein [polymorphum gilvum
           SL003B-26A1]
 gi|326414731|gb|ADZ71794.1| Adenine dna methyltransferase protein [Polymorphum gilvum
           SL003B-26A1]
          Length = 379

 Score =  487 bits (1254), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 221/354 (62%), Positives = 281/354 (79%), Gaps = 1/354 (0%)

Query: 19  WKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSF 78
           W + I+KG+ ++ LEKLP++SVDL+FADPPYNLQL G L+RPD S VDA  D+WD+F SF
Sbjct: 25  WLNTILKGDCVAALEKLPSRSVDLVFADPPYNLQLGGDLHRPDQSRVDACDDAWDQFDSF 84

Query: 79  EAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
           EAYDAFTRAWLLA RRVLK +G++WVIGSYHNIFR+G +LQ+L FWILND+VW KSNPMP
Sbjct: 85  EAYDAFTRAWLLAVRRVLKKDGSIWVIGSYHNIFRVGAILQDLGFWILNDVVWVKSNPMP 144

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
           NFRG+R  NAHET+IWA+PS  A+ YTFNYDALKA N+D+QMRSDW +P+C+G+ERL++ 
Sbjct: 145 NFRGKRLTNAHETMIWAAPSKDAR-YTFNYDALKAFNDDLQMRSDWHLPLCTGAERLKDG 203

Query: 199 DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYI 258
            G+K+HPTQKPEALL R+L +S+KP DI+LDPFFG+GT+GAVA+KL R+F+G+E +Q YI
Sbjct: 204 GGQKVHPTQKPEALLYRVLTASSKPDDIVLDPFFGTGTTGAVARKLGRNFVGVEREQAYI 263

Query: 259 DIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCA 318
           D AT RIA+V+P     L +  GKR EPR+ F  L+E GL+QPG  LT ++G   A V A
Sbjct: 264 DAATARIAAVEPASGACLDMQKGKRAEPRIPFGSLLEAGLLQPGATLTCSKGRHKAIVRA 323

Query: 319 DGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           DG+L S    GSIH+VGA V G++ CNGW FW+ E+ G    I+ LR ++R  L
Sbjct: 324 DGSLASADHTGSIHKVGALVQGADACNGWTFWHIEEDGTRAPIDALRQIIRSRL 377


>gi|39934101|ref|NP_946377.1| DNA methylase N-4/N-6 [Rhodopseudomonas palustris CGA009]
 gi|192289628|ref|YP_001990233.1| DNA methylase N-4/N-6 domain protein [Rhodopseudomonas palustris
           TIE-1]
 gi|39647949|emb|CAE26469.1| possible adenine DNA methyltransferase [Rhodopseudomonas palustris
           CGA009]
 gi|192283377|gb|ACE99757.1| DNA methylase N-4/N-6 domain protein [Rhodopseudomonas palustris
           TIE-1]
          Length = 376

 Score =  486 bits (1251), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 222/351 (63%), Positives = 275/351 (78%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           +II G+ I+ +EKLP KSVDL+FADPPYNLQL G L RPD S VDAV D WDKF+SF AY
Sbjct: 24  RIIVGDCIAEMEKLPPKSVDLVFADPPYNLQLKGALKRPDESEVDAVDDDWDKFASFAAY 83

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFR 141
           D FTRAWLLA RR++KP+ TLWVIGSYHNIFR+GT++Q+L FW+LNDIVWRKSNPMPNFR
Sbjct: 84  DNFTRAWLLAARRIMKPSATLWVIGSYHNIFRVGTIMQDLGFWVLNDIVWRKSNPMPNFR 143

Query: 142 GRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGE 201
           GRRF NAHET+IWA+    AKGYTFNYDALKAANEDVQ RSDWLIP+C+G ERL+ KDG+
Sbjct: 144 GRRFTNAHETMIWAARDENAKGYTFNYDALKAANEDVQARSDWLIPLCTGDERLKGKDGK 203

Query: 202 KLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIA 261
           K+HPTQKPE LL+R+L+SS+KPGD+++DPF G+GT+GAVAK+LRR++IGIE  + Y + A
Sbjct: 204 KVHPTQKPEQLLARVLLSSSKPGDLVVDPFNGTGTTGAVAKRLRRNYIGIERDKTYAEAA 263

Query: 262 TKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGT 321
             RI S++PL +  L      R  PRVAF+ L+ERG+I PG  L +++    A V ADG 
Sbjct: 264 RARIDSIEPLPDDTLKPFLTARDAPRVAFSELIERGMISPGARLVDSKKRHGALVRADGA 323

Query: 322 LISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           ++ G ++GSIHR+GA   GSE CNGW FW+ E    L  I+ LR  +R  +
Sbjct: 324 IMLGDKVGSIHRIGAVAQGSEACNGWTFWHVETSKGLRLIDELRAEIRSTM 374


>gi|90420098|ref|ZP_01228006.1| DNA modification methylase BabI [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90335432|gb|EAS49182.1| DNA modification methylase BabI [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 379

 Score =  485 bits (1248), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 228/354 (64%), Positives = 280/354 (79%)

Query: 19  WKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSF 78
           W D+I KG+ +S +  LP  SVD+IFADPPYNLQL G L+RPD S VDAV D WD+F SF
Sbjct: 21  WLDRIHKGHCVSQMAALPENSVDVIFADPPYNLQLGGDLHRPDQSKVDAVDDHWDQFESF 80

Query: 79  EAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
           +AYDAFTRAWLLA RRVLKPNGT+WVIGSYHNIFR+G M+Q+L FW+LND+VWRK+NPMP
Sbjct: 81  QAYDAFTRAWLLAARRVLKPNGTIWVIGSYHNIFRVGAMMQDLGFWMLNDVVWRKTNPMP 140

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
           NFRGRRFQNAHET+IWAS    AKGYTFNYDA+K+AN+DVQMRSDWL PICSG ERL++ 
Sbjct: 141 NFRGRRFQNAHETMIWASRDANAKGYTFNYDAMKSANDDVQMRSDWLFPICSGGERLKDA 200

Query: 199 DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYI 258
           +G K HPTQKPEALL+R+L+SSTKPGD++LDPFFG+GT+GAVAK+L R ++GIE +  YI
Sbjct: 201 EGRKTHPTQKPEALLARVLLSSTKPGDVVLDPFFGTGTTGAVAKRLGRHYVGIEREDVYI 260

Query: 259 DIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCA 318
           + A  RIA+V+ L    L V  GKR EPR+ F  L+E GL+QPG  LT+A+   +A V A
Sbjct: 261 EAAEARIAAVEALDPTVLKVSAGKRAEPRIPFASLLEAGLVQPGTELTDAKRRWTARVRA 320

Query: 319 DGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           DGT+  G +  SIHR+GAKV G + CNGW FW+ +    L  I+TLR  +R ++
Sbjct: 321 DGTIAIGEDAASIHRIGAKVQGLDACNGWTFWHIDSKKGLTPIDTLRQTMRDQM 374


>gi|316932563|ref|YP_004107545.1| DNA methylase N-4/N-6 domain-containing protein [Rhodopseudomonas
           palustris DX-1]
 gi|315600277|gb|ADU42812.1| DNA methylase N-4/N-6 domain protein [Rhodopseudomonas palustris
           DX-1]
          Length = 376

 Score =  484 bits (1245), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 220/356 (61%), Positives = 277/356 (77%)

Query: 17  FEWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFS 76
           +E + +II G+ I+ +EKLPAKSVDL+FADPPYNLQL G L RPD S VDAV D WDKF+
Sbjct: 19  YEPESQIIVGDCIAEMEKLPAKSVDLVFADPPYNLQLKGALKRPDESEVDAVDDDWDKFA 78

Query: 77  SFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNP 136
           SF AYD FTRAWLLA RR++KP+ TLWVIGSYHNIFR+G ++Q+L FW+LNDIVWRKSNP
Sbjct: 79  SFAAYDNFTRAWLLAARRIMKPSATLWVIGSYHNIFRVGAIMQDLGFWLLNDIVWRKSNP 138

Query: 137 MPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLR 196
           MPNFRGRRF NAHET+IWA+    AKGYTFNYDALKAANEDVQ RSDWLIP+C+G ERL+
Sbjct: 139 MPNFRGRRFTNAHETMIWAARDENAKGYTFNYDALKAANEDVQARSDWLIPLCTGEERLK 198

Query: 197 NKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQD 256
            KDG+K+HPTQKPE LL+R+L+SS++PGD+++DPF G+GT+GAVAK+LRR++IG E  + 
Sbjct: 199 GKDGKKVHPTQKPEQLLARVLLSSSRPGDLVVDPFNGTGTTGAVAKRLRRNYIGFERDRT 258

Query: 257 YIDIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATV 316
           Y + A  RI +++PL +  L      R  PRVAF+ L+ERG+I PG  L +++    A V
Sbjct: 259 YAEAARARIDAIEPLPDDTLKPFLTARDAPRVAFSELIERGMISPGARLVDSKKRHGALV 318

Query: 317 CADGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
            ADG ++ G ++GSIHR+GA   GSE CNGW FW+ E    L  I+ LR  +R  +
Sbjct: 319 RADGAIMLGDKVGSIHRIGAMAQGSEACNGWTFWHVETSKGLRLIDELRTEIRNTM 374


>gi|158422077|ref|YP_001523369.1| putative adenine DNA methyltransferase [Azorhizobium caulinodans
           ORS 571]
 gi|158328966|dbj|BAF86451.1| putative adenine DNA methyltransferase [Azorhizobium caulinodans
           ORS 571]
          Length = 395

 Score =  482 bits (1240), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 218/356 (61%), Positives = 274/356 (76%), Gaps = 4/356 (1%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           D+I+ G+ +  L  LP  SVD++FADPPYNLQL G+L RPD S VDAV D+WD+F SFEA
Sbjct: 34  DRILIGDCVEQLASLPPHSVDMVFADPPYNLQLQGELKRPDDSRVDAVDDAWDQFESFEA 93

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YDAFTRAWLLA +RV+KPN T+WVIGSYHNIFR+G ++Q+L FWILND+VWRKSNPMPNF
Sbjct: 94  YDAFTRAWLLAVKRVMKPNATIWVIGSYHNIFRVGALMQDLGFWILNDVVWRKSNPMPNF 153

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           RGRRF NAHET+IWA+  P AKGY FNY+ALK  NEDVQ+RSDWL+PIC+G ERL++  G
Sbjct: 154 RGRRFTNAHETMIWAARDPGAKGYQFNYEALKGGNEDVQVRSDWLLPICTGGERLKDAQG 213

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
            KLHPTQKPEALL+R+++S++KPGD++LDPF GSGTS AVAK+LRR F+G+E  + Y   
Sbjct: 214 RKLHPTQKPEALLARVMLSASKPGDVVLDPFLGSGTSAAVAKRLRRHFVGVERDETYAAA 273

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADG 320
           A  RI +++PL    L      R  PRVAF+ LV+ GL+ PG  LT+A+G++ A V ADG
Sbjct: 274 AAARIDAIEPLPEAALVAPPSAREAPRVAFSALVDSGLVTPGLELTDAKGHVRAVVRADG 333

Query: 321 T--LISGTEL--GSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           T  L++   L  GSIHR+GA   G+E CNGW FW+ E+ G  H I+ LR  +R E+
Sbjct: 334 TIALVNAATLAVGSIHRMGALAQGAEACNGWTFWHVEQEGRRHPIDVLRARLRAEM 389


>gi|209886095|ref|YP_002289952.1| modification methylase CcrMI [Oligotropha carboxidovorans OM5]
 gi|209874291|gb|ACI94087.1| modification methylase CcrMI [Oligotropha carboxidovorans OM5]
          Length = 374

 Score =  481 bits (1237), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 224/371 (60%), Positives = 279/371 (75%), Gaps = 1/371 (0%)

Query: 1   MSQKNSLAINENQNSIFEWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRP 60
           MS++ + A     N       +I+ G+ ++ + KLPA SVDL+FADPPYNLQL G+L RP
Sbjct: 1   MSRRGASAKAPRTNFETSPSARIVIGDCVAEMTKLPANSVDLVFADPPYNLQLKGELKRP 60

Query: 61  DHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQN 120
           D S VDAV D WDKFSSF AYD FTRAWLLACRR++KP  T+WVIGSYHNIFR+G ++Q+
Sbjct: 61  DESHVDAVNDDWDKFSSFAAYDDFTRAWLLACRRIMKPTATIWVIGSYHNIFRVGAIMQD 120

Query: 121 LNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQM 180
           L FWILNDIVWRKSNPMPNFRGRRF NAHET+IWA+   +A  YTFNYDALKAANEDVQ 
Sbjct: 121 LGFWILNDIVWRKSNPMPNFRGRRFTNAHETMIWAA-RDEATKYTFNYDALKAANEDVQA 179

Query: 181 RSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAV 240
           RSDWLIP+C+G ERL+ KDG K+HPTQKPE LL+R+L+SS+KPGD+++DPF G+GT+GAV
Sbjct: 180 RSDWLIPLCTGEERLKGKDGRKIHPTQKPEGLLARVLLSSSKPGDLVIDPFNGTGTTGAV 239

Query: 241 AKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQ 300
           AK+L RS+IG E  + Y + A KRIA+V+PL    L      R  PRV F  L+ERG+I 
Sbjct: 240 AKRLGRSYIGFERDRTYAEAAEKRIAAVEPLPQATLAPFMTAREAPRVPFAELIERGMIS 299

Query: 301 PGQILTNAQGNISATVCADGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHS 360
           PG  L +++   +A V ADG ++ G ++GSIHR+GA   GSE CNGW+FW+ E    L  
Sbjct: 300 PGAKLVDSKKKHAALVRADGAIMLGDKVGSIHRMGALAQGSEACNGWSFWHVETKKGLRL 359

Query: 361 INTLRILVRKE 371
           I+ LR  VR+E
Sbjct: 360 IDELRAEVRRE 370


>gi|118590772|ref|ZP_01548173.1| adenine dna methyltransferase protein [Stappia aggregata IAM 12614]
 gi|118436748|gb|EAV43388.1| adenine dna methyltransferase protein [Stappia aggregata IAM 12614]
          Length = 379

 Score =  476 bits (1224), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 219/354 (61%), Positives = 274/354 (77%), Gaps = 1/354 (0%)

Query: 19  WKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSF 78
           W + I+KG+ ++ LEKLP++SVDL+FADPPYNLQL G L+RPD S VDA  D WD+F SF
Sbjct: 25  WLNTILKGDCVAALEKLPSRSVDLVFADPPYNLQLGGDLHRPDQSKVDACDDHWDQFESF 84

Query: 79  EAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
           EAYDAFTRAWLLA RRV+K +G+L+VIGSYHNIFR+G +LQ+L FWI+NDIVW KSNPMP
Sbjct: 85  EAYDAFTRAWLLAVRRVMKADGSLYVIGSYHNIFRVGAILQDLGFWIMNDIVWLKSNPMP 144

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
           NFRG+RF NAHET+IWA  S  AK  TFNYDALK  NED+QMRSDW +P+C+G+ERL+ K
Sbjct: 145 NFRGKRFTNAHETMIWAVKSKDAKP-TFNYDALKTFNEDLQMRSDWHLPLCTGAERLKGK 203

Query: 199 DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYI 258
           DG+K+HPTQKPEALL R+L +S+KPGD++LDPFFG+GT+GAVAKKL R ++G+E +QDYI
Sbjct: 204 DGQKVHPTQKPEALLYRVLTASSKPGDVVLDPFFGTGTTGAVAKKLGRHYVGVEREQDYI 263

Query: 259 DIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCA 318
           D AT RI +++P     L +  GKR   R+ F  L+E GL+QPG  L+  +G   A V A
Sbjct: 264 DAATARIEAIEPGDAASLEMQQGKRALKRIPFGTLLESGLLQPGTELSCPKGKHLAIVRA 323

Query: 319 DGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           DG+L SG   GSIH+VGA V G E CNGW FW+  + G+   I+ LR  +R  L
Sbjct: 324 DGSLKSGDHTGSIHKVGALVQGQEACNGWTFWHINEGGKTSPIDDLRKEIRSRL 377


>gi|115526424|ref|YP_783335.1| DNA methylase N-4/N-6 domain-containing protein [Rhodopseudomonas
           palustris BisA53]
 gi|115520371|gb|ABJ08355.1| DNA adenine methylase CcrM [Rhodopseudomonas palustris BisA53]
          Length = 379

 Score =  474 bits (1221), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 214/351 (60%), Positives = 268/351 (76%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           +I+ G+ ++ + KLP  SVDL+FADPPYNLQL G L RPD S VDAV D WDKFSSF AY
Sbjct: 26  RIVIGDCVAEMSKLPKASVDLVFADPPYNLQLKGDLKRPDESHVDAVNDDWDKFSSFAAY 85

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFR 141
           D FTRAWLL+CRR++KP+ T+WVIGSYHNIFR+G ++Q+L FW+LNDIVWRKSNPMPNFR
Sbjct: 86  DDFTRAWLLSCRRIMKPSATIWVIGSYHNIFRVGAIMQDLGFWVLNDIVWRKSNPMPNFR 145

Query: 142 GRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGE 201
           GRRF NAHET+IWA+    AKGYTFNY+ALKAANEDVQ RSDWLIP+C+G ERL+  DG+
Sbjct: 146 GRRFTNAHETMIWAARDENAKGYTFNYEALKAANEDVQARSDWLIPLCTGDERLKGADGK 205

Query: 202 KLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIA 261
           K+HPTQKPE LL+R+L+SS+KPGD+++DPF G+GT+GAVAK+L R +IG E  +DY   A
Sbjct: 206 KVHPTQKPEGLLARVLLSSSKPGDLVIDPFNGTGTTGAVAKRLGRRYIGFERDKDYAKAA 265

Query: 262 TKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGT 321
             RI +++PL    L      R+ PRVAF  LVERG+I PG  L +++    A V ADG 
Sbjct: 266 RARIDAIEPLPEATLAPFVTARSAPRVAFAELVERGMILPGTKLVDSKKRHGALVRADGA 325

Query: 322 LISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           ++ G ++GSIHR+GA   GSE CNGW FW+ E    L  I+ LR  +R  +
Sbjct: 326 IMLGDKVGSIHRIGAVAQGSEACNGWTFWHVETKKGLKLIDELRAEIRSGM 376


>gi|310817213|ref|YP_003965177.1| modification methylase [Ketogulonicigenium vulgare Y25]
 gi|308755948|gb|ADO43877.1| modification methylase [Ketogulonicigenium vulgare Y25]
          Length = 367

 Score =  474 bits (1220), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 216/352 (61%), Positives = 272/352 (77%), Gaps = 1/352 (0%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           D II G+ I  +  LP  S+DLIFADPPYNLQL G+L+RPD+S VDAV D WD+F SF A
Sbjct: 15  DSIIAGDCIDAMRALPDASIDLIFADPPYNLQLKGELHRPDNSRVDAVDDHWDQFDSFAA 74

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YDAF+RAWL   RR+LKPNG +WVIGSYHNIFR+G  LQN  +W+LND++WRKSNPMPNF
Sbjct: 75  YDAFSRAWLAEARRLLKPNGAIWVIGSYHNIFRLGAELQNQGYWLLNDVIWRKSNPMPNF 134

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           RG+R  NAHETLIWA+ S  AK  TFNY+ALKA NE VQMRSDW++PIC+G ERL+  DG
Sbjct: 135 RGKRLTNAHETLIWAAKSENAKP-TFNYEALKALNEGVQMRSDWVLPICTGHERLKGDDG 193

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
            K HPTQKPE+LL R+L+ +T PGD++LDPFFG+GT+GAVAK L R FIGIE ++ Y  +
Sbjct: 194 AKAHPTQKPESLLHRVLIGTTNPGDVVLDPFFGTGTTGAVAKMLGRHFIGIEREESYRKV 253

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADG 320
           AT+R+A V+PL    L V T KR EPRVAF LLVERG+++PG+ L +  G  SA V ADG
Sbjct: 254 ATRRLAKVRPLSAEALAVTTSKRAEPRVAFGLLVERGMLRPGEELQSLNGRHSAKVRADG 313

Query: 321 TLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           TL++    GSIH+VGA++ G+ +CNGW +W+F++ G+   I+ LR  +R E+
Sbjct: 314 TLVATDHTGSIHQVGARLEGAPSCNGWTYWHFKRDGQNVPIDALRQQIRDEM 365


>gi|86748198|ref|YP_484694.1| DNA methylase N-4/N-6 [Rhodopseudomonas palustris HaA2]
 gi|86571226|gb|ABD05783.1| DNA adenine methylase CcrM [Rhodopseudomonas palustris HaA2]
          Length = 377

 Score =  473 bits (1217), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 219/353 (62%), Positives = 274/353 (77%)

Query: 20  KDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFE 79
           +++II G+ ++ + KLPAKSVDL+FADPPYNLQL G L RPD S VDAV D WDKFSSF 
Sbjct: 22  ENRIIVGDCVAEMSKLPAKSVDLVFADPPYNLQLKGALKRPDESQVDAVDDDWDKFSSFA 81

Query: 80  AYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPN 139
           AYD FTRAWLLA RR++KP+ T+WVIGSYHNIFR+G ++Q+L FW+LNDIVWRK+NPMPN
Sbjct: 82  AYDDFTRAWLLAARRIMKPSATIWVIGSYHNIFRVGAIMQDLGFWVLNDIVWRKTNPMPN 141

Query: 140 FRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKD 199
           FRGRRF NAHET+IWA+    AKGYTFNYDALKA+NEDVQ RSDWLIP+C+G ERL+ KD
Sbjct: 142 FRGRRFTNAHETMIWAARDENAKGYTFNYDALKASNEDVQARSDWLIPLCTGDERLKGKD 201

Query: 200 GEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYID 259
           G+K+HPTQKPE LL+R+L+SS+KPGD+++DPF G+GT+GAVAK+LRR++IG E  + Y D
Sbjct: 202 GKKVHPTQKPEGLLARVLLSSSKPGDLVIDPFNGTGTTGAVAKRLRRNYIGFERDRTYAD 261

Query: 260 IATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCAD 319
            A  RI +V+PL    L      R  PRVAF+ L+ERG+I PG  L +++    A V AD
Sbjct: 262 AARARIDAVEPLPEDTLKPFLTARDAPRVAFSELIERGMISPGAKLVDSKKRHGALVRAD 321

Query: 320 GTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           G ++ G ++GSIHR+GA   GSE CNGW FW+ E    L  I+ LR  VR  +
Sbjct: 322 GAIMLGDKVGSIHRIGAMAQGSEACNGWTFWHVETTKGLRLIDELRAEVRSAM 374


>gi|85714254|ref|ZP_01045242.1| DNA methylase N-4/N-6 [Nitrobacter sp. Nb-311A]
 gi|85698701|gb|EAQ36570.1| DNA methylase N-4/N-6 [Nitrobacter sp. Nb-311A]
          Length = 376

 Score =  472 bits (1214), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 220/351 (62%), Positives = 271/351 (77%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           +II G+ ++ + KLPA S DLIFADPPYNLQL G+L RPD S VDAV   WDKFSSF AY
Sbjct: 23  RIIIGDCVAGMSKLPAGSADLIFADPPYNLQLKGELKRPDESHVDAVNSEWDKFSSFSAY 82

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFR 141
           D FTRAWLLACRRV+KP+ T+WVIGSYHNIFR+G M+Q+L FW+LNDIVWRK+NPMPNFR
Sbjct: 83  DDFTRAWLLACRRVMKPSATIWVIGSYHNIFRVGAMMQDLGFWVLNDIVWRKTNPMPNFR 142

Query: 142 GRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGE 201
           GRRF NAHET+IWA+    AKGYTFNY+ALKAANEDVQ RSDWLIP+C+G+ERL+ KDG 
Sbjct: 143 GRRFTNAHETMIWAARDENAKGYTFNYEALKAANEDVQARSDWLIPLCTGNERLKGKDGR 202

Query: 202 KLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIA 261
           K+HPTQKPE LL+R+L+SS+KPGD+++DPF G+GT+GAVAK+L RS+IG E  Q Y   A
Sbjct: 203 KIHPTQKPEGLLARVLLSSSKPGDLVIDPFNGTGTTGAVAKRLGRSYIGFERDQAYAAAA 262

Query: 262 TKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGT 321
            KRIA+V+PL    L      R  PRVAF+ L+ERG+I PG  L +A+    A V ADG 
Sbjct: 263 EKRIAAVEPLPEATLAPFMTAREAPRVAFSELIERGMISPGAKLVDAKKRHGALVRADGA 322

Query: 322 LISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           ++ G ++GSIHR+GA   G+  CNGW FW+ E    L  I+ LR  +R ++
Sbjct: 323 IMLGDKVGSIHRIGAVAQGASACNGWTFWHIETSKGLRLIDELRAEIRSQM 373


>gi|90425838|ref|YP_534208.1| DNA methylase N-4/N-6 [Rhodopseudomonas palustris BisB18]
 gi|90107852|gb|ABD89889.1| DNA methylase N-4/N-6 [Rhodopseudomonas palustris BisB18]
          Length = 377

 Score =  469 bits (1208), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 215/351 (61%), Positives = 270/351 (76%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           +I+ G+ ++ + K+ A SVDL+FADPPYNLQL G L RPD S VDAVTD WDKF SF AY
Sbjct: 24  QIVIGDCVAEMSKMAAGSVDLVFADPPYNLQLKGDLKRPDESHVDAVTDDWDKFDSFAAY 83

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFR 141
           D FTRAWLLACRR++KP  TLWVIGSYHNIFR+GT++Q+L FW+LNDIVWRK+NPMPNFR
Sbjct: 84  DNFTRAWLLACRRIMKPTATLWVIGSYHNIFRVGTIMQDLGFWVLNDIVWRKTNPMPNFR 143

Query: 142 GRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGE 201
           GRRF NAHET+IWA+    +KGYTFNY+ALKAANEDVQ RSDWLIP+C+G ERL+  DG+
Sbjct: 144 GRRFTNAHETMIWAARDENSKGYTFNYEALKAANEDVQARSDWLIPLCTGEERLKGADGK 203

Query: 202 KLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIA 261
           K+HPTQKPE LL+R+L+SS+KPGD++LDPF G+GT+GAVAK+L R +IG E   DY   A
Sbjct: 204 KIHPTQKPEGLLARVLLSSSKPGDLVLDPFNGTGTTGAVAKRLGRHYIGFERDHDYAAAA 263

Query: 262 TKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGT 321
             RI +++PL +  L      R+ PRVAF+ L+ERG+I PG  L +++    A V ADG 
Sbjct: 264 RARIDAIEPLPDATLAPFMTARSAPRVAFSELIERGIISPGTKLVDSKKRHGALVRADGA 323

Query: 322 LISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           ++ G ++GSIHR+GA   GSE CNGW FW+ E    L  I+ LR  +R E+
Sbjct: 324 IMLGDKVGSIHRMGAVAQGSEACNGWTFWHVETHKGLRLIDELRAEIRSEM 374


>gi|91975680|ref|YP_568339.1| DNA methylase N-4/N-6 [Rhodopseudomonas palustris BisB5]
 gi|91682136|gb|ABE38438.1| DNA adenine methylase CcrM [Rhodopseudomonas palustris BisB5]
          Length = 377

 Score =  469 bits (1207), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 218/358 (60%), Positives = 278/358 (77%), Gaps = 2/358 (0%)

Query: 17  FEW--KDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDK 74
           FE+  +++II G+ ++ + KLPA+SVDL+FADPPYNLQL G+L RPD S VDAV + WDK
Sbjct: 17  FEYLPENRIIVGDCVAEMSKLPARSVDLVFADPPYNLQLKGELKRPDESHVDAVDNDWDK 76

Query: 75  FSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKS 134
           FSSF AYD FTRAWLLA RR++KP+ T+WVIGSYHNIFR+G ++Q+L FW+LNDIVWRK+
Sbjct: 77  FSSFAAYDDFTRAWLLAARRIMKPSATIWVIGSYHNIFRVGAIMQDLGFWLLNDIVWRKT 136

Query: 135 NPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSER 194
           NPMPNFRGRRF NAHET+IWA+    AKGYTFNYDALKAANEDVQ RSDWLIP+C+G ER
Sbjct: 137 NPMPNFRGRRFTNAHETMIWAARDENAKGYTFNYDALKAANEDVQARSDWLIPLCTGEER 196

Query: 195 LRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMK 254
           L+  DG+K+HPTQKPE LL+R+L+SS+KPGD+++DPF G+GT+GAVAK+LRR++IG E  
Sbjct: 197 LKGSDGKKVHPTQKPEGLLARVLLSSSKPGDLVIDPFNGTGTTGAVAKRLRRNYIGFERD 256

Query: 255 QDYIDIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISA 314
           +DY   A  RIA+++PL    L      R+ PRVAF  L+ERG+I PG  L +++    A
Sbjct: 257 RDYATAAEARIAAIEPLPEATLAPFMTARSAPRVAFAELIERGIISPGTKLVDSKKRHGA 316

Query: 315 TVCADGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
            V ADG ++ G ++GSIHR+GA   GSE CNGW FW+ E    L  I+ LR  +R  +
Sbjct: 317 LVRADGAIMLGDKVGSIHRIGAVAQGSEACNGWTFWHVETSKGLRLIDELRAEIRSAM 374


>gi|254471927|ref|ZP_05085328.1| modification methylase SmeIP [Pseudovibrio sp. JE062]
 gi|211959129|gb|EEA94328.1| modification methylase SmeIP [Pseudovibrio sp. JE062]
          Length = 365

 Score =  469 bits (1206), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 215/355 (60%), Positives = 273/355 (76%), Gaps = 1/355 (0%)

Query: 18  EWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSS 77
           EW D IIKG+ +  L KLP  SVD++FADPPYNLQL G L+RPDHS VDA  D WD+FSS
Sbjct: 10  EWLDTIIKGDCVEALNKLPDNSVDVVFADPPYNLQLGGDLHRPDHSKVDACDDHWDQFSS 69

Query: 78  FEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPM 137
           F+AYD FTRAWL A RRVLKPNG++WVIGSYHNIFR+G ++Q+L FWI ND+VW K+NPM
Sbjct: 70  FKAYDEFTRAWLTAVRRVLKPNGSIWVIGSYHNIFRVGAVMQDLGFWINNDVVWLKTNPM 129

Query: 138 PNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRN 197
           PNFRG+RF NAHETLIWA PS ++K  TFNYDA+K  N+D+QMRSDW++PIC+G ERL++
Sbjct: 130 PNFRGKRFTNAHETLIWACPSQESKP-TFNYDAMKTFNDDLQMRSDWVLPICTGHERLKD 188

Query: 198 KDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDY 257
            +G+K+HPTQKPE+LL R+L+S++  GD+ILDPFFG+GT+GAVAKKL R F+G E +  Y
Sbjct: 189 DNGDKVHPTQKPESLLYRVLLSTSNQGDVILDPFFGTGTTGAVAKKLGRHFVGCEREDAY 248

Query: 258 IDIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVC 317
           I  A++RI  V P  +  L +  GKR  PRV F  L+E GL+ PG  LT+A+G   ATV 
Sbjct: 249 IKAASERIDRVTPANDDFLAMTQGKRALPRVPFGNLLETGLLTPGAELTDARGRFKATVR 308

Query: 318 ADGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           ADG+LI G   GSIH+VGA V G + CNGW FW+ ++   L  ++ LR +VR ++
Sbjct: 309 ADGSLICGEHSGSIHKVGALVQGQQACNGWTFWHVKRGKALEPVDALRQVVRSQM 363


>gi|254504291|ref|ZP_05116442.1| DNA methylase domain protein [Labrenzia alexandrii DFL-11]
 gi|222440362|gb|EEE47041.1| DNA methylase domain protein [Labrenzia alexandrii DFL-11]
          Length = 346

 Score =  469 bits (1206), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 214/344 (62%), Positives = 272/344 (79%), Gaps = 1/344 (0%)

Query: 29  ISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAW 88
           ++ LEKLP++SVDL+FADPPYNLQL G L+RPD S VDA  D WD+F SFEAYDAFTRAW
Sbjct: 1   MAALEKLPSRSVDLVFADPPYNLQLGGDLHRPDQSKVDACDDHWDQFESFEAYDAFTRAW 60

Query: 89  LLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNA 148
           LLA RRV+K +G+L+VIGSYHNIFR+G +LQ+L FWI+NDIVW KSNPMPNFRG+RF NA
Sbjct: 61  LLAARRVMKTDGSLYVIGSYHNIFRVGAILQDLGFWIMNDIVWLKSNPMPNFRGKRFTNA 120

Query: 149 HETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQK 208
           HET+IWA+ S  AK  TFNYDALK  NED+QMRSDW +P+C+G+ERL+ KDG+K+HPTQK
Sbjct: 121 HETMIWATKSKDAKP-TFNYDALKTFNEDLQMRSDWHLPLCTGAERLKGKDGQKVHPTQK 179

Query: 209 PEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASV 268
           PEALL R+L +S+KPGD++LDPFFG+GT+GAVA+KL R+++G+E +QDYID AT RIA++
Sbjct: 180 PEALLYRVLTASSKPGDVVLDPFFGTGTTGAVARKLGRNYVGVEREQDYIDAATARIAAI 239

Query: 269 QPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTLISGTEL 328
           QP     L +  GKR + R+ F  L+E G+++PG  LT ++G   A V ADG+L SG   
Sbjct: 240 QPGDEKALEMQQGKRAQKRIPFGTLLENGVLEPGTELTCSKGKHLAIVRADGSLKSGDHT 299

Query: 329 GSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           GSIH+VGA V G E CNGW FW+ ++  +   I+ LR  +R  L
Sbjct: 300 GSIHKVGALVQGQEACNGWTFWHTKEGSKKSPIDELRKEIRSRL 343


>gi|92118691|ref|YP_578420.1| DNA methylase N-4/N-6 [Nitrobacter hamburgensis X14]
 gi|91801585|gb|ABE63960.1| DNA methylase N-4/N-6 [Nitrobacter hamburgensis X14]
          Length = 376

 Score =  467 bits (1202), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 215/351 (61%), Positives = 271/351 (77%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           +II G+ ++ + KLP+ S DL+FADPPYNLQL G L RPD S VDAV D WDKFSSF AY
Sbjct: 23  RIIVGDCVAAMSKLPSGSADLVFADPPYNLQLKGDLKRPDESHVDAVNDDWDKFSSFAAY 82

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFR 141
           D FTRAWLLACRRV+KP  T+WVIGSYHNIFR+G ++Q+L FW+LNDIVWRK+NPMPNFR
Sbjct: 83  DDFTRAWLLACRRVMKPTATIWVIGSYHNIFRVGAIMQDLGFWVLNDIVWRKTNPMPNFR 142

Query: 142 GRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGE 201
           GRRF NAHET+IWA+    AKGYTFNY+ALKA+NEDVQ RSDWLIP+C+G+ERL++KDG 
Sbjct: 143 GRRFTNAHETMIWAARDENAKGYTFNYEALKASNEDVQARSDWLIPLCTGNERLKDKDGR 202

Query: 202 KLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIA 261
           K+HPTQKPE LL+R+L+SS++PGD+I+DPF G+GT+GAVAK+L R++IG E  Q Y   A
Sbjct: 203 KVHPTQKPEGLLARVLLSSSRPGDLIIDPFNGTGTTGAVAKRLGRNYIGFERDQTYAAAA 262

Query: 262 TKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGT 321
            KRIA+++PL    +      R  PRVAF+ L+ERG+I PG  L +A+    A V ADG 
Sbjct: 263 EKRIAAIEPLPEATIAPFMTAREAPRVAFSELIERGMISPGAKLVDAKKRHGALVRADGA 322

Query: 322 LISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           ++ G ++GSIHR+GA   G+  CNGW FW+ E    L  I+ LR  +R E+
Sbjct: 323 IMLGDKVGSIHRIGAVAQGAGACNGWTFWHIETSKGLRLIDELRAEIRSEM 373


>gi|197104043|ref|YP_002129420.1| modification methylase [Phenylobacterium zucineum HLK1]
 gi|196477463|gb|ACG76991.1| modification methylase [Phenylobacterium zucineum HLK1]
          Length = 359

 Score =  466 bits (1200), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 214/352 (60%), Positives = 268/352 (76%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           D II+G+ +  L+KLP +SVDL+FADPPYNLQL G L RPD+S VDAV D WD+F SFEA
Sbjct: 6   DTIIEGDCLEALKKLPDRSVDLVFADPPYNLQLGGDLLRPDNSKVDAVDDHWDQFESFEA 65

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YDAFTRAWL  CRRVLK +G +WVIGSYHNIFR+G  +Q+L FWILNDIVWRKSNPMPNF
Sbjct: 66  YDAFTRAWLKECRRVLKDDGAIWVIGSYHNIFRVGVAVQDLGFWILNDIVWRKSNPMPNF 125

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           +G RF NAHETLIWAS S   + YTFNYDA+K AN+++QMRSDW +P+C+G ERL++  G
Sbjct: 126 KGTRFTNAHETLIWASKSRGGRRYTFNYDAMKMANDELQMRSDWTLPLCTGDERLKDGSG 185

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
            K HPTQKPEALL R++++STKPGD+ILDPFFG+GT+GAVA++L R F+GIE + +Y  +
Sbjct: 186 AKAHPTQKPEALLHRVILASTKPGDVILDPFFGTGTTGAVARRLGRKFVGIEREAEYAAL 245

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADG 320
           A KRIA V P    E+ V   KR EPRV F  ++E GL++PG +L   +G  +A V ADG
Sbjct: 246 ARKRIAQVTPATADEMAVTGSKRAEPRVPFGTILEAGLLRPGDVLYCPKGRNAARVRADG 305

Query: 321 TLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           +L+ G   GSIH+VGA V  +  CNGW +W+F+    L  I+ LR  VR +L
Sbjct: 306 SLVVGEVSGSIHKVGALVQSAPACNGWTYWHFKSDKGLAPIDVLRAKVRSQL 357


>gi|84687972|ref|ZP_01015836.1| modification methylase [Maritimibacter alkaliphilus HTCC2654]
 gi|84664004|gb|EAQ10504.1| modification methylase [Rhodobacterales bacterium HTCC2654]
          Length = 364

 Score =  466 bits (1198), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 218/352 (61%), Positives = 270/352 (76%), Gaps = 2/352 (0%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           ++I+ G+ I V+  LP  SVDLIFADPPYNLQL G L+RPD+S VDAV D WD+F+SF+ 
Sbjct: 14  NQILPGDCIEVMNSLPEGSVDLIFADPPYNLQLKGDLHRPDNSKVDAVDDEWDQFASFKV 73

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YD FTR WL A RR+LKPNG +WVIGSYHN+FR+G  LQN  FWILND+VWRKSNPMPNF
Sbjct: 74  YDDFTREWLAAARRLLKPNGAIWVIGSYHNVFRMGAELQNQGFWILNDVVWRKSNPMPNF 133

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           RG+R  NAHETLIWA  S  +K  TFNY+ALK+ NE VQMRSDW+IPIC+G ERL++ +G
Sbjct: 134 RGKRLTNAHETLIWAQKSEDSKA-TFNYEALKSLNEGVQMRSDWVIPICNGGERLKDDNG 192

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
           EK HPTQKPEALL R+LV +T PGD++LDPFFG+GT+GAVAK L R FIGIE ++ Y  +
Sbjct: 193 EKAHPTQKPEALLHRVLVGTTNPGDVVLDPFFGTGTTGAVAKMLGREFIGIEREEAYRKV 252

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADG 320
           A KRI+ ++      LTV T KR EPRVAF  LVERG+++PG+ L   +G I A V ADG
Sbjct: 253 AEKRISKIRKFDKEALTVSTSKRAEPRVAFGQLVERGMLRPGETLIGPRGQI-AKVRADG 311

Query: 321 TLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           TLISG   GSIH+VGA +  + +CNGW +W F++ G+  SI+ LR  +R E+
Sbjct: 312 TLISGEARGSIHQVGAALESAPSCNGWTYWAFKRDGKTVSIDVLRQQIRAEM 363


>gi|56698274|ref|YP_168647.1| modification methylase [Ruegeria pomeroyi DSS-3]
 gi|56680011|gb|AAV96677.1| modification methylase [Ruegeria pomeroyi DSS-3]
          Length = 367

 Score =  465 bits (1196), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 217/352 (61%), Positives = 268/352 (76%), Gaps = 1/352 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           I+ G+ I V+  +P  SVDLIFADPPYNLQL GQL+RPD+S VDAV D WD+FSSF AYD
Sbjct: 17  IVSGDCIDVMNAMPEASVDLIFADPPYNLQLKGQLHRPDNSQVDAVDDHWDQFSSFAAYD 76

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            FTRAWL A RR+LKPNG +WVIGSYHNIFR+G+ LQ+  +WILND+VWRKSNPMPNFRG
Sbjct: 77  QFTRAWLKAARRLLKPNGAIWVIGSYHNIFRVGSALQDAGYWILNDVVWRKSNPMPNFRG 136

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +RF NAHET+IWAS S   K YTFNY+ALKA NE VQMRSDW++PIC+G ER+++++G+K
Sbjct: 137 KRFTNAHETMIWASKSEGGK-YTFNYEALKALNEGVQMRSDWVMPICTGHERIKDENGDK 195

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKPEALL R+LVSST PGD++LDPFFG+GT+GAVAK L R FIGIE ++ Y  +A 
Sbjct: 196 AHPTQKPEALLHRVLVSSTNPGDVVLDPFFGTGTTGAVAKMLGREFIGIEREEAYRKVAE 255

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           KRIA V+      L V   KR EPR+ F  LVERG+++PG+ L +      A V ADGTL
Sbjct: 256 KRIAKVRKFDREALEVSASKRAEPRIPFGQLVERGMLRPGEELYSMNQRHKAKVRADGTL 315

Query: 323 ISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKELYN 374
           I     GSIH+VGA +  + +CNGW +W F++ G+   I+ LR  +R EL N
Sbjct: 316 IGQNIKGSIHQVGAHLENAPSCNGWTYWCFKRDGKTVPIDVLRQQIRAELEN 367


>gi|126734212|ref|ZP_01749959.1| modification methylase [Roseobacter sp. CCS2]
 gi|126717078|gb|EBA13942.1| modification methylase [Roseobacter sp. CCS2]
          Length = 369

 Score =  464 bits (1195), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 215/350 (61%), Positives = 268/350 (76%), Gaps = 1/350 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           I+ G+ I V+  LPA SVDLIFADPPYNLQL G L+RPD+S VDAV D+WD+F SF+ YD
Sbjct: 18  IVDGDCIDVMNSLPAGSVDLIFADPPYNLQLKGDLHRPDNSKVDAVDDAWDQFDSFKVYD 77

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            FTR WL A RR+LKPNG +WVIGSYHN+FR+G  LQN  FWILND+VWRKSNPMPNFRG
Sbjct: 78  KFTREWLAAARRLLKPNGAIWVIGSYHNVFRMGAELQNQGFWILNDVVWRKSNPMPNFRG 137

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +R  NAHETLIWAS    +K YTFNY+ALKA NE VQMRSDW++PIC+G ERL+N+ G+K
Sbjct: 138 KRLTNAHETLIWASKEEASK-YTFNYEALKALNEGVQMRSDWVLPICTGHERLKNEAGDK 196

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKP++LL R+LV++T PGD++LDPFFG+GT+GAVAK L R FIGIE ++ Y  +A 
Sbjct: 197 AHPTQKPQSLLHRVLVATTNPGDVVLDPFFGTGTTGAVAKMLGRDFIGIEREESYRKVAE 256

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           KRI + +   N  L V T KR EPRVAF +LVERG+++PG+ L +  G   A V ADGTL
Sbjct: 257 KRIKNTRKFDNEALQVSTSKRAEPRVAFGVLVERGMLRPGEELWSMNGRHKAKVRADGTL 316

Query: 323 ISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           I     GSIH+VGA + G+ +CNGW +W F++ G+   I+ LR  +R E+
Sbjct: 317 IGDDIKGSIHQVGAHLEGAPSCNGWTYWQFKRDGQKVPIDLLRQQIRSEM 366


>gi|299134661|ref|ZP_07027853.1| DNA methylase N-4/N-6 domain protein [Afipia sp. 1NLS2]
 gi|298590471|gb|EFI50674.1| DNA methylase N-4/N-6 domain protein [Afipia sp. 1NLS2]
          Length = 376

 Score =  464 bits (1194), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 217/351 (61%), Positives = 273/351 (77%), Gaps = 1/351 (0%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           +I+ G+ ++ + KLPA SVDL+FADPPYNLQL G+L RPD S VDAV + WDKFSSF AY
Sbjct: 24  RIVIGDCVAEMTKLPASSVDLVFADPPYNLQLKGELKRPDESHVDAVNNDWDKFSSFAAY 83

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFR 141
           D FTRAWLLA RR +KP+ T+WVIGSYHNIFR+G ++Q+L FWILNDIVWRK+NPMPNFR
Sbjct: 84  DDFTRAWLLAARRAMKPSATIWVIGSYHNIFRVGAIMQDLGFWILNDIVWRKTNPMPNFR 143

Query: 142 GRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGE 201
           GRRF NAHET+IWA+     K YTFNYDALKAANEDVQ RSDWLIP+C+G ERL+ KDG+
Sbjct: 144 GRRFTNAHETMIWAARDESTK-YTFNYDALKAANEDVQARSDWLIPLCTGDERLKGKDGK 202

Query: 202 KLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIA 261
           K+HPTQKPE LL+R+L+SS+KPGD+++DPF G+GT+GAVAK+L RS+IG E  + Y   A
Sbjct: 203 KVHPTQKPEGLLARVLLSSSKPGDLVIDPFNGTGTTGAVAKRLGRSYIGFERDKTYAAAA 262

Query: 262 TKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGT 321
            KRIA+V+PL    L      R  PRVAF+ L+ERG+I PG  L +++   +A V ADG 
Sbjct: 263 EKRIAAVEPLPEATLAPFLTARDAPRVAFSELIERGMISPGAKLVDSKKKHAALVRADGA 322

Query: 322 LISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           ++ G ++GSIHR+GA   GSE CNGW+FW+ E    L  I+ LR  +R+E+
Sbjct: 323 IMLGDKVGSIHRMGAVAQGSEACNGWSFWHVETKKGLRLIDELRAEIRREM 373


>gi|260432296|ref|ZP_05786267.1| modification methylase CcrMI [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260416124|gb|EEX09383.1| modification methylase CcrMI [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 367

 Score =  462 bits (1190), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 214/352 (60%), Positives = 267/352 (75%), Gaps = 1/352 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           I+ G+ I V+  LP  SVDLIFADPPYNLQL GQL+RPD+S VDAV D WD+FSSF AYD
Sbjct: 17  ILSGDCIEVMNSLPEASVDLIFADPPYNLQLKGQLHRPDNSQVDAVDDHWDQFSSFAAYD 76

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            FTRAWL A  R+LKPNG +WVIGSYHNIFR+G+ LQ+  +WILND++WRKSNPMPNFRG
Sbjct: 77  KFTRAWLKAAHRLLKPNGAIWVIGSYHNIFRVGSALQDAGYWILNDVIWRKSNPMPNFRG 136

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +RF NAHET+IWAS    AK YTFNY+ALKA NE VQMRSDW++PIC+G ERL++++G+K
Sbjct: 137 KRFTNAHETMIWASKREGAK-YTFNYEALKALNEGVQMRSDWVLPICTGHERLKDENGDK 195

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKPE+LL R+L+ ST PGD++LDPFFG+GT+GAVAK L R FIGIE ++ Y  +A 
Sbjct: 196 AHPTQKPESLLHRVLIGSTNPGDVVLDPFFGTGTTGAVAKMLGREFIGIEREESYRKVAE 255

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           KRIA V+      L V   KR EPRV F  LVERG+++PG+ L +      A V ADGTL
Sbjct: 256 KRIAKVRKFDRDALEVSASKRAEPRVPFGQLVERGMLRPGEELYSMNRRHKAKVRADGTL 315

Query: 323 ISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKELYN 374
           +     GSIH+VGA +  + +CNGW +W F++ G+   I+ LR  +R EL+N
Sbjct: 316 VGDNIKGSIHQVGAHLENAPSCNGWTYWCFKREGKTVPIDVLRQQIRAELHN 367


>gi|27377620|ref|NP_769149.1| adenine DNA methyltransferase [Bradyrhizobium japonicum USDA 110]
 gi|27350765|dbj|BAC47774.1| adenine DNA methyltransferase [Bradyrhizobium japonicum USDA 110]
          Length = 376

 Score =  462 bits (1189), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 214/348 (61%), Positives = 267/348 (76%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           +II G+ ++ + KL A SVDL+FADPPYNLQL G L RPD S VDAV D WDKF SF AY
Sbjct: 23  RIILGDCVAEMSKLQAGSVDLVFADPPYNLQLKGDLKRPDESHVDAVNDDWDKFDSFSAY 82

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFR 141
           D FTRAWLLA RR +KP+ T+WVIGSYHNIFR+G ++Q+L FW+LNDIVWRK+NPMPNFR
Sbjct: 83  DDFTRAWLLAARRAMKPSATIWVIGSYHNIFRVGAIMQDLGFWLLNDIVWRKTNPMPNFR 142

Query: 142 GRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGE 201
           GRRF NAHET+IWA+   KAKGYTFNY+ALKAANEDVQ RSDWLIP+C+G ERL+  DG+
Sbjct: 143 GRRFTNAHETMIWAARDEKAKGYTFNYEALKAANEDVQARSDWLIPLCTGEERLKGADGK 202

Query: 202 KLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIA 261
           K+HPTQKPE LL+R+L+SS+KPGD+++DPF G+GT+GAVAK+L RS+IG E  + Y   A
Sbjct: 203 KVHPTQKPEGLLARVLLSSSKPGDLVIDPFNGTGTTGAVAKRLGRSYIGFERDKTYAKAA 262

Query: 262 TKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGT 321
             RIA+V+PL    L      R  PRVAF+ L+ERG+I PG  L +A+  + A V ADG 
Sbjct: 263 EARIAAVEPLPEASLAPFMTAREAPRVAFSELIERGMIMPGTKLFDAKKKLGALVRADGA 322

Query: 322 LISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVR 369
           ++ G ++GSIHR+GA   G++ CNGW FW+ E    L  I+ LR  +R
Sbjct: 323 IMFGDKVGSIHRIGAVAQGAQACNGWTFWHVETKKGLKLIDELRAEIR 370


>gi|254512453|ref|ZP_05124520.1| modification methylase SmeIP [Rhodobacteraceae bacterium KLH11]
 gi|221536164|gb|EEE39152.1| modification methylase SmeIP [Rhodobacteraceae bacterium KLH11]
          Length = 367

 Score =  462 bits (1188), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 214/352 (60%), Positives = 266/352 (75%), Gaps = 1/352 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           I+ G+ I  +  LP  SVDLIFADPPYNLQL GQL+RPD+S VDAV D WD+FSSF AYD
Sbjct: 17  ILSGDCIEAMNSLPEASVDLIFADPPYNLQLKGQLHRPDNSQVDAVDDHWDQFSSFGAYD 76

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            FTRAWL A  R+LKPNG +WVIGSYHNIFR+G+ LQ+  +WILND+VWRKSNPMPNFRG
Sbjct: 77  QFTRAWLKAAHRLLKPNGAIWVIGSYHNIFRVGSALQDAGYWILNDVVWRKSNPMPNFRG 136

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +RF NAHET+IWAS    AK YTFNY+ALKA NE VQMRSDW++PIC+G ERL++++G+K
Sbjct: 137 KRFTNAHETMIWASKREGAK-YTFNYEALKALNEGVQMRSDWVLPICTGHERLKDENGDK 195

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKPE+LL R+L+ ST PGD++LDPFFG+GT+GAVAK L R FIGIE ++ Y  +A 
Sbjct: 196 AHPTQKPESLLHRVLIGSTNPGDVVLDPFFGTGTTGAVAKMLGREFIGIEREESYRKVAE 255

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           KRIA V+      L V   KR EPRV F  LVERG+++PG+ L +      A V ADGTL
Sbjct: 256 KRIAKVRKFDREALEVSASKRAEPRVPFGQLVERGMLRPGEELYSMNKRHKAKVRADGTL 315

Query: 323 ISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKELYN 374
           +     GSIH+VGA +  + +CNGW +W F++ G+   I+ LR  +R EL+N
Sbjct: 316 VGDNVKGSIHQVGAHLENAPSCNGWTYWCFKREGKTVPIDVLRQQIRAELHN 367


>gi|75676787|ref|YP_319208.1| DNA methylase N-4/N-6 [Nitrobacter winogradskyi Nb-255]
 gi|74421657|gb|ABA05856.1| DNA adenine methylase CcrM [Nitrobacter winogradskyi Nb-255]
          Length = 376

 Score =  461 bits (1187), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 215/351 (61%), Positives = 270/351 (76%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           +II G+ ++ + KL A S DLIFADPPYNLQL G L RPD S VDAV   WDKFSSF AY
Sbjct: 23  RIIIGDCVAGMSKLQAGSADLIFADPPYNLQLKGDLKRPDESHVDAVNSDWDKFSSFSAY 82

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFR 141
           D FTRAWLLACRRV+KP+ T+WVIGSYHNIFR+G ++Q+L FW+LNDIVWRK+NPMPNFR
Sbjct: 83  DEFTRAWLLACRRVMKPSATIWVIGSYHNIFRVGAIMQDLGFWVLNDIVWRKTNPMPNFR 142

Query: 142 GRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGE 201
           GRRF NAHET+IWA+    AKGYTFNY+ALKAANEDVQ RSDWLIP+C+G+ERL+++DG 
Sbjct: 143 GRRFTNAHETMIWAARDENAKGYTFNYEALKAANEDVQARSDWLIPLCTGNERLKDEDGR 202

Query: 202 KLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIA 261
           K+HPTQKPE LL+R+L+SS+KPGD+++DPF G+GT+GAVAK+L R++IG E  + Y   A
Sbjct: 203 KVHPTQKPEGLLARVLLSSSKPGDLVIDPFNGTGTTGAVAKRLGRNYIGFERDRTYAAAA 262

Query: 262 TKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGT 321
            KRIA+V+PL    L      R  PRVAF+ L+ERG+I PG  L +A+    A V ADG 
Sbjct: 263 EKRIAAVEPLPEATLAPFMTAREAPRVAFSELIERGMISPGAKLVDAKKRHGALVRADGA 322

Query: 322 LISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           ++ G ++GSIHR+GA   G+  CNGW FW+ E    L  I+ LR  +R ++
Sbjct: 323 IMLGDKVGSIHRIGAVAQGAGACNGWTFWHIETSKGLKLIDELRAEIRSQM 373


>gi|260425326|ref|ZP_05779306.1| modification methylase CcrMI [Citreicella sp. SE45]
 gi|260423266|gb|EEX16516.1| modification methylase CcrMI [Citreicella sp. SE45]
          Length = 370

 Score =  461 bits (1185), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 211/350 (60%), Positives = 269/350 (76%), Gaps = 2/350 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           I+ G+ I ++  LP +SVDLIFADPPYNLQL G+L+RPD+S VDAV D WD+F+SF AYD
Sbjct: 18  ILDGDCIEMMNSLPEESVDLIFADPPYNLQLKGELHRPDNSRVDAVDDHWDQFASFAAYD 77

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            FTR WL A RRVLKPNG +WVIGSYHNIFR+G  LQ+  +WILND+VWRKSNPMPNFRG
Sbjct: 78  QFTREWLAAARRVLKPNGAIWVIGSYHNIFRVGAALQDAGYWILNDVVWRKSNPMPNFRG 137

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +RF NAHET+IWAS S  AK YTFNY+ALKA NE +QMRSDW++PIC+G ERL++ +G+K
Sbjct: 138 KRFTNAHETMIWASKSDAAK-YTFNYEALKALNEGIQMRSDWVLPICNGGERLKDANGDK 196

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKP +LL R+LV ST PGD++LDPFFG+GT+GAVAK L R +IGIE +  Y ++AT
Sbjct: 197 AHPTQKPMSLLHRVLVGSTNPGDVVLDPFFGTGTTGAVAKMLGRDWIGIEREAAYREVAT 256

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           +RIA ++      L V   KR EPR+ F  LVERG+++PG++L +  G + A V ADGTL
Sbjct: 257 RRIADIRAFDRSALEVTRAKRAEPRIPFGQLVERGMLRPGEMLVSPSGKV-AKVRADGTL 315

Query: 323 ISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           +     GSIH+VGA + G+ +CNGW +W+F K G+   I+ LR  +R E+
Sbjct: 316 VGDDVKGSIHQVGAHLEGAPSCNGWTYWHFRKDGKHVPIDVLRQQIRAEM 365


>gi|154251158|ref|YP_001411982.1| DNA methylase N-4/N-6 domain-containing protein [Parvibaculum
           lavamentivorans DS-1]
 gi|154155108|gb|ABS62325.1| DNA methylase N-4/N-6 domain protein [Parvibaculum lavamentivorans
           DS-1]
          Length = 367

 Score =  460 bits (1184), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 209/350 (59%), Positives = 265/350 (75%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II+G+ I  +  LP KSVDLIFADPPYNLQL G L RPD S VDAV D WDKF+SF+ YD
Sbjct: 15  IIQGDCIEAMNALPEKSVDLIFADPPYNLQLGGGLTRPDQSKVDAVDDDWDKFASFQVYD 74

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            FTR W+ A RRVLK  G +WVIGSYHNIFR+G  LQ+L FW++ND+VWRKSNPMPNFRG
Sbjct: 75  EFTRNWMNAARRVLKDTGAIWVIGSYHNIFRVGATLQDLGFWMMNDVVWRKSNPMPNFRG 134

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
            RF NAHETLIWA+ S   K YTFNYDA+KA N+D+QMRSDWL+PIC+G ERL++ DG+K
Sbjct: 135 TRFTNAHETLIWATKSADQKKYTFNYDAMKALNDDLQMRSDWLLPICTGGERLKDGDGDK 194

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKPEALL R+L+++T  GD +LDPFFG+GT+GAVAKKL R+F+GIE ++ YI +A 
Sbjct: 195 AHPTQKPEALLHRVLLATTNAGDTVLDPFFGTGTTGAVAKKLGRNFVGIEREERYIKVAR 254

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           +RI  ++     +L V T K+ E R+ F  L+ERGL++PG +LT+     +A V ADG++
Sbjct: 255 ERIRLIKTGAPEDLKVTTSKKAEVRIPFGTLIERGLLEPGAVLTDPAKRHAARVRADGSI 314

Query: 323 ISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           +     GSIH++GA V G + CNGW FW+F+  G+L  I+ LR  VR E+
Sbjct: 315 VCRDATGSIHKIGAHVQGLDACNGWTFWHFKTDGKLKPIDILRQKVRAEM 364


>gi|83855283|ref|ZP_00948813.1| modification methylase [Sulfitobacter sp. NAS-14.1]
 gi|83941806|ref|ZP_00954268.1| modification methylase [Sulfitobacter sp. EE-36]
 gi|83843126|gb|EAP82293.1| modification methylase [Sulfitobacter sp. NAS-14.1]
 gi|83847626|gb|EAP85501.1| modification methylase [Sulfitobacter sp. EE-36]
          Length = 366

 Score =  460 bits (1183), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 215/352 (61%), Positives = 264/352 (75%), Gaps = 1/352 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II G+ I  +  LPA+SVDLIFADPPYNLQL G L+RPD+S VDAV D+WD+FSSF  YD
Sbjct: 16  IISGDCIEAMNALPAESVDLIFADPPYNLQLRGDLHRPDNSKVDAVDDAWDQFSSFAVYD 75

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            FTR WL A RR+LKPNG +WVIGSYHNIFR+G  LQ+  FWILND+VWRKSNPMPNFRG
Sbjct: 76  KFTREWLKAARRLLKPNGAIWVIGSYHNIFRVGAALQDAGFWILNDVVWRKSNPMPNFRG 135

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +RF NAHET+IWA     +K YTFNY+ALKA NE +QMRSDW++PIC+G ERL+++ G+K
Sbjct: 136 KRFTNAHETMIWAGKDENSK-YTFNYEALKALNEGIQMRSDWVLPICTGHERLKDEMGDK 194

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKPE+LL RILV ST PGD++LDPFFG+GT+GAVAK L R FIGIE ++ Y  +A 
Sbjct: 195 AHPTQKPESLLHRILVGSTNPGDVVLDPFFGTGTTGAVAKMLGRDFIGIEREEAYRKVAE 254

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           KRI SV+      L   T KR EPRV F  LVERG+++PG+ L +  G  SA V ADGTL
Sbjct: 255 KRIKSVRKFDKEALQTTTSKRAEPRVPFGQLVERGMLRPGEELYSLNGRYSAKVRADGTL 314

Query: 323 ISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKELYN 374
           +     GSIH+VGA    + +CNGW +W ++K G+   I+ LR  +R E+ N
Sbjct: 315 VGNEVKGSIHQVGAAYEKAPSCNGWTYWCYKKDGKRVPIDILRQQIRAEMAN 366


>gi|114764187|ref|ZP_01443425.1| modification methylase [Pelagibaca bermudensis HTCC2601]
 gi|114543339|gb|EAU46355.1| modification methylase [Roseovarius sp. HTCC2601]
          Length = 367

 Score =  460 bits (1183), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 211/350 (60%), Positives = 269/350 (76%), Gaps = 2/350 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           I+ G+ I ++  LPA+SVDLIFADPPYNLQL G L+RPD+S VDAV D WD+F+SFE YD
Sbjct: 15  ILAGDCIEMMNSLPAESVDLIFADPPYNLQLRGDLHRPDNSRVDAVDDHWDQFASFEVYD 74

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            FTR WL A +R+LKPNG +WVIGSYHNIFR+G  LQ+  +WILND++WRKSNPMPNFRG
Sbjct: 75  RFTREWLAAAKRLLKPNGAIWVIGSYHNIFRVGAALQDAGYWILNDVIWRKSNPMPNFRG 134

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +RF NAHET+IWAS    AK YTFNY+ALKA NE +QMRSDW++PIC+G ERL++ +G+K
Sbjct: 135 KRFTNAHETMIWASKGEGAK-YTFNYEALKALNEGIQMRSDWVLPICNGGERLKDANGDK 193

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKP +LL R+LV ST PGD++LDPFFG+GT+GAVAK L R +IGIE +  Y ++A 
Sbjct: 194 AHPTQKPASLLHRVLVGSTNPGDVVLDPFFGTGTTGAVAKMLGRDWIGIEREAAYREVAE 253

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           +RIA V+      L V   KR EPRV F  LVERGL++PG++L +A G + A V ADGTL
Sbjct: 254 RRIADVRAYDRSSLEVTRAKRAEPRVPFGQLVERGLLRPGEMLVSANGKV-AKVRADGTL 312

Query: 323 ISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           +     GSIH+VGA + G+ +CNGW +W+F K G++  I+ LR  +R E+
Sbjct: 313 VGDDVKGSIHQVGAHLEGAPSCNGWTYWHFRKDGKVVPIDVLRQQIRAEM 362


>gi|163745411|ref|ZP_02152771.1| modification methylase [Oceanibulbus indolifex HEL-45]
 gi|161382229|gb|EDQ06638.1| modification methylase [Oceanibulbus indolifex HEL-45]
          Length = 366

 Score =  459 bits (1182), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 216/352 (61%), Positives = 265/352 (75%), Gaps = 1/352 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           I+ G+ I  +  LPA+SVDLIFADPPYNLQL G L+RPD+S VDAV D WD+F+SF+AYD
Sbjct: 16  IVAGDCIEAMNALPAESVDLIFADPPYNLQLRGDLHRPDNSKVDAVDDEWDQFASFKAYD 75

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            FTRAWL A RR+LKP+G +WVIGSYHNIFR+G  LQ+  FWILND+VWRKSNPMPNFRG
Sbjct: 76  DFTRAWLKAARRLLKPDGAIWVIGSYHNIFRVGAALQDQGFWILNDVVWRKSNPMPNFRG 135

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +RF NAHET+IWA  S  +K YTFNY+ALKA NE +QMRSDW++PIC+G ERL++  G+K
Sbjct: 136 KRFTNAHETMIWAGKSENSK-YTFNYEALKALNEGIQMRSDWVLPICTGHERLKDDAGDK 194

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKPE+LL RILV ST PGD+ILDPFFG+GT+GAVAK L R FIGIE +  Y  +A 
Sbjct: 195 AHPTQKPESLLHRILVGSTNPGDVILDPFFGTGTTGAVAKMLGRDFIGIEREAAYRKVAE 254

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           KRI+ V+   N  L   T KR EPRV F  LVERG+++PG+ L +  G   A V ADGTL
Sbjct: 255 KRISMVRKFDNEALQTTTSKRAEPRVPFGQLVERGMLRPGENLYSMNGRHKAKVRADGTL 314

Query: 323 ISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKELYN 374
           I     GSIH+VGA    + +CNGW +W ++K G+   I+ LR  +R E+ N
Sbjct: 315 IGSDVKGSIHQVGAAYEKAPSCNGWTYWCYKKDGKNVPIDILRQQIRAEMAN 366


>gi|85705986|ref|ZP_01037082.1| modification methylase [Roseovarius sp. 217]
 gi|85669574|gb|EAQ24439.1| modification methylase [Roseovarius sp. 217]
          Length = 371

 Score =  459 bits (1182), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 209/350 (59%), Positives = 270/350 (77%), Gaps = 1/350 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II G+ I V+  LP  SVDLIFADPPYNLQL G L+RPD+S VDAV D+WD+F+SF AYD
Sbjct: 18  IIAGDCIEVMNSLPEASVDLIFADPPYNLQLKGDLHRPDNSQVDAVDDAWDQFASFAAYD 77

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            FT  WL A RR+LKP+G +WVIGSYHNIFR+G  LQ+  +WILND++WRKSNPMPNFRG
Sbjct: 78  KFTHDWLKAARRLLKPHGAIWVIGSYHNIFRVGAALQDAGYWILNDVIWRKSNPMPNFRG 137

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +R  NAHET+IWAS S  AK YTFNY+ALK+ N+ VQMRSDW++P+C+G ERL++  G+K
Sbjct: 138 KRLTNAHETMIWASKSEGAK-YTFNYEALKSLNDGVQMRSDWVLPLCTGHERLKDDKGDK 196

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKPE+LL R+LV ST PGD+ILDPFFG+GT+GAVAK L R +IGIE +  Y  +A 
Sbjct: 197 AHPTQKPESLLHRVLVGSTNPGDVILDPFFGTGTTGAVAKMLGRDYIGIEREAAYRVVAE 256

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           KR+AS++      L V T KR EPRV F  L+ERG+++PG++LT+  G  +A V ADGTL
Sbjct: 257 KRLASIRKFDRDALQVSTSKRAEPRVPFGQLIERGMLRPGEMLTSMNGKCAAKVRADGTL 316

Query: 323 ISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           ++ +  GSIH+VGA + G+ +CNGW +W F++ G++  I+ LR  +R E+
Sbjct: 317 VADSIKGSIHQVGAHLEGAPSCNGWTYWCFKREGKVVPIDVLRQQIRSEM 366


>gi|254417828|ref|ZP_05031552.1| DNA methylase domain protein [Brevundimonas sp. BAL3]
 gi|196184005|gb|EDX78981.1| DNA methylase domain protein [Brevundimonas sp. BAL3]
          Length = 369

 Score =  459 bits (1182), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 211/350 (60%), Positives = 262/350 (74%)

Query: 20  KDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFE 79
           KD I +G+ I+VL+ LP  SVD++FADPPYNLQL G L RPD+S VDAV D WDKF SF 
Sbjct: 16  KDVIHRGDCIAVLKSLPDASVDMVFADPPYNLQLGGDLLRPDNSKVDAVDDDWDKFDSFA 75

Query: 80  AYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPN 139
            YD FTRAWL  CRRVLKP G++WVIGSYHN+FR+G  +Q+L FW+LNDI+WRKSNPMPN
Sbjct: 76  EYDTFTRAWLTECRRVLKPEGSIWVIGSYHNVFRLGAAIQDLGFWVLNDIIWRKSNPMPN 135

Query: 140 FRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKD 199
           F+G RF NAHETLIWA+ S + K YTFNYDALKA NED QMRSDW   +C+G ER+++ D
Sbjct: 136 FKGTRFTNAHETLIWAARSREQKRYTFNYDALKAFNEDTQMRSDWTFALCTGEERIKDAD 195

Query: 200 GEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYID 259
           G+K HPTQKPEALL R+L+S+T+PGD++LDPFFG+GT+GA AK+L R +IGIE  + Y +
Sbjct: 196 GKKAHPTQKPEALLHRVLLSATRPGDVVLDPFFGTGTTGAAAKRLGRHYIGIERDETYAE 255

Query: 260 IATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCAD 319
           +A  RIASV P    +L V+  KR EP+V F  LVE GL+ PG  L   +G   A V AD
Sbjct: 256 VAETRIASVIPANPEDLMVMGSKRAEPKVPFGALVEAGLLHPGDRLYCPKGEREARVRAD 315

Query: 320 GTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVR 369
           G+L+SG+  GSIH++GA    +  CNGW +W F+    L SI+ LR  VR
Sbjct: 316 GSLVSGSLTGSIHKLGALFENAPACNGWTYWRFKTDQGLKSIDALRAEVR 365


>gi|144899369|emb|CAM76233.1| DNA methylase N-4/N-6 [Magnetospirillum gryphiswaldense MSR-1]
          Length = 357

 Score =  459 bits (1181), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 215/354 (60%), Positives = 273/354 (77%), Gaps = 3/354 (0%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           D I++G+ I+ +E LPAKSVDL+FADPPYNLQL G+L RP++S VD V D WD+F SF  
Sbjct: 6   DTILQGDCIAQMEALPAKSVDLVFADPPYNLQLGGELLRPNNSRVDGVDDDWDRFDSFRD 65

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YD FTR WL A RRVLK +G LWVIGSYHNIFR+G  LQ+L FW+LNDIVWRKSNPMPNF
Sbjct: 66  YDDFTRRWLAAARRVLKDDGALWVIGSYHNIFRVGASLQDLGFWMLNDIVWRKSNPMPNF 125

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           RG RF NAHETLIW + S +++ YTFNY+A+KA N+D+QMRSDW IP+C+GSERL+N DG
Sbjct: 126 RGTRFTNAHETLIWCAKSAESR-YTFNYEAMKALNDDLQMRSDWTIPLCTGSERLKN-DG 183

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
            K+HPTQKPE LL R+L+++TKPGD++LDPFFG+GT+GAVAKKL+R FIG E   DYI  
Sbjct: 184 TKVHPTQKPEMLLYRVLMATTKPGDVVLDPFFGTGTTGAVAKKLKRHFIGCERDPDYIKA 243

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILT-NAQGNISATVCAD 319
           A +RI+ V+P+  + L     K++EPRV F  +VERGL++ G +L  N + +++A V AD
Sbjct: 244 AQERISKVRPVSELSLLSTPSKKSEPRVPFGTVVERGLLEVGTVLYGNGKDSLTAKVRAD 303

Query: 320 GTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKELY 373
           GTLIS    GSIH+VGA V  +  CNGW FW+ ++  EL  I+ LR  +R EL+
Sbjct: 304 GTLISADHRGSIHKVGALVQNAPACNGWTFWHLKQGDELVPIDVLRQKIRAELH 357


>gi|86136900|ref|ZP_01055478.1| modification methylase [Roseobacter sp. MED193]
 gi|85826224|gb|EAQ46421.1| modification methylase [Roseobacter sp. MED193]
          Length = 389

 Score =  459 bits (1181), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 215/352 (61%), Positives = 262/352 (74%), Gaps = 1/352 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II G+ I V+  LP   +DLIFADPPYNLQL  QL+RPD+S VDAV D WD+FSSF AYD
Sbjct: 39  IIDGDCIDVMAGLPDNCIDLIFADPPYNLQLKNQLHRPDNSKVDAVDDHWDQFSSFAAYD 98

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            FT  WL   RR+LKPNG +WVIGSYHNIFR+GT +Q+  FWILND+VWRKSNPMPNFRG
Sbjct: 99  DFTSRWLHQARRILKPNGAIWVIGSYHNIFRVGTAMQDEGFWILNDVVWRKSNPMPNFRG 158

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +R+ NAHET+IWAS S   K YTFNY+ALKA NE +QMRSDW++PIC+G ERL+N+DGEK
Sbjct: 159 KRYTNAHETMIWASKSEGGK-YTFNYEALKALNEGIQMRSDWVLPICTGHERLKNEDGEK 217

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKPE+LL RILV ST PGD++LDPFFG+GT+GAVAK L R FIGIE ++ Y  +A 
Sbjct: 218 AHPTQKPESLLHRILVGSTNPGDVVLDPFFGTGTTGAVAKMLGREFIGIEQEESYRKVAA 277

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           +RI SV+      L V T KR EPRV F  LVERG+++PG  L +      A V ADGTL
Sbjct: 278 ERIKSVRKFDREALQVSTSKRAEPRVPFGQLVERGMLRPGDELYSMNQRHKAKVRADGTL 337

Query: 323 ISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKELYN 374
           I     GSIH+VGA +  + +CNGW +W F++ G+   I+ LR  +R E+ N
Sbjct: 338 IGDNVKGSIHQVGAHLENAPSCNGWTYWCFKRDGQTVPIDVLRQQIRAEMQN 389


>gi|126728137|ref|ZP_01743953.1| modification methylase [Sagittula stellata E-37]
 gi|126711102|gb|EBA10152.1| modification methylase [Sagittula stellata E-37]
          Length = 365

 Score =  459 bits (1180), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 209/352 (59%), Positives = 273/352 (77%), Gaps = 2/352 (0%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           ++I+ G+ I V+  LP  SVDLIFADPPYNLQL G+L+RPD+S VDAV D WD+FS+F A
Sbjct: 16  NQILDGDCIQVMNSLPEASVDLIFADPPYNLQLKGELHRPDNSRVDAVDDHWDQFSNFAA 75

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YDAFT+ WL A RR+LKP+G +WVIGSYHNIFR+G  LQ+  FWILND++WRK+NPMPNF
Sbjct: 76  YDAFTQDWLRAARRLLKPDGAIWVIGSYHNIFRVGAALQDAGFWILNDVIWRKANPMPNF 135

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           RG+RF NAHET+IWAS S  AK YTFNY+ALK+ NE +QMRSDW++PIC+G ERL++ +G
Sbjct: 136 RGKRFTNAHETMIWASKSEGAK-YTFNYEALKSLNEGIQMRSDWVLPICNGGERLKDANG 194

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
           +K HPTQKP++LL R++V ST PGD++LDPFFG+GT+GAVAK L R +IGIE +  Y ++
Sbjct: 195 DKAHPTQKPQSLLHRVIVGSTNPGDVVLDPFFGTGTTGAVAKMLGRDWIGIEREAAYREV 254

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADG 320
           A KR+  V+      L V T KR EPRV F  LVERG+++PG++L N +G + A V ADG
Sbjct: 255 ALKRLGDVRAFDKGALEVSTSKRAEPRVPFGQLVERGMLRPGEMLINGRGQM-AKVRADG 313

Query: 321 TLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           TL+     GSIH+VGAK+ G+ +CNGW +W+F + G+   I+ LR  +R E+
Sbjct: 314 TLVGDGVTGSIHQVGAKLEGAPSCNGWTYWHFRRDGKTVPIDVLRQQIRSEM 365


>gi|326387696|ref|ZP_08209302.1| DNA methylase N-4/N-6 [Novosphingobium nitrogenifigens DSM 19370]
 gi|326207742|gb|EGD58553.1| DNA methylase N-4/N-6 [Novosphingobium nitrogenifigens DSM 19370]
          Length = 388

 Score =  459 bits (1180), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 204/347 (58%), Positives = 270/347 (77%), Gaps = 1/347 (0%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           ++I++G+ I  +  LP  S+D+IFADPPYNLQL G L RPD S VDAVT+ WDKF SF A
Sbjct: 36  NQILRGDCIEQMRALPTASIDMIFADPPYNLQLGGDLARPDGSHVDAVTNDWDKFDSFAA 95

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YDAFTR WL   RR+LKP+G++WVIGSYHNIFR+G +LQ++ FWILNDIVWRK+NPMPNF
Sbjct: 96  YDAFTREWLAEARRLLKPDGSIWVIGSYHNIFRVGAILQDMGFWILNDIVWRKANPMPNF 155

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           +G RF NAHETLIWAS S K+K YTFNY A+K  N+++QMRSDW++PICSG ERLRNK G
Sbjct: 156 KGTRFTNAHETLIWASRSEKSK-YTFNYRAMKTLNDELQMRSDWVLPICSGQERLRNKRG 214

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
            K HPTQKPE+LL R+++++T PGD++LDPFFG+GT+GAVAK+L R +IG E ++ YI++
Sbjct: 215 AKAHPTQKPESLLYRVMLATTNPGDVVLDPFFGTGTTGAVAKRLGRHWIGCEREEGYIEV 274

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADG 320
           A +RI    PL    L  +  ++++PRVAF  LVE G I+PG +L++ +G    TV ADG
Sbjct: 275 AEERIEMALPLDETALKTMQSRKSQPRVAFGQLVESGWIRPGAVLSDRKGRYCVTVRADG 334

Query: 321 TLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRIL 367
           ++++G + GSIH +GAK+ G+ +CNGW FW+ E  G++  I+ LR L
Sbjct: 335 SIMAGDDSGSIHGIGAKLQGAPSCNGWTFWHIEHEGQVKQIDALRQL 381


>gi|254465616|ref|ZP_05079027.1| modification methylase SmeIP [Rhodobacterales bacterium Y4I]
 gi|206686524|gb|EDZ47006.1| modification methylase SmeIP [Rhodobacterales bacterium Y4I]
          Length = 367

 Score =  458 bits (1179), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 213/352 (60%), Positives = 267/352 (75%), Gaps = 1/352 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II G+ I  +  LPA SVDLIFADPPYNLQL GQL+RPD+S VDAV D WD+FSSF AYD
Sbjct: 17  IIGGDCIEAMNSLPANSVDLIFADPPYNLQLKGQLHRPDNSKVDAVDDHWDQFSSFAAYD 76

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            FTR WL A RRVLKPNG++WVIGSYHNIFR+G +LQ+  +W+LND++WRKSNPMPNFRG
Sbjct: 77  QFTREWLKAARRVLKPNGSIWVIGSYHNIFRVGALLQDEGYWVLNDVIWRKSNPMPNFRG 136

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +RF NAHET+IWAS S  AK YTFNY+ALKA NE +QMRSDW++PIC+G ER+++++G+K
Sbjct: 137 KRFTNAHETMIWASKSEGAK-YTFNYEALKALNEGIQMRSDWVLPICTGHERIKDENGDK 195

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKPE+LL RILV +T PGD++LDPFFG+GT+GAVAK L R FIGIE ++ Y  +A 
Sbjct: 196 AHPTQKPESLLHRILVGATNPGDVVLDPFFGTGTTGAVAKMLGREFIGIEREEAYRKVAE 255

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           KRI +V+      L V   KR  PRV F  LVERG+++PG+ L +      A V ADGTL
Sbjct: 256 KRIKAVRKFDREALEVSASKRAAPRVPFGQLVERGMLRPGEELYSMNRRHKAKVRADGTL 315

Query: 323 ISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKELYN 374
           I     GSIH+VGA +  + +CNGW +W F++ G+   I+ LR  +R E+ N
Sbjct: 316 IGDNIKGSIHQVGAHLENAPSCNGWTYWCFKRDGKTVPIDVLRQQIRAEMQN 367


>gi|167648322|ref|YP_001685985.1| DNA methylase N-4/N-6 domain-containing protein [Caulobacter sp.
           K31]
 gi|167350752|gb|ABZ73487.1| DNA methylase N-4/N-6 domain protein [Caulobacter sp. K31]
          Length = 358

 Score =  458 bits (1179), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 214/352 (60%), Positives = 263/352 (74%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           + II+G+ I  +  LP KSVDLIFADPPYNLQL G L RPD+S VDAV D WD+F SF A
Sbjct: 6   ETIIQGDCIEAMNALPEKSVDLIFADPPYNLQLGGDLLRPDNSKVDAVDDHWDQFESFAA 65

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YD FTR WL A RRVLK +G +WVIGSYHNIFR+G  +Q+L FWILND++WRKSNPMPNF
Sbjct: 66  YDKFTREWLKAARRVLKDDGAIWVIGSYHNIFRVGVAVQDLGFWILNDVIWRKSNPMPNF 125

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           +G RF NAHETLIWAS S  AK YTFNYDALK AN++VQMRSDW +P+C+G ER++  DG
Sbjct: 126 KGTRFANAHETLIWASKSQGAKRYTFNYDALKMANDEVQMRSDWTLPLCTGEERIKGADG 185

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
            K HPTQKPEALL R+++S+TKPGD+ILDPFFG GT+GA AK+L R F+GIE + DYI+ 
Sbjct: 186 NKAHPTQKPEALLYRVILSTTKPGDVILDPFFGVGTTGAAAKRLGRRFVGIERESDYIEH 245

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADG 320
           A  RIA V P+   +L V+  KR+EPRV F  +VE GL+ PG  L  A+G+ +A V ADG
Sbjct: 246 AKARIAKVVPIAPGDLDVMGSKRSEPRVPFGNIVEAGLLNPGDTLYCAKGSHAAKVRADG 305

Query: 321 TLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           ++  G   GSIH+VGA V  +  CNGW +W+F+    L  I+ LR  VR  +
Sbjct: 306 SITVGDLSGSIHKVGALVQSAPACNGWTYWHFKTDKGLAPIDVLRSQVRAGM 357


>gi|84515025|ref|ZP_01002388.1| modification methylase [Loktanella vestfoldensis SKA53]
 gi|84511184|gb|EAQ07638.1| modification methylase [Loktanella vestfoldensis SKA53]
          Length = 385

 Score =  458 bits (1179), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 213/350 (60%), Positives = 268/350 (76%), Gaps = 1/350 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II G+ I+V+  LPA SVDLIFADPPYNLQL G L+RP++S VDAV D+WD+F SF AYD
Sbjct: 34  IIDGDCIAVMNSLPAGSVDLIFADPPYNLQLKGDLHRPNNSKVDAVDDAWDQFDSFAAYD 93

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            FT+AWL A RR+LKPNG +WVIGSYHN+FR+G  LQN  FWILND+VWRKSNPMPNFRG
Sbjct: 94  RFTKAWLAAARRLLKPNGAIWVIGSYHNVFRMGAELQNQGFWILNDVVWRKSNPMPNFRG 153

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +R  NAHETLIWAS    +K YTFNY+ALK+ NE VQMRSDW++PIC+G ERL++  G+K
Sbjct: 154 KRLTNAHETLIWASKEEASK-YTFNYEALKSLNEGVQMRSDWVLPICTGHERLKDDQGDK 212

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKP++LL R++V +T PGD+ILDPFFG+GT+GAVAK L R FIGIE +  Y  +A 
Sbjct: 213 AHPTQKPQSLLHRVIVGTTNPGDVILDPFFGTGTTGAVAKMLGRDFIGIEREAAYRKVAE 272

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           KRIA+ +      L V + KR+EPRVAF +LVERG+++PG+ L +  G   A V ADGTL
Sbjct: 273 KRIANTRKFDTEALEVSSSKRSEPRVAFGVLVERGMLRPGEELWSMNGRHKAKVRADGTL 332

Query: 323 ISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           I     GSIH+VGA + G+ +CNGW +W F++ G+   I+ LR  +R E+
Sbjct: 333 IGDDIKGSIHQVGAHLEGAPSCNGWTYWQFKRDGQKVPIDLLRQQIRSEM 382


>gi|99082489|ref|YP_614643.1| DNA methylase N-4/N-6 [Ruegeria sp. TM1040]
 gi|99038769|gb|ABF65381.1| DNA methylase N-4/N-6 [Ruegeria sp. TM1040]
          Length = 389

 Score =  458 bits (1179), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 214/350 (61%), Positives = 264/350 (75%), Gaps = 1/350 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           I+ G+ I  +  LP+ S+D+IFADPPYNLQL GQL+RPD+S VDAV D WD+FSSF  YD
Sbjct: 39  ILDGDCIERMASLPSNSIDMIFADPPYNLQLKGQLHRPDNSKVDAVDDEWDQFSSFGVYD 98

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            FTRAWL   RR+LKPNG LWVIGSYHNIFR+GT LQ+  FWILND+VWRKSNPMPNFRG
Sbjct: 99  QFTRAWLKEARRILKPNGALWVIGSYHNIFRVGTALQDEGFWILNDVVWRKSNPMPNFRG 158

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +R+ NAHET+IWAS S  AK YTFNY+ALKA NE +QMRSDW++PIC+G ERL++ +G+K
Sbjct: 159 KRYTNAHETMIWASKSEGAK-YTFNYEALKALNEGIQMRSDWVMPICTGHERLKDANGDK 217

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKPEALL RILV ST PGD++LDPFFG+GT+GAVAK L R FIGIE ++ Y  +A 
Sbjct: 218 AHPTQKPEALLHRILVGSTNPGDVVLDPFFGTGTTGAVAKMLGREFIGIEREEAYRKVAE 277

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           +RI +V+      L V   KR EPRV F  LVERG+++PG+ L +      A V ADGTL
Sbjct: 278 ERIKNVRKFDREALQVSASKRAEPRVPFGQLVERGMLRPGEELYSMNRRHKAKVRADGTL 337

Query: 323 ISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           I     GSIH+VGA +  + +CNGW +W F+K G+   I+ LR  +R E+
Sbjct: 338 IGDNIKGSIHQVGAHLENAPSCNGWTYWCFKKDGKTVPIDVLRQQIRAEM 387


>gi|110677702|ref|YP_680709.1| modification methylase [Roseobacter denitrificans OCh 114]
 gi|109453818|gb|ABG30023.1| modification methylase [Roseobacter denitrificans OCh 114]
          Length = 364

 Score =  457 bits (1177), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 214/350 (61%), Positives = 267/350 (76%), Gaps = 2/350 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II G+ I V+  LP  SVDLIFADPPYNLQL G L+RPD+S VDAV D WD+FSSF+AYD
Sbjct: 15  IIDGDCIEVMNGLPEASVDLIFADPPYNLQLKGDLHRPDNSRVDAVDDEWDQFSSFKAYD 74

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            FT+AWL A RR+LKP+G +WVIGSYHNIFR+G  LQN  +WILND+VWRKSNPMPNFRG
Sbjct: 75  NFTKAWLKAARRILKPDGAIWVIGSYHNIFRVGAELQNQGYWILNDVVWRKSNPMPNFRG 134

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +RF NAHET+IWA     +K YTFNY+ALKA NE +QMRSDW++PIC+G ERL++++G+K
Sbjct: 135 KRFTNAHETMIWAGRDESSK-YTFNYEALKALNEGIQMRSDWVLPICTGHERLKDENGDK 193

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKPE+LL R+LV +T PGD+ILDPFFG+GT+GAVAK L R FIGIE +  Y  +A 
Sbjct: 194 AHPTQKPESLLHRVLVGATNPGDVILDPFFGTGTTGAVAKMLGRDFIGIEREAAYRKVAE 253

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           KRIA V+      L V   KR EPRV F  LVERG+++PG+ L + +G + A V ADGTL
Sbjct: 254 KRIAKVRKFDREALQVSVSKRAEPRVPFGQLVERGMLRPGEALYSPRGQV-AKVRADGTL 312

Query: 323 ISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           I     GSIH+VGA + G+ +CNGW +W F++ G+   I+ LR  +R E+
Sbjct: 313 IGNDVKGSIHQVGAHLEGAPSCNGWTYWTFKQDGKKIPIDVLRQQIRSEM 362


>gi|163733085|ref|ZP_02140529.1| modification methylase [Roseobacter litoralis Och 149]
 gi|161393620|gb|EDQ17945.1| modification methylase [Roseobacter litoralis Och 149]
          Length = 366

 Score =  457 bits (1177), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 213/352 (60%), Positives = 267/352 (75%), Gaps = 2/352 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II G+ I V+  LP  SVDLIFADPPYNLQL G L+RPD+S VDAV D WD+F+SF+ YD
Sbjct: 17  IIDGDCIEVMNGLPEASVDLIFADPPYNLQLKGDLHRPDNSRVDAVDDEWDQFASFKVYD 76

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            FT+AWL A RR+LKP+G +WVIGSYHNIFR+G  LQN  +WILND+VWRKSNPMPNFRG
Sbjct: 77  DFTKAWLKAARRILKPDGAIWVIGSYHNIFRVGAELQNQGYWILNDVVWRKSNPMPNFRG 136

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +RF NAHET+IWA     +K YTFNY+ALKA NE +QMRSDW++PIC+G ERL++++G+K
Sbjct: 137 KRFTNAHETMIWAGRDESSK-YTFNYEALKALNEGIQMRSDWVLPICTGHERLKDENGDK 195

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKPE+LL R+LV +T PGD+ILDPFFG+GT+GAVAK L R FIGIE +  Y  +A 
Sbjct: 196 AHPTQKPESLLHRVLVGATNPGDVILDPFFGTGTTGAVAKMLGRDFIGIEREAAYRKVAE 255

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           KRIA V+      L V   KR EPRV F  LVERG+++PG+ L + +G + A V ADGTL
Sbjct: 256 KRIAKVRKFDREALQVSVSKRAEPRVPFGQLVERGMLRPGEALYSPRGQV-AKVRADGTL 314

Query: 323 ISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKELYN 374
           I     GSIH+VGA + G+ +CNGW +W F++ G+   I+ LR  +R E+ N
Sbjct: 315 IGNDVKGSIHQVGAHLEGAPSCNGWTYWTFKQDGKKVPIDVLRQQIRSEMTN 366


>gi|259417500|ref|ZP_05741419.1| modification methylase CcrMI [Silicibacter sp. TrichCH4B]
 gi|259346406|gb|EEW58220.1| modification methylase CcrMI [Silicibacter sp. TrichCH4B]
          Length = 385

 Score =  457 bits (1176), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 213/350 (60%), Positives = 264/350 (75%), Gaps = 1/350 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           I+ G+ I  +  LP+ S+D+IFADPPYNLQL GQL+RPD+S VDAV D WD+FSSF  YD
Sbjct: 35  ILDGDCIERMASLPSNSIDMIFADPPYNLQLKGQLHRPDNSRVDAVDDEWDQFSSFGVYD 94

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            FTRAWL   RR+LKPNG LWVIGSYHNIFR+G+ LQ+  FWILND+VWRKSNPMPNFRG
Sbjct: 95  QFTRAWLKEARRILKPNGALWVIGSYHNIFRVGSALQDEGFWILNDVVWRKSNPMPNFRG 154

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +R+ NAHET+IWAS S  AK YTFNY+ALKA NE +QMRSDW++PIC+G ERL++ +G+K
Sbjct: 155 KRYTNAHETMIWASKSEGAK-YTFNYEALKALNEGIQMRSDWVMPICTGHERLKDANGDK 213

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKPEALL RILV ST PGD++LDPFFG+GT+GAVAK L R FIGIE ++ Y  +A 
Sbjct: 214 AHPTQKPEALLHRILVGSTNPGDVVLDPFFGTGTTGAVAKMLGREFIGIEREESYRKVAE 273

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           +RI +V+      L V   KR EPRV F  LVERG+++PG+ L +      A V ADGTL
Sbjct: 274 ERIKNVRKFDREALQVSASKRAEPRVPFGQLVERGMLRPGEELYSMNRRHKAKVRADGTL 333

Query: 323 ISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           I     GSIH+VGA +  + +CNGW +W F+K G+   I+ LR  +R E+
Sbjct: 334 IGDNIKGSIHQVGAHLENAPSCNGWTYWCFKKDGKTVPIDVLRQQIRAEM 383


>gi|307941627|ref|ZP_07656982.1| modification methylase SmeI [Roseibium sp. TrichSKD4]
 gi|307775235|gb|EFO34441.1| modification methylase SmeI [Roseibium sp. TrichSKD4]
          Length = 372

 Score =  456 bits (1174), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 211/363 (58%), Positives = 275/363 (75%), Gaps = 1/363 (0%)

Query: 10  NENQNSIFEWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVT 69
           ++  N    W + I +G+ +S LE+LP+KSVDL+FADPPYNLQL G L RPD S VDA  
Sbjct: 9   SQGSNPEPSWLNTIHRGDCVSALERLPSKSVDLVFADPPYNLQLGGDLMRPDDSKVDACD 68

Query: 70  DSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDI 129
           D WD+F+SFEAYDAFTRAWLLA RRV+KP+G+L+VIGSYHNIFR+G +LQ+L FWI+NDI
Sbjct: 69  DHWDQFASFEAYDAFTRAWLLAVRRVMKPDGSLYVIGSYHNIFRVGAILQDLGFWIMNDI 128

Query: 130 VWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPIC 189
           +W KSNPMPNFRG+RF NAHET+IWA+ S  AK  TFNYDALK  N+D+QMRSDW +P+C
Sbjct: 129 IWLKSNPMPNFRGKRFTNAHETIIWATKSKDAKP-TFNYDALKTFNDDLQMRSDWQLPLC 187

Query: 190 SGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFI 249
           +G ERL+++ G+K+HPTQKPEALL R+L +S+ PGD++LDPFFG+GT+GAVAKKL R+++
Sbjct: 188 TGGERLKDEAGQKVHPTQKPEALLYRVLTASSTPGDVVLDPFFGTGTTGAVAKKLGRNYV 247

Query: 250 GIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQ 309
           G+E ++DYI  A  R+A++ P     L +  GKR E R+ F  L+E GL++PG  L+ A+
Sbjct: 248 GVEREEDYIRHAEARLAAITPGDAETLEMQKGKRAEKRIPFGSLLETGLMKPGTELSCAK 307

Query: 310 GNISATVCADGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVR 369
           G   A V ADG+L  G   GSIH+VGA V G ++CNGW FW+         I++LR  +R
Sbjct: 308 GQHLAVVRADGSLKCGNHTGSIHKVGALVQGQQSCNGWTFWHVGSGKTRTPIDSLRQDLR 367

Query: 370 KEL 372
             L
Sbjct: 368 SRL 370


>gi|159042580|ref|YP_001531374.1| adenine-specific methyltransferase [Dinoroseobacter shibae DFL 12]
 gi|157910340|gb|ABV91773.1| adenine-specific methyltransferase [Dinoroseobacter shibae DFL 12]
          Length = 368

 Score =  456 bits (1173), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 208/352 (59%), Positives = 272/352 (77%), Gaps = 2/352 (0%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           ++I+ G+ I V+  LP  SVDLIFADPPYNLQL G L+RPD+S VDAV D+WD+F+SF++
Sbjct: 16  NEILAGDCIEVMNSLPEASVDLIFADPPYNLQLKGDLHRPDNSKVDAVDDAWDRFASFDS 75

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YD F+  WL A RR+LKPNG +WVIGSYHNIFR+G  LQN  +WILND+VWRKSNPMPNF
Sbjct: 76  YDRFSADWLAAARRLLKPNGAIWVIGSYHNIFRVGAALQNTGYWILNDVVWRKSNPMPNF 135

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           RG+R  NAHETLIWAS S  AK YTFNY+ALK  NE +QMRSDW++PIC+G ERL+++ G
Sbjct: 136 RGKRLTNAHETLIWASKSEGAK-YTFNYEALKQLNEGIQMRSDWVLPICTGHERLKDEAG 194

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
           +K HPTQKPE+LL R++V++T PGD++LDPFFG+GT+GAVAKKL R FIGIE ++ Y  +
Sbjct: 195 DKAHPTQKPESLLHRVIVATTNPGDVVLDPFFGTGTTGAVAKKLGRDFIGIEREEAYRKV 254

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADG 320
           A  R+A V+      L V   KR+EPRV F  LVERG+++PG++LT+  G + A V ADG
Sbjct: 255 AEARLADVRKYDRESLAVTQSKRSEPRVPFGQLVERGMLRPGEVLTSPGGKV-AKVRADG 313

Query: 321 TLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           TL++    GSIH+VGA +  + +CNGW +W+F++ G+   I+ LR  +R E+
Sbjct: 314 TLVADQVAGSIHQVGAALEHAPSCNGWTYWHFKRDGKSVPIDLLRQQIRAEM 365


>gi|148253825|ref|YP_001238410.1| DNA adenine methylase CcrM [Bradyrhizobium sp. BTAi1]
 gi|146405998|gb|ABQ34504.1| DNA adenine methylase CcrM [Bradyrhizobium sp. BTAi1]
          Length = 344

 Score =  456 bits (1173), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 212/341 (62%), Positives = 264/341 (77%)

Query: 32  LEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLA 91
           + KLP  SVDL+FADPPYNLQL G+L RPD S VDAV D WDKFSSF AYD FTRAWLLA
Sbjct: 1   MSKLPGASVDLVFADPPYNLQLKGELKRPDESQVDAVDDDWDKFSSFAAYDDFTRAWLLA 60

Query: 92  CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHET 151
            RR++KP+ T+WVIGSYHNIFR+G ++Q+L FWILNDIVWRKSNPMPNFRGRRF NAHET
Sbjct: 61  ARRLMKPSATIWVIGSYHNIFRVGAIMQDLGFWILNDIVWRKSNPMPNFRGRRFTNAHET 120

Query: 152 LIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPEA 211
           +IWA+   KAKGYTFNY+ALKA+NEDVQ RSDWLIP+C+G ERL++ DG+K+HPTQKPE 
Sbjct: 121 MIWAARDEKAKGYTFNYEALKASNEDVQARSDWLIPLCTGEERLKDADGKKVHPTQKPEG 180

Query: 212 LLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPL 271
           LL+R+L+SS+KPGD+++DPF G+GT+GAVAK+L R +IG E  + Y + A +RIA+V+PL
Sbjct: 181 LLARVLLSSSKPGDLVIDPFNGTGTTGAVAKRLGRRYIGFERDKTYAEAAERRIAAVEPL 240

Query: 272 GNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTLISGTELGSI 331
               L      R  PRVAF+ L+ERG+I PG  L +++    A V ADG ++ G ++GSI
Sbjct: 241 PEATLVPFMTAREAPRVAFSELIERGMISPGTKLVDSKRRHGALVRADGAIMLGDKVGSI 300

Query: 332 HRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           HR+GA   G   CNGW FW+ E    L  I+ LR  +R E+
Sbjct: 301 HRIGAVAQGLPACNGWTFWHVETTRGLKLIDELRAEIRAEM 341


>gi|146339056|ref|YP_001204104.1| adenine DNA methyltransferase [Bradyrhizobium sp. ORS278]
 gi|146191862|emb|CAL75867.1| adenine DNA methyltransferase [Bradyrhizobium sp. ORS278]
          Length = 344

 Score =  456 bits (1172), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 213/341 (62%), Positives = 264/341 (77%)

Query: 32  LEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLA 91
           + KLP  SVDL+FADPPYNLQL G+L RPD S VDAV D WDKFSSF AYD FTRAWLLA
Sbjct: 1   MSKLPGASVDLVFADPPYNLQLKGELKRPDESQVDAVDDDWDKFSSFTAYDDFTRAWLLA 60

Query: 92  CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHET 151
            RRV+KP+ T+WVIGSYHNIFR+G ++Q+L FWILNDIVWRKSNPMPNFRGRRF NAHET
Sbjct: 61  ARRVMKPSATIWVIGSYHNIFRVGAIMQDLGFWILNDIVWRKSNPMPNFRGRRFTNAHET 120

Query: 152 LIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPEA 211
           +IWA+   KAKGYTFNY+ALKA+NEDVQ RSDWLIP+C+G ERL++ DG+K+HPTQKPE 
Sbjct: 121 MIWAARDEKAKGYTFNYEALKASNEDVQARSDWLIPLCTGEERLKDGDGKKVHPTQKPEG 180

Query: 212 LLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPL 271
           LL+R+L+SS+K GD+++DPF G+GT+GAVAK+L R +IG E  + Y + A +RIA+V+PL
Sbjct: 181 LLARVLLSSSKQGDLVIDPFNGTGTTGAVAKRLGRRYIGFERDKAYAEAAERRIAAVEPL 240

Query: 272 GNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTLISGTELGSI 331
               L      R  PRVAF+ L+ERG+I PG  L +++    A V ADG ++ G ++GSI
Sbjct: 241 PAETLAPFMTAREAPRVAFSELIERGMIAPGAKLVDSKRRYGALVRADGAIMLGDKVGSI 300

Query: 332 HRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           HR+GA   G   CNGW FW+ E  G L  I+ LR  +R E+
Sbjct: 301 HRIGAVAQGLPACNGWTFWHVETKGGLRLIDELRAEIRSEM 341


>gi|163739876|ref|ZP_02147283.1| DNA methylase N-4/N-6 [Phaeobacter gallaeciensis BS107]
 gi|163743379|ref|ZP_02150759.1| modification methylase [Phaeobacter gallaeciensis 2.10]
 gi|161383373|gb|EDQ07762.1| modification methylase [Phaeobacter gallaeciensis 2.10]
 gi|161386910|gb|EDQ11272.1| DNA methylase N-4/N-6 [Phaeobacter gallaeciensis BS107]
          Length = 367

 Score =  456 bits (1172), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 216/352 (61%), Positives = 263/352 (74%), Gaps = 1/352 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           I+ G+ I V+  LP+ SVDLIFADPPYNLQL GQL+RPD+S VDAV D WD+FSSF  YD
Sbjct: 17  ILDGDCIEVMSGLPSNSVDLIFADPPYNLQLKGQLHRPDNSKVDAVDDHWDQFSSFGVYD 76

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            FTR WL   RR+LKPNG++WVIGSYHNIFR+GT +Q+  FWILND++WRKSNPMPNFRG
Sbjct: 77  KFTRDWLKQARRILKPNGSIWVIGSYHNIFRVGTAVQDEGFWILNDVIWRKSNPMPNFRG 136

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +R+ NAHET+IWAS S  AK YTFNY+ALKA NE +QMRSDW++PIC+G ERL++  G K
Sbjct: 137 KRYTNAHETMIWASKSEGAK-YTFNYEALKALNEGLQMRSDWVMPICTGHERLKDDAGNK 195

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKPEALL RILV ST PGD++LDPFFG+GT+GAVAK L R FIGIE +  Y ++A 
Sbjct: 196 AHPTQKPEALLHRILVGSTNPGDVVLDPFFGTGTTGAVAKMLGREFIGIEREAAYREVAE 255

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           KRI SV+      L V   KR EPRV F  LVERG+++PG  L +      A V ADGTL
Sbjct: 256 KRIKSVRKFDREALQVSASKRAEPRVPFGQLVERGMLRPGDELYSMNRRHKAKVRADGTL 315

Query: 323 ISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKELYN 374
           I     GSIH+VGA +  + +CNGW +W F++ G+   I+ LR  +R EL N
Sbjct: 316 IGDNIKGSIHQVGAHLENAPSCNGWTYWCFKRDGKTVPIDVLRQQIRAELQN 367


>gi|83945340|ref|ZP_00957688.1| modification methylase [Oceanicaulis alexandrii HTCC2633]
 gi|83851174|gb|EAP89031.1| modification methylase [Oceanicaulis alexandrii HTCC2633]
          Length = 364

 Score =  455 bits (1171), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 210/352 (59%), Positives = 265/352 (75%), Gaps = 1/352 (0%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           D I++G+   V++ LP +SVDLIFADPPYNLQL G L+RPD+S VDAV + WD+   F+A
Sbjct: 12  DVILEGDCAEVMKTLPDESVDLIFADPPYNLQLGGDLHRPDNSKVDAVDNDWDQIGDFDA 71

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YD F+ AWL   RRVLKPNG LW IGSYHNIFR+G  LQ++ FWILND++WRKSNPMPNF
Sbjct: 72  YDLFSCAWLEEARRVLKPNGALWTIGSYHNIFRVGAFLQDMGFWILNDVIWRKSNPMPNF 131

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           +G RF NAHETLIWAS +  AK  TFNY A+KA N+ VQMRSDW +PIC+G ERL+NKDG
Sbjct: 132 KGTRFTNAHETLIWASKTKDAK-PTFNYAAMKALNDGVQMRSDWTLPICAGGERLKNKDG 190

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
           +K HPTQKPE+LL R+L++++ PGD++LDPFFG+GT+GAVAKKL R +IGIE    Y D+
Sbjct: 191 KKAHPTQKPESLLHRVLLATSNPGDVVLDPFFGTGTTGAVAKKLGRHYIGIEADPGYADV 250

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADG 320
           A KRIA++ P     L V   KR  PR+ F  LVE GL++PG  L  AQG  +A V ADG
Sbjct: 251 ARKRIAAINPTSEDLLQVTQSKRALPRIPFGSLVEAGLLKPGDTLYCAQGRRTAQVRADG 310

Query: 321 TLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           T+I+G + GSIH++GA V G+ +CNGW FW+  + G L  I+ LR  +R E+
Sbjct: 311 TVIAGGQAGSIHQMGAHVQGAPSCNGWTFWHVRQGGALAPIDVLRARIRAEM 362


>gi|254461867|ref|ZP_05075283.1| modification methylase SmeIP [Rhodobacterales bacterium HTCC2083]
 gi|206678456|gb|EDZ42943.1| modification methylase SmeIP [Rhodobacteraceae bacterium HTCC2083]
          Length = 371

 Score =  455 bits (1171), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 212/350 (60%), Positives = 264/350 (75%), Gaps = 1/350 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           I  G+ I V+  LP  S+DLIFADPPYNLQL G L+RPD+S VDAV D WD+FSSF AYD
Sbjct: 18  IQSGDCIEVMNSLPENSIDLIFADPPYNLQLKGDLHRPDNSRVDAVDDHWDQFSSFAAYD 77

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            FT+ WL A RR+LKPNG +WVIGSYHNIFR+G+ LQN  +WILND+VWRKSNPMPNFRG
Sbjct: 78  KFTQDWLKAARRLLKPNGAIWVIGSYHNIFRVGSALQNEGYWILNDVVWRKSNPMPNFRG 137

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +RF NAHET+IWAS S  AK YTFNY+ALK+ NE +QMRSDW++PIC+G ERL+++ GEK
Sbjct: 138 KRFTNAHETMIWASKSEGAK-YTFNYEALKSLNEGIQMRSDWVLPICTGHERLKDEAGEK 196

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKPE+LL R+L+ ST PGD++LDPFFG+GT+GAVAK L R +IGIE +  Y  +A 
Sbjct: 197 AHPTQKPESLLHRVLIGSTNPGDVVLDPFFGTGTTGAVAKMLGREYIGIEREAAYRKVAE 256

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           KRI +V+      L V T KR EPRV F  LVERG+++PG+ L +      A V ADGTL
Sbjct: 257 KRIKAVRKFDREALRVSTSKRAEPRVPFGQLVERGMLRPGENLYSMNNRHKAKVRADGTL 316

Query: 323 ISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           I     GSIH+VGA + G+ +CNGW +W F++ G+   I+ LR  +R E+
Sbjct: 317 IGDDVKGSIHQVGAALEGAPSCNGWTYWSFKRDGKTVPIDVLRQQIRSEM 366


>gi|254476528|ref|ZP_05089914.1| modification methylase SmeIP [Ruegeria sp. R11]
 gi|214030771|gb|EEB71606.1| modification methylase SmeIP [Ruegeria sp. R11]
          Length = 374

 Score =  455 bits (1171), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 214/352 (60%), Positives = 264/352 (75%), Gaps = 1/352 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           I+ G+ I V+  LP+ SVD+IFADPPYNLQL GQL+RPD+S VDAV D WD+FSSF  YD
Sbjct: 24  ILDGDCIEVMAGLPSNSVDMIFADPPYNLQLKGQLHRPDNSKVDAVDDHWDQFSSFGVYD 83

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            FTR WL   RR+LKPNG++WVIGSYHNIFR+GT +Q+  FWILND++WRKSNPMPNFRG
Sbjct: 84  KFTRDWLKEARRILKPNGSIWVIGSYHNIFRVGTAMQDEGFWILNDVIWRKSNPMPNFRG 143

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +RF NAHET+IWAS S  AK YTFNY+ALKA NE +QMRSDW++PIC+G ERL++  G K
Sbjct: 144 KRFTNAHETMIWASKSEGAK-YTFNYEALKALNEGLQMRSDWVLPICTGHERLKDDAGNK 202

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKPE+LL RIL+ ST PGD++LDPFFG+GT+GAVAK L R FIGIE +  Y ++A 
Sbjct: 203 AHPTQKPESLLHRILLGSTNPGDVVLDPFFGTGTTGAVAKMLGREFIGIEREATYREVAE 262

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           KRI SV+      L V   KR EPRV F  LVERG+++PG+ L +      A V ADGTL
Sbjct: 263 KRIKSVRKFDREALQVSASKRAEPRVPFGQLVERGMLRPGEELYSMNRRHKAKVRADGTL 322

Query: 323 ISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKELYN 374
           I     GSIH+VGA +  + +CNGW +W F++ G+   I+ LR  +R EL N
Sbjct: 323 IGDNIKGSIHQVGAHLENAPSCNGWTYWCFKRDGKTVPIDVLRQQIRAELQN 374


>gi|84502791|ref|ZP_01000904.1| modification methylase [Oceanicola batsensis HTCC2597]
 gi|84388774|gb|EAQ01644.1| modification methylase [Oceanicola batsensis HTCC2597]
          Length = 363

 Score =  455 bits (1170), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 212/350 (60%), Positives = 265/350 (75%), Gaps = 2/350 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           I+ G+ I  +  LP  SVDLIFADPPYNLQL GQL+RPD+S VDAV D WD+F SF AYD
Sbjct: 15  ILAGDCIEQMNALPEASVDLIFADPPYNLQLKGQLHRPDNSEVDAVDDHWDQFDSFAAYD 74

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            FTR WL A RR+LKP+G +WVIGSYHNIFR+G  LQ+  +WILND+VWRKSNPMPNFRG
Sbjct: 75  RFTRDWLAAARRLLKPDGAIWVIGSYHNIFRVGAALQDAGYWILNDVVWRKSNPMPNFRG 134

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +RF NAHET+IWAS S  AK YTFNY+ALK+ NE +QMRSDW++PIC+G ERL++  G+K
Sbjct: 135 KRFTNAHETMIWASKSEGAK-YTFNYEALKSLNEGIQMRSDWVLPICNGGERLKDAKGDK 193

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKPEALL R+LV ST PGD++LDPFFG+GT+GAVAK L R +IGIE ++ Y  +A 
Sbjct: 194 AHPTQKPEALLHRVLVGSTNPGDVVLDPFFGTGTTGAVAKMLGREYIGIEREEAYRKVAE 253

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
            RI+ V+      L V T KR EPRV F  LVERG+++PG+ L N +G  +A V ADGTL
Sbjct: 254 ARISKVRKFDRDALIVSTSKRAEPRVPFGQLVERGMLRPGETLVNTRGQ-AARVRADGTL 312

Query: 323 ISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
            +    GSIH+VGA + G+ +CNGW +W+F K G+   I+ +R  +R E+
Sbjct: 313 ATDGFNGSIHQVGAHIEGAPSCNGWTYWHFLKDGKTIPIDLMRQQIRAEM 362


>gi|16124633|ref|NP_419197.1| modification methylase CcrMI [Caulobacter crescentus CB15]
 gi|221233321|ref|YP_002515757.1| adenine-specific methyltransferase ccrM [Caulobacter crescentus
           NA1000]
 gi|239977504|sp|B8GZ33|MTC1_CAUCN RecName: Full=Modification methylase CcrMI; Short=M.CcrMI; AltName:
           Full=Adenine-specific methyltransferase CcrMI
 gi|239977505|sp|P0CAW2|MTC1_CAUCR RecName: Full=Modification methylase CcrMI; Short=M.CcrMI; AltName:
           Full=Adenine-specific methyltransferase CcrMI
 gi|13421535|gb|AAK22365.1| modification methylase CcrMI [Caulobacter crescentus CB15]
 gi|220962493|gb|ACL93849.1| adenine-specific methyltransferase ccrM [Caulobacter crescentus
           NA1000]
          Length = 358

 Score =  455 bits (1170), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 213/349 (61%), Positives = 258/349 (73%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           + II G+ I  +  LP KSVDLIFADPPYNLQL G L RPD+S VDAV D WD+F SF A
Sbjct: 6   ETIIHGDCIEQMNALPEKSVDLIFADPPYNLQLGGDLLRPDNSKVDAVDDHWDQFESFAA 65

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YD FTR WL A RRVLK +G +WVIGSYHNIFR+G  +Q+L FWILNDIVWRKSNPMPNF
Sbjct: 66  YDKFTREWLKAARRVLKDDGAIWVIGSYHNIFRVGVAVQDLGFWILNDIVWRKSNPMPNF 125

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           +G RF NAHETLIWAS S  AK YTFNYDALK AN++VQMRSDW IP+C+G ER++  DG
Sbjct: 126 KGTRFANAHETLIWASKSQNAKRYTFNYDALKMANDEVQMRSDWTIPLCTGEERIKGADG 185

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
           +K HPTQKPEALL R+++S+TKPGD+ILDPFFG GT+GA AK+L R FIGIE + +Y++ 
Sbjct: 186 QKAHPTQKPEALLYRVILSTTKPGDVILDPFFGVGTTGAAAKRLGRKFIGIEREAEYLEH 245

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADG 320
           A  RIA V P+   +L V+  KR EPRV F  +VE GL+ PG  L  ++G   A V  DG
Sbjct: 246 AKARIAKVVPIAPEDLDVMGSKRAEPRVPFGTIVEAGLLSPGDTLYCSKGTHVAKVRPDG 305

Query: 321 TLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVR 369
           ++  G   GSIH++GA V  +  CNGW +W+F+    L  I+ LR  VR
Sbjct: 306 SITVGDLSGSIHKIGALVQSAPACNGWTYWHFKTDAGLAPIDVLRAQVR 354


>gi|255262501|ref|ZP_05341843.1| modification methylase CcrMI [Thalassiobium sp. R2A62]
 gi|255104836|gb|EET47510.1| modification methylase CcrMI [Thalassiobium sp. R2A62]
          Length = 369

 Score =  455 bits (1170), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 211/350 (60%), Positives = 266/350 (76%), Gaps = 1/350 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           I+ G+ I  +  LPA SVDLIFADPPYNLQL G L+RPD+S VDAV + WD+FSSF+ YD
Sbjct: 18  ILDGDCIERMNSLPAGSVDLIFADPPYNLQLRGDLHRPDNSKVDAVDNDWDQFSSFDVYD 77

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            FT+AWL A RR+LKPNG +W IGSYHN+FR+G  LQN  FWILND+VWRKSNPMPNFRG
Sbjct: 78  KFTKAWLKAARRLLKPNGAIWCIGSYHNVFRMGAELQNQGFWILNDVVWRKSNPMPNFRG 137

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +RF NAHETLIWAS S  AK YTFNY+ALKA NE +QMRSDW++PIC+G ERL++ +G+K
Sbjct: 138 KRFTNAHETLIWASKSEGAK-YTFNYEALKALNEGIQMRSDWVLPICTGHERLKDDNGDK 196

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKPE+LL R+L+++T PGD++LDPFFG+GT+GAVAK L R FIGIE +  Y ++A 
Sbjct: 197 AHPTQKPESLLHRVLLATTNPGDVVLDPFFGTGTTGAVAKMLGREFIGIEREVAYREVAE 256

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           KRIA ++      L V   KR EPRV F  LVERG+++PG+ L +      A V ADGTL
Sbjct: 257 KRIAKIRKFDKEALQVSQSKRAEPRVPFGQLVERGMLRPGEELYSINKRHKAKVRADGTL 316

Query: 323 ISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           I     GSIH+VGA + G+ +CNGW +W+++K G+   I+ LR  +R E+
Sbjct: 317 IGDDVKGSIHQVGAHLEGAPSCNGWTYWHYKKEGKKVPIDLLRQQIRAEM 366


>gi|254485663|ref|ZP_05098868.1| modification methylase SmeIP [Roseobacter sp. GAI101]
 gi|214042532|gb|EEB83170.1| modification methylase SmeIP [Roseobacter sp. GAI101]
          Length = 366

 Score =  455 bits (1170), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 212/352 (60%), Positives = 261/352 (74%), Gaps = 1/352 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           I+ G+ I  +  +P  SVDLIFADPPYNLQL G L+RPD+S VDAV D+WD+F+SF  YD
Sbjct: 16  ILAGDCIEAMNAMPEGSVDLIFADPPYNLQLKGDLHRPDNSKVDAVDDAWDQFASFAVYD 75

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            FTR WL A RR+LKPNG +WVIGSYHNIFR+G  LQ+  FWILND+VWRKSNPMPNFRG
Sbjct: 76  KFTREWLKAARRLLKPNGAIWVIGSYHNIFRVGAALQDQGFWILNDVVWRKSNPMPNFRG 135

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +RF NAHET+IWA     +K YTFNY+ALKA NE +QMRSDW++PIC+G ERL++  G+K
Sbjct: 136 KRFTNAHETMIWAGKDENSK-YTFNYEALKALNEGIQMRSDWVLPICTGHERLKDDAGDK 194

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKPE+LL RILV ST PGD++LDPFFG+GT+GAVAK L R FIGIE ++ Y  +A 
Sbjct: 195 AHPTQKPESLLHRILVGSTNPGDVVLDPFFGTGTTGAVAKMLGRDFIGIEREEAYRKVAE 254

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           KRI SV+      L   T KR EPRV F  LVERG+++PG+ L +  G  SA V ADGTL
Sbjct: 255 KRIKSVRKFDKEALQTTTSKRAEPRVPFGQLVERGMLRPGEELYSLNGRYSAKVRADGTL 314

Query: 323 ISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKELYN 374
           I     GSIH+VGA    + +CNGW +W ++K G+   I+ LR  +R E+ N
Sbjct: 315 IGNEVKGSIHQVGAAYEKAPSCNGWTYWCYKKDGKRVPIDILRQQIRAEMAN 366


>gi|119384833|ref|YP_915889.1| DNA methylase N-4/N-6 domain-containing protein [Paracoccus
           denitrificans PD1222]
 gi|119374600|gb|ABL70193.1| DNA methylase N-4/N-6 domain protein [Paracoccus denitrificans
           PD1222]
          Length = 376

 Score =  454 bits (1169), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 209/352 (59%), Positives = 264/352 (75%), Gaps = 1/352 (0%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           ++I+ G+ I ++  LP  SVDLIFADPPYNLQL G+L+RPD+S VDAV D WD+FS F A
Sbjct: 18  NQILAGDCIEIMNALPEASVDLIFADPPYNLQLKGELHRPDNSRVDAVDDHWDQFSGFAA 77

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YD FTR WL A RR+LKP+G +WVIGSYHNIFR+G  LQN  FWILND+VWRK+NPMPNF
Sbjct: 78  YDRFTRDWLAAARRILKPDGAIWVIGSYHNIFRVGAELQNQGFWILNDVVWRKANPMPNF 137

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           RG+R  NAHET+IWAS S  AK YTFNY+ALK+ NE VQMRSDW++PIC+G ERL++  G
Sbjct: 138 RGKRLTNAHETMIWASKSEGAK-YTFNYEALKSLNEGVQMRSDWVLPICTGGERLKDAGG 196

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
            K HPTQKPEALL RILV ST PGD++LDPFFG+GT+GAVAK L R FIGIE +  Y ++
Sbjct: 197 AKAHPTQKPEALLHRILVGSTNPGDVVLDPFFGTGTTGAVAKMLGRDFIGIEREAAYREV 256

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADG 320
           A KRIA ++   +  +  +  KR EPRV F  +VERG+++PG+ L +      A V ADG
Sbjct: 257 AEKRIARIRKFDSEAIATIKPKRAEPRVPFGQVVERGMLRPGEELYSLNNRHKAKVRADG 316

Query: 321 TLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           +LI     GSIH+VGA + G+ +CNGW +W+F + G +  I+ LR  +R E+
Sbjct: 317 SLIGNDVKGSIHQVGAALEGAPSCNGWTYWHFRREGRMVPIDILRQQIRAEM 368


>gi|89052883|ref|YP_508334.1| DNA methylase N-4/N-6 [Jannaschia sp. CCS1]
 gi|88862432|gb|ABD53309.1| DNA methylase N-4/N-6 [Jannaschia sp. CCS1]
          Length = 367

 Score =  454 bits (1169), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 210/350 (60%), Positives = 270/350 (77%), Gaps = 2/350 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           I+ G+ I V+  LP  SVDLIFADPPYNLQL G L+RP++SLVDAV + WD+F SF+AYD
Sbjct: 18  ILAGDCIDVMNALPEASVDLIFADPPYNLQLKGDLHRPNNSLVDAVDNDWDQFDSFKAYD 77

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
           AFT+AWL A +R+LKP G +WVIGSYHNIFR+G  LQ   +WILND+VWRKSNPMPNFRG
Sbjct: 78  AFTKAWLAAAKRLLKPGGAIWVIGSYHNIFRVGAELQTQGYWILNDVVWRKSNPMPNFRG 137

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +RF NAHET+IWAS    AK YTFNY+ALK  NE +QMRSDW++PIC+GSERL++  G+K
Sbjct: 138 KRFTNAHETMIWASKDEGAK-YTFNYEALKELNEGIQMRSDWVLPICNGSERLKDDKGDK 196

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKPE+LL R+LV ST PGD++LDPFFG+GT+GAVAK L R +IGIE ++ Y  +A 
Sbjct: 197 AHPTQKPESLLHRVLVGSTNPGDVVLDPFFGTGTTGAVAKALGRDYIGIEREEAYRVVAE 256

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           KR++ V+      + V T KR EPRV F  LVERG+++PG++L + +G   A V ADGTL
Sbjct: 257 KRLSRVRKFDKTSIAVTTPKRAEPRVPFGQLVERGMLRPGEMLFSPRGQ-QAKVRADGTL 315

Query: 323 ISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           I+    GSIH+VGA++ G+ +CNGW +W F++ G+  SI+ LR  +R E+
Sbjct: 316 IADDVKGSIHKVGAELEGAPSCNGWTYWNFKRDGKNVSIDVLRQQIRAEM 365


>gi|149912479|ref|ZP_01901013.1| Site-specific DNA-methyltransferase [Roseobacter sp. AzwK-3b]
 gi|149812885|gb|EDM72711.1| Site-specific DNA-methyltransferase [Roseobacter sp. AzwK-3b]
          Length = 371

 Score =  454 bits (1168), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 210/352 (59%), Positives = 264/352 (75%), Gaps = 1/352 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           I+ G+ I V+  LP  S+DLIFADPPYNLQL G L+RPD+S VDAV D+WD+F+SFE YD
Sbjct: 18  ILDGDCIEVMNSLPEGSIDLIFADPPYNLQLRGDLHRPDNSAVDAVDDAWDQFASFEVYD 77

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            FT  WL A RR+LKPNG +WVIGSYHNIFR+G  LQN  FWILND+VWRKSNPMPNFRG
Sbjct: 78  CFTNDWLNAARRLLKPNGAIWVIGSYHNIFRVGAALQNAGFWILNDVVWRKSNPMPNFRG 137

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +R  NAHET+IWAS    AK YTFNY+ALK+ N+ VQMRSDW++PIC+G ERL+++ G+K
Sbjct: 138 KRLTNAHETMIWASKQEGAK-YTFNYEALKSLNDGVQMRSDWVLPICTGHERLKDEHGDK 196

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKPE+LL R+LV ST PGD++LDPFFG+GT+GAVAK L R +IGIE +  Y  +A 
Sbjct: 197 AHPTQKPESLLHRVLVGSTNPGDVVLDPFFGTGTTGAVAKMLGRDYIGIEREAAYRKVAE 256

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           KR+A ++      L V T KR EPRV F  LVERG+++PG+ L +  G   A V ADGTL
Sbjct: 257 KRLAGIRKFDRAALEVSTSKRAEPRVPFGQLVERGMLRPGEELLSMNGRHKAKVRADGTL 316

Query: 323 ISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKELYN 374
           I     GSIH+VGA + G+ +CNGW +W F++ G+   I+ LR  +R E+ +
Sbjct: 317 IGDDVKGSIHQVGAALEGAPSCNGWTYWCFKRDGKTVPIDILRQQIRAEMAD 368


>gi|87199857|ref|YP_497114.1| DNA methylase N-4/N-6 [Novosphingobium aromaticivorans DSM 12444]
 gi|87135538|gb|ABD26280.1| DNA methylase N-4/N-6 [Novosphingobium aromaticivorans DSM 12444]
          Length = 380

 Score =  454 bits (1168), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 209/347 (60%), Positives = 270/347 (77%), Gaps = 2/347 (0%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           ++I++G+ I+ + KLP  S+D+IFADPPYNLQL G L RPD S VDAVT+ WDKFSSF A
Sbjct: 29  NQILRGDCIAEMRKLPDASIDMIFADPPYNLQLGGDLARPDGSHVDAVTNDWDKFSSFAA 88

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YD FTR WL+  RR+LKP+G++WVIGSYHNIFR+G +LQ+L FWILNDI+WRK+NPMPNF
Sbjct: 89  YDKFTREWLVEARRLLKPDGSIWVIGSYHNIFRVGALLQDLGFWILNDIIWRKANPMPNF 148

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           +G RF NAHETLIWAS S K+K YTFNY A+K  N+++QMRSDW++PICSG ERLR ++G
Sbjct: 149 KGTRFTNAHETLIWASKSEKSK-YTFNYRAMKTLNDELQMRSDWVLPICSGPERLR-RNG 206

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
            K HPTQKPEALL R+++++T  GD++LDPFFG+GT+GAVAK+L R++IG E + DYI++
Sbjct: 207 TKAHPTQKPEALLYRVMLATTNKGDVVLDPFFGTGTTGAVAKRLGRNWIGCEREDDYIEV 266

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADG 320
           A +RI    PL    LT +  KR+ P+VAF  LVE G + PG  LT  +G  +A V ADG
Sbjct: 267 ANERIELALPLDESALTTMQSKRSAPKVAFGALVESGYLAPGTRLTAKKGRFNAVVRADG 326

Query: 321 TLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRIL 367
           +L S  E+GSIH +GAK+ G+ +CNGW FW+ E  GE+  I+ LR L
Sbjct: 327 SLQSEAEIGSIHGLGAKLQGAPSCNGWTFWHVEHEGEVKPIDALRQL 373


>gi|89070018|ref|ZP_01157349.1| modification methylase [Oceanicola granulosus HTCC2516]
 gi|89044355|gb|EAR50493.1| modification methylase [Oceanicola granulosus HTCC2516]
          Length = 368

 Score =  454 bits (1168), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 206/350 (58%), Positives = 265/350 (75%), Gaps = 1/350 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           I+ G+ I  +  LP  S+DLIFADPPYNLQL G L+RPD+S VDAV D+WD+F++FE YD
Sbjct: 17  ILSGDCIEAMRTLPDASIDLIFADPPYNLQLKGDLHRPDNSRVDAVDDAWDRFATFETYD 76

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
           AFTRAWL   RR+LKP G +WVIGSYHN+FR+G  LQN  +WILND+VWRKSNPMPNFRG
Sbjct: 77  AFTRAWLAEARRLLKPTGAIWVIGSYHNVFRLGAELQNQGYWILNDVVWRKSNPMPNFRG 136

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +R  NAHETLIWAS S  +K YTFNY+ALKA NE  QMRSDW++PIC+G ERL++ +G+K
Sbjct: 137 KRLTNAHETLIWASKSEGSK-YTFNYEALKALNEGTQMRSDWVLPICTGHERLKDANGDK 195

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKPE+LL R+L+ +T PGD++LDPFFG+GT+GAVAK L R +IGIE +  Y ++A 
Sbjct: 196 AHPTQKPESLLHRVLLGTTNPGDVVLDPFFGTGTTGAVAKMLGRDWIGIEREAAYREVAE 255

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
            R+  ++      L V T KR EPRV F  LVERG+++PG++LT+  G  SA V ADGTL
Sbjct: 256 ARLKRIRKYDRDALAVTTSKRAEPRVPFGQLVERGMLRPGEVLTSLNGQKSAKVRADGTL 315

Query: 323 ISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           ++    GSIH+VGA + G+ +CNGW +W F + G+   I+ LR  +R E+
Sbjct: 316 VADDVKGSIHQVGAHLEGAPSCNGWTYWCFRRDGKTVPIDLLRQQIRAEM 365


>gi|295687797|ref|YP_003591490.1| DNA methylase N-4/N-6 domain-containing protein [Caulobacter segnis
           ATCC 21756]
 gi|295429700|gb|ADG08872.1| DNA methylase N-4/N-6 domain protein [Caulobacter segnis ATCC
           21756]
          Length = 358

 Score =  454 bits (1167), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 214/349 (61%), Positives = 258/349 (73%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           + II G+ I  +  LP KSVDLIFADPPYNLQL G L RPD+S VDAV D WD+F SF A
Sbjct: 6   ETIILGDCIEQMNALPEKSVDLIFADPPYNLQLGGDLLRPDNSKVDAVDDHWDQFESFAA 65

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YD FTR WL A RRVLK +G +WVIGSYHNIFR+G  +Q+L FWILNDIVWRKSNPMPNF
Sbjct: 66  YDKFTREWLKAARRVLKDDGAIWVIGSYHNIFRVGVAVQDLGFWILNDIVWRKSNPMPNF 125

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           +G RF NAHETLIWAS S  AK YTFNYDALK AN++VQMRSDW IP+C+G ER++  DG
Sbjct: 126 KGTRFANAHETLIWASKSQNAKRYTFNYDALKMANDEVQMRSDWTIPLCTGEERIKGADG 185

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
           +K HPTQKPEALL R+++S+TKPGD+ILDPFFG GT+GA AK+L R FIGIE + +Y+  
Sbjct: 186 QKAHPTQKPEALLYRVILSTTKPGDVILDPFFGVGTTGAAAKRLGRKFIGIEREAEYLGH 245

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADG 320
           A +RIA V P+   +L V+  KR EPRV F  +VE GL+ PG  L  A+G   A V  DG
Sbjct: 246 AKERIAKVVPINPHDLEVMGSKRAEPRVPFGTIVEAGLLSPGDTLYCAKGERVAKVRPDG 305

Query: 321 TLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVR 369
           ++  G   GSIH++GA V  +  CNGW +W+F+    L  I+ LR  VR
Sbjct: 306 SITVGDLSGSIHKIGALVQSAPACNGWTYWHFKTDAGLAPIDVLRAQVR 354


>gi|254293434|ref|YP_003059457.1| DNA methylase N-4/N-6 domain protein [Hirschia baltica ATCC 49814]
 gi|254041965|gb|ACT58760.1| DNA methylase N-4/N-6 domain protein [Hirschia baltica ATCC 49814]
          Length = 363

 Score =  453 bits (1166), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 208/353 (58%), Positives = 267/353 (75%)

Query: 20  KDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFE 79
           KD I+ G+ I ++  LP KSVDL+FADPPYNLQL G L RPD+S VDAV + WD+F+SFE
Sbjct: 8   KDHILIGDCIELMNSLPEKSVDLVFADPPYNLQLGGDLVRPDNSKVDAVDNEWDQFASFE 67

Query: 80  AYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPN 139
            YD FT+ WL A RRVLK +G +WVIGSYHNIFR+G+ LQ+L FWILND++W KSNPMPN
Sbjct: 68  TYDNFTKDWLTAARRVLKDDGAIWVIGSYHNIFRVGSQLQDLGFWILNDVIWNKSNPMPN 127

Query: 140 FRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKD 199
           F+G RF NAHETLIWA+ S + K YTFNYDALK AN+DVQMRSDW IPICSG ERL+N +
Sbjct: 128 FKGTRFTNAHETLIWATKSKEQKKYTFNYDALKTANDDVQMRSDWTIPICSGGERLKNDE 187

Query: 200 GEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYID 259
           G+K HPTQKPEALL R+++++TK GD +LDPFFG+GT+GAVAK L R FIG+E ++DY  
Sbjct: 188 GKKAHPTQKPEALLHRVIMATTKQGDTVLDPFFGTGTTGAVAKMLGRHFIGLEREEDYAA 247

Query: 260 IATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCAD 319
           +A  RI +V+ + +++L V   KR+ PRV F  L+ERG ++PG  L   +    A V AD
Sbjct: 248 VAQARIDNVRKVDDVDLQVTQPKRSAPRVPFGALIERGFLRPGDRLYCPKQQHIARVRAD 307

Query: 320 GTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           G+L +G + GSIHR+GA+V  + +CNGW FW+++    L  I+ LR   R E+
Sbjct: 308 GSLANGDDTGSIHRLGAQVQNAPSCNGWTFWHYKSDQGLAPIDLLRRKFRTEM 360


>gi|323135965|ref|ZP_08071048.1| DNA methylase N-4/N-6 domain protein [Methylocystis sp. ATCC 49242]
 gi|322399056|gb|EFY01575.1| DNA methylase N-4/N-6 domain protein [Methylocystis sp. ATCC 49242]
          Length = 392

 Score =  453 bits (1165), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 207/354 (58%), Positives = 264/354 (74%), Gaps = 1/354 (0%)

Query: 20  KDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFE 79
           ++ I++G+ + ++  LP +SVDL+FADPPYNLQL  +L RPD SLVDAV D WDKF+ F 
Sbjct: 34  RNAILQGDCVELMRGLPHESVDLVFADPPYNLQLASKLTRPDQSLVDAVDDDWDKFADFA 93

Query: 80  AYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPN 139
            YDAFTR WL A RRV+KP+ T++VIGSYHNIFR+G ++Q+L FWILNDIVWRK+NPMPN
Sbjct: 94  TYDAFTRDWLSAARRVMKPSATIFVIGSYHNIFRVGAIMQDLGFWILNDIVWRKNNPMPN 153

Query: 140 FRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKD 199
           FRGRRF NAHET+IWA+    AK YTFNY+ALKA NED QMRSDWL+PIC+G+ERL++ +
Sbjct: 154 FRGRRFTNAHETMIWAARDASAKSYTFNYEALKAGNEDCQMRSDWLLPICTGAERLKDAE 213

Query: 200 GEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYID 259
           G K HPTQKPE LL+R+++S++  GD++LDPFFGSGT+GAVAK+LRR F+G+E    Y  
Sbjct: 214 GRKAHPTQKPETLLARVILSASNAGDLVLDPFFGSGTTGAVAKRLRRDFLGLERDPVYAK 273

Query: 260 IATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCAD 319
            A  RIA ++PL    ++V   KR EPR+AF  LVE GLI PG  LT+ +    A V AD
Sbjct: 274 AANARIAEIEPLPEHAVSVAPSKRAEPRIAFASLVESGLIAPGARLTDLKKRHVAMVRAD 333

Query: 320 GTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKL-GELHSINTLRILVRKEL 372
           GTL     +GSIH+ GA   G   CNGW FW++EK  G +  I+ LR  +R  +
Sbjct: 334 GTLSLSGFIGSIHKTGALAQGLPACNGWTFWHYEKADGLVAPIDELRAQMRDHM 387


>gi|149202923|ref|ZP_01879894.1| modification methylase [Roseovarius sp. TM1035]
 gi|149143469|gb|EDM31505.1| modification methylase [Roseovarius sp. TM1035]
          Length = 370

 Score =  452 bits (1164), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 206/350 (58%), Positives = 271/350 (77%), Gaps = 2/350 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II G+ I V+  LP  SVDLIFADPPYNLQL G L+RPD+S VDAV D+WD+F+SF AYD
Sbjct: 18  IIAGDCIEVMNSLPEASVDLIFADPPYNLQLKGDLHRPDNSQVDAVDDAWDQFASFAAYD 77

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            FT+ WL A RR+LKP+G +WVIGSYHNIFR+G  LQ+  +WILND++WRKSNPMPNFRG
Sbjct: 78  KFTQDWLKAARRLLKPHGAIWVIGSYHNIFRVGAALQDAGYWILNDVIWRKSNPMPNFRG 137

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +R  NAHET+IWAS S  AK YTFNY+ALK+ N+ VQMRSDW++P+C+G ERL++ +G+K
Sbjct: 138 KRLTNAHETMIWASKSEGAK-YTFNYEALKSLNDGVQMRSDWVLPLCTGHERLKDDNGDK 196

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKPE+LL R+LV ST PGD++LDPFFG+GT+GAVAK L R +IGIE +  Y  +A 
Sbjct: 197 AHPTQKPESLLHRVLVGSTNPGDVVLDPFFGTGTTGAVAKMLGRDYIGIEREAAYRSVAE 256

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           KR+A+++      L V T KR EPRV F  L+ERG+++PG++LT+  G  +A V ADGTL
Sbjct: 257 KRLANIRKFDRDALQVSTSKRAEPRVPFGQLIERGMLRPGEVLTSINGK-AAKVRADGTL 315

Query: 323 ISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           ++    GSIH++GA + G+ +CNGW +W F++ G++  I+ LR  +R E+
Sbjct: 316 VADGINGSIHQIGAHLEGAPSCNGWTYWCFKREGKVVPIDVLRQQIRSEM 365


>gi|126738667|ref|ZP_01754372.1| modification methylase [Roseobacter sp. SK209-2-6]
 gi|126720466|gb|EBA17172.1| modification methylase [Roseobacter sp. SK209-2-6]
          Length = 368

 Score =  452 bits (1163), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 212/352 (60%), Positives = 262/352 (74%), Gaps = 1/352 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           I+ G+ I V+  LP  SVDLIFADPPYNLQL  QL+RPD+S VDAV D WD+FSSF AYD
Sbjct: 18  ILDGDCIEVMSGLPDNSVDLIFADPPYNLQLKNQLHRPDNSKVDAVDDHWDQFSSFAAYD 77

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            FT  WL   RR+LKPNG +WVIGSYHNIFR+GT +Q+  FWILND+VWRKSNPMPNFRG
Sbjct: 78  DFTSRWLHQARRILKPNGAIWVIGSYHNIFRVGTAMQDEGFWILNDVVWRKSNPMPNFRG 137

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +R+ NAHET+IWAS S   K YTFNY+ALKA NE +QMRSDW++PIC+G ERL++++G+K
Sbjct: 138 KRYTNAHETMIWASKSEGGK-YTFNYEALKALNEGIQMRSDWVLPICTGHERLKDENGDK 196

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKPE+LL RILV ST PGD++LDPFFG+GT+GAVAK L R FIGIE ++ Y  +A 
Sbjct: 197 AHPTQKPESLLHRILVGSTNPGDVVLDPFFGTGTTGAVAKMLGREFIGIEQEESYRKVAA 256

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
            RI +V+      L V T KR  PRV F  LVERG+++PG+ L +      A V ADGTL
Sbjct: 257 ARIKAVRKFDREALQVSTSKRAAPRVPFGQLVERGMLRPGEELYSMNRRHKAKVRADGTL 316

Query: 323 ISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKELYN 374
           I     GSIH+VGA +  + +CNGW +W F+K G+   I+ LR  +R E+ N
Sbjct: 317 IGDNCKGSIHQVGAHLENAPSCNGWTYWCFKKDGKTVPIDVLRQQIRAEMQN 368


>gi|329888142|ref|ZP_08266740.1| modification methylase CcrMI [Brevundimonas diminuta ATCC 11568]
 gi|328846698|gb|EGF96260.1| modification methylase CcrMI [Brevundimonas diminuta ATCC 11568]
          Length = 356

 Score =  452 bits (1162), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 209/349 (59%), Positives = 261/349 (74%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           D I++G+ I VL+ LP KSVD++FADPPYNLQL G L RPD+S VDAV D WDKF SF A
Sbjct: 4   DVILRGDCIEVLKGLPDKSVDMVFADPPYNLQLGGDLLRPDNSKVDAVDDDWDKFDSFAA 63

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YDAFTRAWL  CRRVLK  G+LWVIGSYHNIFR+G  +Q+L FW+LNDI+WRKSNPMPNF
Sbjct: 64  YDAFTRAWLGECRRVLKDEGSLWVIGSYHNIFRLGAAMQDLGFWVLNDIIWRKSNPMPNF 123

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           +G RF NAHETLIWA+ S + K YTFNYDALKA NED QMRSDW + +C+G ERL++++G
Sbjct: 124 KGTRFTNAHETLIWAAKSREQKRYTFNYDALKAFNEDTQMRSDWTLALCTGGERLKDENG 183

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
           +K HPTQKPEALL R+L+S+++ GD++LDPFFG+GT+GA AK+L R FIGIE  + Y  +
Sbjct: 184 DKAHPTQKPEALLHRVLLSASRVGDVVLDPFFGTGTTGAAAKRLGRRFIGIERDETYAKL 243

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADG 320
           A KRI +V P    +L V   K+ EP+V F  LVE GL+ PG  L   +G   A V ADG
Sbjct: 244 AEKRIKAVIPAAPEDLVVTGSKKAEPKVPFGALVEAGLLAPGDKLYCPKGEREARVRADG 303

Query: 321 TLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVR 369
           +L+SG   GSIH++GA +  +  CNGW +W F+    L  I+ LR  +R
Sbjct: 304 SLVSGALTGSIHKLGALLENAPACNGWTYWRFKTDTGLRPIDALRAEIR 352


>gi|182677743|ref|YP_001831889.1| DNA methylase N-4/N-6 domain-containing protein [Beijerinckia
           indica subsp. indica ATCC 9039]
 gi|182633626|gb|ACB94400.1| DNA methylase N-4/N-6 domain protein [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 395

 Score =  452 bits (1162), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 215/350 (61%), Positives = 268/350 (76%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           D+I+ G+ +  L +LPA+SVDL+FADPPYNLQL G++ RPD S VDAV D+WDKF SF  
Sbjct: 40  DQILLGDCVEKLNRLPAESVDLVFADPPYNLQLEGKILRPDQSQVDAVDDAWDKFDSFAD 99

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YD FT  WL A RRV+K + TL+VIGSYHNIFR+GT+LQ+  FWILNDI+WRKSNPMPNF
Sbjct: 100 YDRFTHEWLAAVRRVMKRHATLFVIGSYHNIFRVGTILQDQGFWILNDIIWRKSNPMPNF 159

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           RGRRF NAHET+IWA+ S   K YTF+YDALKA NED Q+RSDWL+PICSG ERL+N+ G
Sbjct: 160 RGRRFTNAHETMIWAAKSADVKNYTFHYDALKAGNEDHQVRSDWLLPICSGGERLKNEAG 219

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
            K HPTQKPE LLSRIL+++T PGD++LDPFFG+GT+GAVAKKL RSFIGIE +  Y   
Sbjct: 220 RKTHPTQKPENLLSRILLATTNPGDVVLDPFFGTGTTGAVAKKLGRSFIGIEREAGYAAA 279

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADG 320
           A  RIA++ PL +  +     KRTEPR+ F  L+E GL+  G+ LT+ +G   A V ADG
Sbjct: 280 AKARIAAIDPLPSEAIASFPNKRTEPRIPFMTLIESGLLAAGETLTDEKGRHEAVVRADG 339

Query: 321 TLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRK 370
           TL  G  +GSIH++GA V G   CNGW FW+F++ G+ H ++ LRI +R+
Sbjct: 340 TLAVGPIIGSIHKIGALVQGLPACNGWTFWHFQRDGQKHPLDRLRIQLRE 389


>gi|393012|gb|AAA18913.1| adenine methyltransferase [Caulobacter crescentus CB15]
          Length = 358

 Score =  451 bits (1160), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 212/349 (60%), Positives = 257/349 (73%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           + II G+ I  +  LP KSVDLIFADPPYNLQL G L RPD+S VDAV D WD+F SF A
Sbjct: 6   ETIIHGDCIEQMNALPEKSVDLIFADPPYNLQLGGDLLRPDNSKVDAVDDHWDQFESFAA 65

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YD FTR WL A RRVLK +G +WVIGSYHNIFR+G  +Q+L FWILNDIVWRKSNPMPNF
Sbjct: 66  YDKFTREWLKAARRVLKDDGAIWVIGSYHNIFRVGVAVQDLGFWILNDIVWRKSNPMPNF 125

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           +G RF NAHETLIWAS S  AK YTFNYDALK AN++VQMRSDW IP+C+G ER++  DG
Sbjct: 126 KGTRFANAHETLIWASKSQNAKRYTFNYDALKMANDEVQMRSDWTIPLCTGEERIKGADG 185

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
           +K HPTQKPEALL R+++S+TKPGD+ILDPFFG GT+GA AK+L R FIGIE + + ++ 
Sbjct: 186 QKAHPTQKPEALLYRVILSTTKPGDVILDPFFGVGTTGAAAKRLGRKFIGIEREAEDLEH 245

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADG 320
           A  RIA V P+   +L V+  KR EPRV F  +VE GL+ PG  L  ++G   A V  DG
Sbjct: 246 AKARIAKVVPIAPEDLDVMGSKRAEPRVPFGTIVEAGLLSPGDTLYCSKGTHVAKVRPDG 305

Query: 321 TLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVR 369
           ++  G   GSIH++GA V  +  CNGW +W+F+    L  I+ LR  VR
Sbjct: 306 SITVGDLSGSIHKIGALVQSAPACNGWTYWHFKTDAGLAPIDVLRAQVR 354


>gi|146276124|ref|YP_001166283.1| DNA methylase N-4/N-6 domain-containing protein [Rhodobacter
           sphaeroides ATCC 17025]
 gi|145554365|gb|ABP68978.1| DNA methylase N-4/N-6 domain protein [Rhodobacter sphaeroides ATCC
           17025]
          Length = 372

 Score =  451 bits (1159), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 208/352 (59%), Positives = 266/352 (75%), Gaps = 1/352 (0%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           ++I+ G+ I V+  LP  SVDLIFADPPYNLQL G L+RPD+S VDAV D WD+FSSF +
Sbjct: 16  NQILAGDCIEVMRSLPECSVDLIFADPPYNLQLRGDLHRPDNSRVDAVDDHWDQFSSFAS 75

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YD FTR WL A RR+LKPNG +WVIGSYHNIFR+G  LQ+  FWILND+VWRKSNPMPNF
Sbjct: 76  YDQFTREWLAAARRLLKPNGAIWVIGSYHNIFRVGAALQDQGFWILNDVVWRKSNPMPNF 135

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           +G+R  NAHETLIWAS    +K YTFNY+ALKA NE +QMRSDW+IPIC+G ERL+++ G
Sbjct: 136 KGKRLTNAHETLIWASKQEASK-YTFNYEALKALNEGIQMRSDWVIPICTGHERLKDEHG 194

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
           +K HPTQKPEALL R++V++T PGD++LDPFFG+GT+GAVAK L R FIGIE ++ Y  +
Sbjct: 195 DKAHPTQKPEALLHRVMVATTNPGDVVLDPFFGTGTTGAVAKMLGRDFIGIEREEGYRKV 254

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADG 320
           A +R++ V+      L V   KR EPRV F  LVERG+++PG+ L +      A V ADG
Sbjct: 255 AAERLSRVRRFDASALEVSGSKRAEPRVPFGQLVERGMLRPGEELYSMNNRHKAKVRADG 314

Query: 321 TLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           TLI     GSIH+VGA + G+ +CNGW +W +++ G++  I+ LR  +R E+
Sbjct: 315 TLIGNDVKGSIHQVGAALEGAPSCNGWTYWCYKREGKMIPIDILRQQIRAEM 366


>gi|294675758|ref|YP_003576373.1| adenine-specific DNA-methyltransferase [Rhodobacter capsulatus SB
           1003]
 gi|294474578|gb|ADE83966.1| site-specific DNA-methyltransferase (adenine-specific) [Rhodobacter
           capsulatus SB 1003]
          Length = 367

 Score =  451 bits (1159), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 207/352 (58%), Positives = 266/352 (75%), Gaps = 1/352 (0%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           ++I+ G+ I V+ +LP  SVDLIFADPPYNLQL G L+RPD+S VDAV D+WD+F SF+ 
Sbjct: 16  NEILAGDCIDVMNRLPEASVDLIFADPPYNLQLRGDLHRPDNSKVDAVDDAWDQFGSFDH 75

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YD FTR WL A +R+LKPNG +WVIGSYHN+FR+G  LQN  FWILND+VWRKSNPMPNF
Sbjct: 76  YDTFTRDWLAAAKRILKPNGAIWVIGSYHNVFRLGAELQNQGFWILNDVVWRKSNPMPNF 135

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           RG+R  NAHETLIWAS S  AK YTFNY+ALKA NE +QMRSDW++PIC+G+ERL++  G
Sbjct: 136 RGKRLTNAHETLIWASKSEGAK-YTFNYEALKALNEGIQMRSDWVLPICTGNERLKDDAG 194

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
           +K HPTQKPE+LL RI++ +T  GD++LDPFFG+GT+GAVAK L R FIGIE ++ Y + 
Sbjct: 195 DKAHPTQKPESLLHRIILGTTNAGDVVLDPFFGTGTTGAVAKMLGRDFIGIEREEAYREA 254

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADG 320
           A KRI  V+      L +   KR EPRV F  LVERG+++PG+ L +      A V ADG
Sbjct: 255 ARKRIDKVRKFDREALEITGSKRAEPRVPFGQLVERGMLRPGEELYSIGNRFKAKVRADG 314

Query: 321 TLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           TL+     GSIH+VGA + G+ +CNGW +W+F++ G++  I+ LR  +R E+
Sbjct: 315 TLVGNDVKGSIHQVGAHLEGAPSCNGWTYWHFKRDGKMVPIDLLRQQIRAEM 366


>gi|315498149|ref|YP_004086953.1| DNA methylase n-4/n-6 domain protein [Asticcacaulis excentricus CB
           48]
 gi|315416161|gb|ADU12802.1| DNA methylase N-4/N-6 domain protein [Asticcacaulis excentricus CB
           48]
          Length = 371

 Score =  450 bits (1158), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 202/351 (57%), Positives = 260/351 (74%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           D I  G  + +L+ LP KSVDL+FADPPYNLQL G L+RPD+S VDAV D WD+F+SFEA
Sbjct: 19  DTIHVGECVDILKSLPDKSVDLVFADPPYNLQLGGDLHRPDNSKVDAVDDEWDQFASFEA 78

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YD FTR W+  C+RVLK +G +WVIGSYHN+FR+G  LQ+L FW++ND++WRK+NPMPNF
Sbjct: 79  YDRFTREWMRECQRVLKDDGAIWVIGSYHNVFRLGVALQDLGFWVMNDVIWRKANPMPNF 138

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           +G RF NAHETLIWA+ +   K YTFNYDALKA NED QMRSDW IP+C+G ERL+++DG
Sbjct: 139 KGTRFTNAHETLIWATKAKGQKRYTFNYDALKAFNEDTQMRSDWAIPLCTGEERLKDEDG 198

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
            K+HPTQKPE+LL R+L++ +KPG ++LDPFFG+GT+GA AK+L R FIGIE  + Y   
Sbjct: 199 NKVHPTQKPESLLYRVLLACSKPGHVVLDPFFGTGTTGAAAKRLGRHFIGIERDETYAKH 258

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADG 320
           A +RIA VQ     +L  +  K+ EPRV F  LVE GL+QPG  L   +G  +A V ADG
Sbjct: 259 ARERIARVQRANESDLATMGSKKAEPRVPFGALVEAGLLQPGDTLYCPKGQRTARVRADG 318

Query: 321 TLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKE 371
           +L+ G   GSIH+VGA +  + +CNGW FW F+       I+ LR  +R++
Sbjct: 319 SLVHGELTGSIHKVGAMLEQAPSCNGWTFWRFKTDAGFKPIDDLRARIRQQ 369


>gi|77462007|ref|YP_351511.1| site-specific DNA-methyltransferase [Rhodobacter sphaeroides 2.4.1]
 gi|126460897|ref|YP_001042011.1| DNA methylase N-4/N-6 domain-containing protein [Rhodobacter
           sphaeroides ATCC 17029]
 gi|221640958|ref|YP_002527220.1| DNA methylase N-4/N-6 domain-containing protein [Rhodobacter
           sphaeroides KD131]
 gi|332559934|ref|ZP_08414256.1| DNA methylase N-4/N-6 domain protein [Rhodobacter sphaeroides WS8N]
 gi|77386425|gb|ABA77610.1| Site-specific DNA-methyltransferase [Rhodobacter sphaeroides 2.4.1]
 gi|126102561|gb|ABN75239.1| DNA methylase N-4/N-6 domain protein [Rhodobacter sphaeroides ATCC
           17029]
 gi|221161739|gb|ACM02719.1| DNA methylase N-4/N-6 domain protein [Rhodobacter sphaeroides
           KD131]
 gi|332277646|gb|EGJ22961.1| DNA methylase N-4/N-6 domain protein [Rhodobacter sphaeroides WS8N]
          Length = 372

 Score =  450 bits (1158), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 209/352 (59%), Positives = 264/352 (75%), Gaps = 1/352 (0%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           ++I+ G+ I  +  LP  SVDLIFADPPYNLQL G L+RPD+S VDAV D WD+FSSF  
Sbjct: 16  NQILAGDCIETMRSLPECSVDLIFADPPYNLQLRGDLHRPDNSRVDAVDDHWDQFSSFSV 75

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YD FTR WL A RR+LKPNG +WVIGSYHNIFR+G  LQ+  FWILND+VWRKSNPMPNF
Sbjct: 76  YDQFTREWLAAARRLLKPNGAIWVIGSYHNIFRVGAALQDQGFWILNDVVWRKSNPMPNF 135

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           +G+R  NAHETLIWAS    +K YTFNY+ALKA NE VQMRSDW+IPIC+G ERL+++ G
Sbjct: 136 KGKRLTNAHETLIWASKQEASK-YTFNYEALKALNEGVQMRSDWVIPICTGHERLKDEQG 194

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
           +K HPTQKPEALL R++V++T PGD++LDPFFG+GT+GAVAK L R FIGIE ++ Y  I
Sbjct: 195 DKAHPTQKPEALLHRVMVATTNPGDVVLDPFFGTGTTGAVAKMLGRDFIGIEREESYRRI 254

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADG 320
           A +R++ V+      L V   KR EPRV F  LVERG+++PG+ L +      A V ADG
Sbjct: 255 AAERLSRVRRYDASALEVSGSKRAEPRVPFGQLVERGMLRPGEELYSMNNRHKAKVRADG 314

Query: 321 TLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           TLI     GSIH+VGA + G+ +CNGW +W +++ G++  I+ LR  +R E+
Sbjct: 315 TLIGNDVKGSIHQVGAALEGAPSCNGWTYWCYKREGKMIPIDILRQQIRAEM 366


>gi|329114180|ref|ZP_08242942.1| Modification methylase SmeI [Acetobacter pomorum DM001]
 gi|326696256|gb|EGE47935.1| Modification methylase SmeI [Acetobacter pomorum DM001]
          Length = 367

 Score =  449 bits (1154), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 201/345 (58%), Positives = 261/345 (75%), Gaps = 1/345 (0%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           D+I++G  +  +  LP+ SVD +FADPPYNLQL G+L RPD +LVD V D WDKFS  E 
Sbjct: 14  DQILRGECVETMRSLPSGSVDCVFADPPYNLQLRGELRRPDDTLVDGVDDDWDKFSDLEE 73

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YD FTRAWL   RRVL  +GT+WVIGSYHNI+RIG +LQ+L FWILNDIVWRKSNPMPNF
Sbjct: 74  YDRFTRAWLAEARRVLHKDGTIWVIGSYHNIYRIGAILQDLGFWILNDIVWRKSNPMPNF 133

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           RGRRF NAHETLIWA+    ++ Y FNY A+KA N+DVQMRSDW +P+C+G+ERLRN+ G
Sbjct: 134 RGRRFTNAHETLIWAARGQDSR-YRFNYQAMKALNDDVQMRSDWYLPLCTGNERLRNEHG 192

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
            KLHPTQKPE+LL R+L++ST   D+ILDPF G+GT+ A+A++LRR FIGIE   DY++ 
Sbjct: 193 LKLHPTQKPESLLHRVLLASTTVNDVILDPFSGTGTTAAMARRLRRHFIGIERHPDYVEA 252

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADG 320
           A  R+A+  PL    +     KR  PR+ F  LVE+G+I  G ++ + +  + ATV  DG
Sbjct: 253 AMARVAAETPLEADAVQTTQDKREAPRIPFGSLVEQGVIAAGTVVCDKKRRVHATVSPDG 312

Query: 321 TLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLR 365
           TL++GT+ GSIH++GA+++ + +CNGW FWYFE+ GEL  ++ LR
Sbjct: 313 TLVNGTKRGSIHKLGAQLTNAPSCNGWTFWYFERAGELLQLDVLR 357


>gi|163796460|ref|ZP_02190420.1| DNA methylase N-4/N-6 [alpha proteobacterium BAL199]
 gi|159178310|gb|EDP62854.1| DNA methylase N-4/N-6 [alpha proteobacterium BAL199]
          Length = 370

 Score =  449 bits (1154), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 204/348 (58%), Positives = 265/348 (76%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           +I+ G+ I  L  LP +SVDLIFADPPYNLQL G+L RP+++ VD V D+WD+F  FEAY
Sbjct: 11  RILTGDCIEELRSLPDRSVDLIFADPPYNLQLGGELLRPNNTRVDGVDDAWDRFGGFEAY 70

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFR 141
           D F RAWL  CRRVLK  GTLWVIGSYHNIFR+G ++Q+L FW+LND++WRK+NPMPNFR
Sbjct: 71  DKFCRAWLGECRRVLKDTGTLWVIGSYHNIFRVGAIVQDLGFWMLNDVIWRKANPMPNFR 130

Query: 142 GRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGE 201
           G+RF NAHETLIWA+ S  ++ YTFNYDA+KA N+D QMRSDW +P+C+G+ERL+ +DG 
Sbjct: 131 GKRFTNAHETLIWAARSEDSRRYTFNYDAMKALNDDQQMRSDWFLPLCTGAERLKAEDGS 190

Query: 202 KLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIA 261
           K HPTQKPE+LL+R+L+++++PGDI+LDPFFG+GT+GAVAK+L R +IGIE    Y  IA
Sbjct: 191 KAHPTQKPESLLARVLLAASRPGDIVLDPFFGTGTTGAVAKRLGRRWIGIERDPGYAAIA 250

Query: 262 TKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGT 321
           +KRIA V+ + +     L  +R +PRV F  LVE GLI+PG++L +++    A V ADG 
Sbjct: 251 SKRIAEVEAVDDPMALALANRREQPRVPFGRLVEEGLIRPGEVLFDSRRRWFAKVRADGH 310

Query: 322 LISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVR 369
           LIS +  GSIH VGA V G+  CNGW FW+ E+ G    I+  R  +R
Sbjct: 311 LISESHKGSIHSVGAAVQGAPACNGWTFWHAERKGMPLPIDVFRQQIR 358


>gi|254450082|ref|ZP_05063519.1| modification methylase [Octadecabacter antarcticus 238]
 gi|198264488|gb|EDY88758.1| modification methylase [Octadecabacter antarcticus 238]
          Length = 373

 Score =  448 bits (1153), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 207/350 (59%), Positives = 262/350 (74%), Gaps = 1/350 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II G+ I V+  LP  SVDLIFADPPYNLQL G L+RPD+S VDAV + WD+F SF+ YD
Sbjct: 22  IIDGDCIEVMNSLPEGSVDLIFADPPYNLQLKGDLHRPDNSKVDAVDNDWDQFESFKVYD 81

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            FT AWL A RR+LKP+G +WVIGSYHN+FR+GT LQN  FWILND+VWRKSNPMPNFRG
Sbjct: 82  DFTHAWLKAARRILKPDGAIWVIGSYHNVFRMGTELQNQGFWILNDVVWRKSNPMPNFRG 141

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +R  NAHETLIWAS + K+K  TFNY+ALKA NE +QMRSDW++PIC+G ERL+N  G+K
Sbjct: 142 KRLTNAHETLIWASKAEKSKP-TFNYEALKALNEGIQMRSDWVLPICTGHERLKNDQGDK 200

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKPE+LL R+L+ +T PGD++LDPFFG+GT+GAVAK L R +IGIE + +Y  +A 
Sbjct: 201 AHPTQKPESLLHRVLLGTTNPGDVVLDPFFGTGTTGAVAKMLGRDYIGIEREAEYRAVAE 260

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           KR+A ++   +  L V   KR EPRV F  +VERG+++PG+ L +  G   A V ADGTL
Sbjct: 261 KRLAKIRKFDSEALEVTQSKRAEPRVPFGQVVERGMLRPGEELWSMNGRHKAKVRADGTL 320

Query: 323 ISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           I     GSIH+VGA    + +CNGW +W+F + G+   I+ LR  +R E+
Sbjct: 321 IGADAKGSIHQVGAACEKAPSCNGWTYWHFRRDGKTVPIDLLRQQIRSEM 370


>gi|260574051|ref|ZP_05842056.1| DNA methylase N-4/N-6 domain protein [Rhodobacter sp. SW2]
 gi|259023517|gb|EEW26808.1| DNA methylase N-4/N-6 domain protein [Rhodobacter sp. SW2]
          Length = 375

 Score =  448 bits (1153), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 206/352 (58%), Positives = 266/352 (75%), Gaps = 1/352 (0%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           ++I++G+ I+ +  LPA S+DLIFADPPYNLQL G L+RPD+SLVDAV D WD+FSSF A
Sbjct: 16  NQILEGDCIAAMNGLPAASIDLIFADPPYNLQLKGDLHRPDNSLVDAVDDHWDQFSSFAA 75

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YD FT  WL A RR+LKPNG +WVIGSYHNIFR+G  LQ+  FW+LND+VWRKSNPMPNF
Sbjct: 76  YDKFTHDWLAAARRLLKPNGAIWVIGSYHNIFRVGAALQDQGFWLLNDVVWRKSNPMPNF 135

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           RG+R  NAHETLIWAS    +K YTFNY+ALKA N+ VQMRSDW++PIC+G ERL++  G
Sbjct: 136 RGKRLTNAHETLIWASKEEASK-YTFNYEALKALNDGVQMRSDWVLPICTGHERLKDAAG 194

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
           +K HPTQKPE+LL RIL+++T PGD++LDPFFG+GT+GAVAK L R FIGIE ++ Y   
Sbjct: 195 DKAHPTQKPESLLHRILLATTNPGDVVLDPFFGTGTTGAVAKMLGRDFIGIEREEIYRQA 254

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADG 320
           AT+R++ V+      L     KR EPRV F  +VERG+++PG+ L +        V ADG
Sbjct: 255 ATERLSRVRRFDATGLETTGSKRAEPRVPFGQVVERGMLRPGEELFSLGNRFKVKVRADG 314

Query: 321 TLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           TLI     GSIH+VGA + G+ +CNGW +W+F++ G++  I+ LR  +R E+
Sbjct: 315 TLIGNDVKGSIHQVGAALEGAPSCNGWTYWHFKRDGKMVPIDILRQQIRAEM 366


>gi|217977761|ref|YP_002361908.1| DNA methylase N-4/N-6 domain protein [Methylocella silvestris BL2]
 gi|217503137|gb|ACK50546.1| DNA methylase N-4/N-6 domain protein [Methylocella silvestris BL2]
          Length = 379

 Score =  447 bits (1151), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 208/352 (59%), Positives = 259/352 (73%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           ++I+ G+ +  L +LPA SVD +FADPPYNLQL   L RPD SLVDAV D WDKF SF  
Sbjct: 23  NEILIGDCLEQLARLPAASVDAVFADPPYNLQLESTLSRPDQSLVDAVNDDWDKFDSFSH 82

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YD+F+R+WL A RRV+KP  TL+VIGSYHNIFR+G+ LQ+  FWILNDIVWRK+NPMPNF
Sbjct: 83  YDSFSRSWLKAVRRVMKPEATLFVIGSYHNIFRVGSTLQDEGFWILNDIVWRKANPMPNF 142

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           RGRRF NAHETLIWA+    AK Y FNY+ LKA NED Q+RSDWL PIC+G+ERL+  DG
Sbjct: 143 RGRRFTNAHETLIWAAKDSAAKNYRFNYELLKAGNEDCQLRSDWLFPICTGAERLKGSDG 202

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
            K HPTQKPEALL+RIL+++T PGD++LDPFFGSGT+GA AK+L R F+GIE  + Y   
Sbjct: 203 RKTHPTQKPEALLARILIAATNPGDVVLDPFFGSGTTGAAAKRLGRHFVGIERDKTYAAA 262

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADG 320
           A  RI +V+ L    + +   KRTEPRVAF+ +VE GLI PG  L + +    ATV ADG
Sbjct: 263 ARARIDAVETLPEAAIALTPSKRTEPRVAFSAIVEAGLIAPGDSLVDDKQRHRATVRADG 322

Query: 321 TLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
            +  G  +GSIH++GA   G   CNGW +W+F + G+L  I+ LR + R +L
Sbjct: 323 AITLGPVVGSIHKIGALAQGLPACNGWTYWHFAQGGKLQPIDALRTVARGKL 374


>gi|258542065|ref|YP_003187498.1| DNA methyltransferase [Acetobacter pasteurianus IFO 3283-01]
 gi|256633143|dbj|BAH99118.1| DNA methyltransferase [Acetobacter pasteurianus IFO 3283-01]
 gi|256636200|dbj|BAI02169.1| DNA methyltransferase [Acetobacter pasteurianus IFO 3283-03]
 gi|256639255|dbj|BAI05217.1| DNA methyltransferase [Acetobacter pasteurianus IFO 3283-07]
 gi|256642309|dbj|BAI08264.1| DNA methyltransferase [Acetobacter pasteurianus IFO 3283-22]
 gi|256645364|dbj|BAI11312.1| DNA methyltransferase [Acetobacter pasteurianus IFO 3283-26]
 gi|256648419|dbj|BAI14360.1| DNA methyltransferase [Acetobacter pasteurianus IFO 3283-32]
 gi|256651472|dbj|BAI17406.1| DNA methyltransferase [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256654463|dbj|BAI20390.1| DNA methyltransferase [Acetobacter pasteurianus IFO 3283-12]
          Length = 367

 Score =  447 bits (1150), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 200/345 (57%), Positives = 261/345 (75%), Gaps = 1/345 (0%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           D+I++G  +  +  LP+ SVD +FADPPYNLQL G+L RPD +LVD V D WDKFS  E 
Sbjct: 14  DQILRGECVETMRSLPSGSVDCVFADPPYNLQLRGELRRPDDTLVDGVDDDWDKFSDLEE 73

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YD FTRAWL   RRVL  +GT+WVIGSYHNI+RIG +LQ+L FWILNDIVWRKSNPMPNF
Sbjct: 74  YDRFTRAWLAEARRVLHKDGTIWVIGSYHNIYRIGAILQDLGFWILNDIVWRKSNPMPNF 133

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           RGRRF NAHETLIWA+    ++ Y FNY A+KA N+DVQMRSDW +P+C+G+ERLRN+ G
Sbjct: 134 RGRRFTNAHETLIWAARGQDSR-YRFNYQAMKALNDDVQMRSDWYLPLCTGNERLRNEHG 192

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
            KLHPTQKPE+LL R+L++ST   D+ILDPF G+GT+ A+A++LRR FIGIE   DY++ 
Sbjct: 193 LKLHPTQKPESLLHRVLLASTTVNDVILDPFSGTGTTAAMARRLRRHFIGIERHPDYVEA 252

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADG 320
           A  R+A+  PL    +     KR  PR+ F  LVE+G+I  G ++ + +  + ATV  DG
Sbjct: 253 AMARVAAETPLEADAVQTTQDKREAPRIPFGSLVEQGVIAAGTVVCDKKRRVHATVSPDG 312

Query: 321 TLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLR 365
           TL++GT+ GSIH++GA+++ + +CNGW FW+FE+ GEL  ++ LR
Sbjct: 313 TLVNGTKRGSIHKLGAQLTNAPSCNGWTFWHFERAGELLQLDVLR 357


>gi|126724760|ref|ZP_01740603.1| Site-specific DNA-methyltransferase [Rhodobacterales bacterium
           HTCC2150]
 gi|126705924|gb|EBA05014.1| Site-specific DNA-methyltransferase [Rhodobacterales bacterium
           HTCC2150]
          Length = 345

 Score =  446 bits (1148), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 204/341 (59%), Positives = 260/341 (76%), Gaps = 1/341 (0%)

Query: 32  LEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLA 91
           +  LP  SVDLIFADPPYNLQL G L+RPD+S VDAV D WD+F SF  YD F+ AWL A
Sbjct: 1   MNALPENSVDLIFADPPYNLQLKGDLHRPDNSKVDAVDDHWDQFDSFRVYDEFSNAWLKA 60

Query: 92  CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHET 151
            +R+LKP+G +WVIGSYHNIFR+GT +QN  FW+LND++WRKSNPMPNFRG+RF NAHET
Sbjct: 61  AQRILKPDGAIWVIGSYHNIFRVGTAMQNAGFWMLNDVIWRKSNPMPNFRGKRFTNAHET 120

Query: 152 LIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPEA 211
           LIWAS + K+K  TFNY+ALKA NE +QMRSDW++P+C+G ERL+N+DG+K HPTQKPE+
Sbjct: 121 LIWASKTEKSKP-TFNYEALKALNEGIQMRSDWVLPLCTGHERLKNEDGDKAHPTQKPES 179

Query: 212 LLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPL 271
           LL R+LV++T PGD++LDPFFG+GT+GAVAKKL R FIGIE +++Y  +AT R+  V+  
Sbjct: 180 LLHRVLVATTNPGDVVLDPFFGTGTTGAVAKKLGRDFIGIEREEEYRKVATARLRDVRKY 239

Query: 272 GNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTLISGTELGSI 331
               L V   KR EPRV F  +VERG++ PG+ L +  G   A V ADGTLI     GSI
Sbjct: 240 DRSSLEVTQSKRAEPRVPFGQIVERGMLNPGENLFSLNGRHKAKVRADGTLIGDDVKGSI 299

Query: 332 HRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           H+VGA + G+ +CNGW +W ++  G++  I+ LR  VR E+
Sbjct: 300 HQVGAALEGAPSCNGWTYWGYKSEGKMVPIDLLRQQVRAEM 340


>gi|83950882|ref|ZP_00959615.1| modification methylase [Roseovarius nubinhibens ISM]
 gi|83838781|gb|EAP78077.1| modification methylase [Roseovarius nubinhibens ISM]
          Length = 371

 Score =  446 bits (1148), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 208/350 (59%), Positives = 260/350 (74%), Gaps = 1/350 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           I+ G+ I V+  LP  SVDLIFADPPYNLQL G+L+RPD+S VDAV D+WD+FSSF AYD
Sbjct: 18  ILSGDCIEVMNSLPEASVDLIFADPPYNLQLKGELHRPDNSQVDAVDDAWDQFSSFAAYD 77

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            FT  WL A RR+LKPNG +WVIGSYHNIFR+G  LQN  FWILND+VWRKSNPMPNFRG
Sbjct: 78  KFTTEWLRAARRLLKPNGAIWVIGSYHNIFRVGASLQNEGFWILNDVVWRKSNPMPNFRG 137

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +R  NAHET+IWAS     K YTFNY+ALK+ NE +QMRSDW++PIC+G ERL++ +G+K
Sbjct: 138 KRLTNAHETMIWASKEEGGK-YTFNYEALKSLNEGIQMRSDWVLPICTGHERLKDANGDK 196

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKPE+LL RILV ST PGD++LDPFFG+GT+GAVAK L R +IGIE +  Y ++A 
Sbjct: 197 AHPTQKPESLLHRILVGSTNPGDVVLDPFFGTGTTGAVAKMLGRDYIGIEREAAYREVAE 256

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           KR+A V+      L V   KR EPRV F  L+ERG+++PG+ L +      A V ADGTL
Sbjct: 257 KRLAKVRKYDREALQVSQSKRAEPRVPFGQLIERGMLRPGENLYSMNLRHKAKVRADGTL 316

Query: 323 ISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           I     GSIH+VGA + G+ +CNGW +W  ++ G+   I+  R  +R E+
Sbjct: 317 IGDDIKGSIHQVGAALEGAPSCNGWTYWCIKRDGKQVPIDVFRQQIRAEM 366


>gi|94497422|ref|ZP_01303992.1| DNA methylase N-4/N-6 [Sphingomonas sp. SKA58]
 gi|94423053|gb|EAT08084.1| DNA methylase N-4/N-6 [Sphingomonas sp. SKA58]
          Length = 391

 Score =  446 bits (1147), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 201/345 (58%), Positives = 265/345 (76%), Gaps = 2/345 (0%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           D +++G+ I+ +  LP K +D+IFADPPYNLQL G L+RP+ S VDAV + WDKF +  +
Sbjct: 40  DTLLRGDCIAQMAALPDKCIDMIFADPPYNLQLGGDLFRPEGSRVDAVDNDWDKFDTLGS 99

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YD FT+AWL   RR+LKPNGT+WVIGSYHNIFR+G+ LQ+  FWILNDI+WRK+NPMPNF
Sbjct: 100 YDRFTKAWLREARRILKPNGTIWVIGSYHNIFRVGSALQDEGFWILNDIIWRKANPMPNF 159

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           +G RF NAHETLIWAS    AK YTFNY A+K  N+++QMRSDW++PIC G ERL+ ++G
Sbjct: 160 KGTRFTNAHETLIWASQGEDAK-YTFNYKAMKTLNDELQMRSDWVLPICGGQERLK-RNG 217

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
            K HPTQKPE+LL R+L+S TKPGD++LDPFFG+GT+GAVAK+L R +IGIE ++DYI++
Sbjct: 218 TKAHPTQKPESLLYRVLLSCTKPGDVVLDPFFGTGTTGAVAKRLGRRWIGIEREEDYIEV 277

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADG 320
           A +RIA   PL    LT++   R++P+VAF  LVE G ++PG ILT+ +    A V ADG
Sbjct: 278 ALERIADALPLDESALTIMQSARSQPKVAFGTLVETGYLKPGAILTDTKRRWQAQVRADG 337

Query: 321 TLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLR 365
           +L  G + GSIH++GA + G+ +CNGW FW++E  G L  I+ LR
Sbjct: 338 SLAVGADSGSIHKMGATLQGAPSCNGWTFWHYEAEGGLKPIDALR 382


>gi|296116693|ref|ZP_06835303.1| DNA methylase N-4/N-6 domain protein [Gluconacetobacter hansenii
           ATCC 23769]
 gi|295976905|gb|EFG83673.1| DNA methylase N-4/N-6 domain protein [Gluconacetobacter hansenii
           ATCC 23769]
          Length = 364

 Score =  446 bits (1147), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 200/351 (56%), Positives = 263/351 (74%), Gaps = 1/351 (0%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           D+I++G+ + +++ LPA S+D +FADPPYNLQL G+L RPD S+VD V D WDKF+  +A
Sbjct: 7   DQILRGDCVEMMQTLPAGSIDCVFADPPYNLQLRGELRRPDDSIVDGVDDDWDKFADLQA 66

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YD FTRAWL   RRVL+ +GT+WVIGSYHNIFRIG +LQ+L FWILND++WRKSNPMPNF
Sbjct: 67  YDRFTRAWLSEARRVLRKDGTIWVIGSYHNIFRIGAILQDLGFWILNDVIWRKSNPMPNF 126

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           RGRRF NAHETLIWA+  P ++ Y FNY A+KA N+DVQMRSDW +P+C+G ERLRN+ G
Sbjct: 127 RGRRFTNAHETLIWAARGPDSR-YRFNYQAMKALNDDVQMRSDWYLPLCTGGERLRNEHG 185

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
            KLHPTQKPE+LL R+L++ST   D++LDPF G+GT+ A+A++LRR FIGIE   DY + 
Sbjct: 186 LKLHPTQKPESLLHRVLIASTNVDDVVLDPFTGTGTTPAMARRLRRRFIGIERHPDYAEA 245

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADG 320
           A  R    +P+    +     +R  PR+ F  LVER ++ PG +L + Q  +SATV  DG
Sbjct: 246 AIGRARREKPVPLDSVLTTPARRECPRIPFGTLVERAILPPGTVLMDRQKRVSATVAPDG 305

Query: 321 TLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKE 371
           TLISG   GSIH++GA ++ + +CNGW FW+FE+ G L  ++ LR  +R E
Sbjct: 306 TLISGGHRGSIHKLGATLTNAPSCNGWTFWHFERAGVLQPLDILRNELRAE 356


>gi|312113930|ref|YP_004011526.1| DNA methylase N-4/N-6 domain protein [Rhodomicrobium vannielii ATCC
           17100]
 gi|311219059|gb|ADP70427.1| DNA methylase N-4/N-6 domain protein [Rhodomicrobium vannielii ATCC
           17100]
          Length = 373

 Score =  445 bits (1145), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 205/353 (58%), Positives = 272/353 (77%), Gaps = 2/353 (0%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           + I++G+ + +L ++P+ SVDL+FADPPYNLQL G+L RP+++ VD V  +WD+F+ F  
Sbjct: 16  EGILQGDCLDILRRMPSASVDLVFADPPYNLQLGGELLRPNNTRVDGVDHAWDRFADFAT 75

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YD F+RAWL  CRRVLKPNG LWVIG+YHNIFR+GT LQ+L FW++ND++W K+NPMPNF
Sbjct: 76  YDRFSRAWLSECRRVLKPNGALWVIGTYHNIFRLGTALQDLGFWMMNDVIWLKTNPMPNF 135

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           +G RF NAHETLIWA+   KA+  TFNYD++KA N+D+QMRSDWLIPICSG ERLR+  G
Sbjct: 136 KGTRFTNAHETLIWAARDEKAR-PTFNYDSMKAFNDDLQMRSDWLIPICSGPERLRDDGG 194

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
            K HPTQKPEALL+R+L+++TKPGD++LDPFFG+GT+GAVAK LRR FIGIE   DY+  
Sbjct: 195 RKAHPTQKPEALLARVLMATTKPGDLVLDPFFGTGTTGAVAKLLRRRFIGIERDPDYVAA 254

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADG 320
           A+ RIA+++P       ++T KR EPRV F +++ERG+++PG +L +A+  I A V AD 
Sbjct: 255 ASARIAAIEPCDAKAAALITSKRAEPRVPFGMVLERGMLRPGDVLFDAKAEIRAQVMADA 314

Query: 321 TLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGE-LHSINTLRILVRKEL 372
           +L+     GSIH VGAK  G   CNGW FW+FE+  + L  I+ LR+ VRK +
Sbjct: 315 SLMWNGTRGSIHSVGAKAQGRGACNGWTFWHFEQPKDGLAPIDLLRMEVRKTM 367


>gi|330993888|ref|ZP_08317820.1| Modification methylase SmeI [Gluconacetobacter sp. SXCC-1]
 gi|329759156|gb|EGG75668.1| Modification methylase SmeI [Gluconacetobacter sp. SXCC-1]
          Length = 362

 Score =  445 bits (1144), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 203/351 (57%), Positives = 265/351 (75%), Gaps = 1/351 (0%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           D++++G+ + +++ LPA S+D +FADPPYNLQL G+L RPD S+VD V D WDKF+  +A
Sbjct: 7   DQVLRGDCVEMMKTLPAASIDCVFADPPYNLQLKGELRRPDDSIVDGVDDDWDKFTDLQA 66

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YDAFTRAWL   RRVL+ +GT+WVIGSYHNIFRIG +LQ+L FWILND++WRKSNPMPNF
Sbjct: 67  YDAFTRAWLTEARRVLRKDGTIWVIGSYHNIFRIGAILQDLGFWILNDVIWRKSNPMPNF 126

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           RGRRF NAHETLIWA+    ++ Y FNY A+KA N+DVQMRSDW +P+C+G ERLRN+ G
Sbjct: 127 RGRRFTNAHETLIWAARGADSR-YRFNYQAMKALNDDVQMRSDWYLPLCTGGERLRNEHG 185

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
            KLHPTQKPE+LL R+LV+ST   D++LDPF G+GT+ A+A++LRR FIGIE   DY + 
Sbjct: 186 LKLHPTQKPESLLHRVLVASTNVDDVVLDPFTGTGTTTAMARRLRRRFIGIERHPDYAEA 245

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADG 320
           A  R    +PL    +     +R  PRV F LLVERG++  G +L + Q  + ATV  DG
Sbjct: 246 AIGRARREKPLPLDSVQTTPARRESPRVPFGLLVERGMVPAGTVLMDRQKRVRATVSPDG 305

Query: 321 TLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKE 371
           TL+SG   GSIH++GA+++ + +CNGW FWYFE+ GEL  ++ LR  +R E
Sbjct: 306 TLVSGRHRGSIHKMGAQLTNAPSCNGWTFWYFEREGELVQLDVLRGDIRAE 356


>gi|302383800|ref|YP_003819623.1| DNA methylase N-4/N-6 domain protein [Brevundimonas subvibrioides
           ATCC 15264]
 gi|302194428|gb|ADL02000.1| DNA methylase N-4/N-6 domain protein [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 359

 Score =  444 bits (1142), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 205/349 (58%), Positives = 257/349 (73%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           D I +G+ + +L  LP +SVD++FADPPYNLQL G L RPD+S VDAV D WDKF SF A
Sbjct: 7   DIIHRGDCLEILRGLPDRSVDMVFADPPYNLQLGGDLLRPDNSKVDAVDDDWDKFDSFAA 66

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YDAF R WL  CRRVLK  G+LWVIGSYHNIFR+GT +Q++ +W+LNDIVWRK+NPMPNF
Sbjct: 67  YDAFCRDWLKECRRVLKDEGSLWVIGSYHNIFRLGTAIQDIGYWVLNDIVWRKTNPMPNF 126

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           +G RF NAHETLIWA+ S + K YTFNYDALKA NED QMRSDW   +C+G ER++ +DG
Sbjct: 127 KGTRFTNAHETLIWAAKSREQKRYTFNYDALKAFNEDTQMRSDWTFALCTGEERIKGEDG 186

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
           +K HPTQKPEALL R+++++T+PGD+ILDPFFG+GT+GA AK+L R +IGIE   +Y ++
Sbjct: 187 KKAHPTQKPEALLHRVILAATRPGDVILDPFFGTGTTGAAAKRLGRHYIGIERDPEYANV 246

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADG 320
           A KRI +V P    +L V   KR E +V F  LVE GL+ PG +L   +G   A V ADG
Sbjct: 247 AEKRIKAVLPARPEDLIVTGSKRAEVKVPFGALVEAGLLSPGDVLYCPKGEREARVRADG 306

Query: 321 TLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVR 369
           +L+SG   GSIH++GA    +  CNGW +W F     L SI+ LR  VR
Sbjct: 307 SLVSGAMSGSIHKLGALFENAPACNGWTYWRFRTDTGLRSIDALRAEVR 355


>gi|294012714|ref|YP_003546174.1| putative adenine-specific DNA-methyltransferase [Sphingobium
           japonicum UT26S]
 gi|292676044|dbj|BAI97562.1| putative adenine-specific DNA-methyltransferase [Sphingobium
           japonicum UT26S]
          Length = 371

 Score =  444 bits (1142), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 201/345 (58%), Positives = 265/345 (76%), Gaps = 2/345 (0%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           D++++G+ I+ + KLP   +D+IFADPPYNLQL G L+RP+   VDAV + WDKF +  +
Sbjct: 20  DRLLRGDCIAEMAKLPDACIDMIFADPPYNLQLGGDLFRPEGGRVDAVDNDWDKFDTLGS 79

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YD FT+AWL   RR+LKPNGT+WVIGSYHNIFR+GT LQ+  FWILNDIVWRKSNPMPNF
Sbjct: 80  YDRFTKAWLREARRILKPNGTIWVIGSYHNIFRVGTALQDEGFWILNDIVWRKSNPMPNF 139

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           +G RF NAHETLIWAS    AK YTFNY A+K  N+++QMRSDW++PIC G ERL+ ++G
Sbjct: 140 KGTRFTNAHETLIWASQGEDAK-YTFNYKAMKTLNDELQMRSDWVLPICGGQERLK-RNG 197

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
            K HPTQKPEALL R+L++ T+PGD++LDPFFG+GT+GAVAK+L R +IGIE ++DYI++
Sbjct: 198 TKAHPTQKPEALLYRVLLACTRPGDVVLDPFFGTGTTGAVAKRLGRRWIGIEREEDYIEV 257

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADG 320
           A +RI +  PL    LT++   + +P+VAF  LVE G +QPG +LT+++    A V ADG
Sbjct: 258 ALERIEAALPLDESALTIMQSAKAQPKVAFGTLVETGYLQPGAVLTDSKRRWQAVVRADG 317

Query: 321 TLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLR 365
           +L  GT+ GSIH++GA + G+ +CNGW FW+ E  G L  I+ LR
Sbjct: 318 SLSVGTDTGSIHKMGATLQGAPSCNGWTFWHCEVEGVLKPIDALR 362


>gi|148557470|ref|YP_001265052.1| DNA methylase N-4/N-6 domain-containing protein [Sphingomonas
           wittichii RW1]
 gi|148502660|gb|ABQ70914.1| DNA methylase N-4/N-6 domain protein [Sphingomonas wittichii RW1]
          Length = 382

 Score =  444 bits (1141), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 204/346 (58%), Positives = 263/346 (76%), Gaps = 2/346 (0%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           ++I++G+ I  +  LP + VD+IFADPPYNLQL G L+RPD S VDAV D WDKF +F A
Sbjct: 29  NEILRGDCIETMRALPDRCVDMIFADPPYNLQLGGDLHRPDGSQVDAVDDDWDKFDTFAA 88

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YD FTR WL    R+LK +GT+WVIGSYHNIFR+GT LQ+  FW+LNDIVWRK+NPMPNF
Sbjct: 89  YDRFTRDWLREAHRILKDDGTIWVIGSYHNIFRVGTALQDQGFWVLNDIVWRKANPMPNF 148

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           +G RF NAHETLIW S + KAK YTFNY  +KA N+DVQMRSDW +PICSG ERL++ DG
Sbjct: 149 KGTRFTNAHETLIWCSKAEKAK-YTFNYRTMKALNDDVQMRSDWTLPICSGGERLKDDDG 207

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
            K HPTQKPE+LL R++++ T+PGD++LDPFFG+GT+GAVA++L R +IGIE +  YI +
Sbjct: 208 HKAHPTQKPESLLYRVMLACTEPGDLVLDPFFGTGTTGAVARRLGRRWIGIEREDKYIKV 267

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADG 320
           AT+RIA+  PL    +  +  K+  PR+AF LLVE GLI PG ++T+A+   SATV ADG
Sbjct: 268 ATQRIAATLPLDESAMMSIPEKKAMPRIAFGLLVEGGLIPPGSVVTDARRRWSATVRADG 327

Query: 321 TLISGT-ELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLR 365
            L SG   +GSIHR+GA++  + +CNGW+FW+ E    L  I+ +R
Sbjct: 328 MLASGCGAIGSIHRLGAQLQKAPSCNGWSFWHIETAQGLEPIDAVR 373


>gi|114328523|ref|YP_745680.1| adenine-specific methyltransferase [Granulibacter bethesdensis
           CGDNIH1]
 gi|114316697|gb|ABI62757.1| adenine-specific methyltransferase [Granulibacter bethesdensis
           CGDNIH1]
          Length = 385

 Score =  444 bits (1141), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 202/345 (58%), Positives = 261/345 (75%), Gaps = 1/345 (0%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           D+++ G+ + V++ LP  SVD IFADPPYNLQL G+L RPD S+VD V D WD+F+ + A
Sbjct: 19  DQVLLGDCVQVMQMLPTGSVDCIFADPPYNLQLRGELRRPDESIVDGVDDDWDRFTDYAA 78

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YDAF+RAWL  CRR+L+ +GT+WVIG+YHNIFR+GT+LQ+L FWILND+VWRK+NPMPNF
Sbjct: 79  YDAFSRAWLTECRRLLRKDGTIWVIGAYHNIFRLGTILQDLGFWILNDVVWRKANPMPNF 138

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           RGRRF NAHETLIWA+    ++ + FNY A+K  N+DVQMRSDW +P+C+GSER+RN  G
Sbjct: 139 RGRRFTNAHETLIWAARGQDSR-HRFNYQAMKTLNDDVQMRSDWFLPLCTGSERMRNDHG 197

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
            KLHPTQKPE+LL R+L+SST PGD++LDPF G+GTS AVAK+L+RSFIGIE    Y + 
Sbjct: 198 LKLHPTQKPESLLYRVLLSSTVPGDVVLDPFLGTGTSAAVAKRLQRSFIGIERHPAYAEA 257

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADG 320
           A  R+ SV+P     L ++  +R + RV F  LVE+GL+  G IL +    +SA V ADG
Sbjct: 258 AIGRLRSVEPAPLDNLNIMPSRREQKRVPFGSLVEQGLLPMGSILMDRLRRVSALVQADG 317

Query: 321 TLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLR 365
           ++ SG   GSIH+VGA V  + +CNGW FW+FE  GE   I+ LR
Sbjct: 318 SIASGAHRGSIHQVGAAVQNAPSCNGWTFWFFELRGEWVPIDVLR 362


>gi|254436719|ref|ZP_05050213.1| DNA methylase domain protein [Octadecabacter antarcticus 307]
 gi|198252165|gb|EDY76479.1| DNA methylase domain protein [Octadecabacter antarcticus 307]
          Length = 373

 Score =  443 bits (1139), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 204/350 (58%), Positives = 261/350 (74%), Gaps = 1/350 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           I+ G+ I V+  LP  SVDLIFADPPYNLQL G L+RPD+S VDAV + WD+F+SF+ YD
Sbjct: 22  ILDGDCIEVMNSLPEGSVDLIFADPPYNLQLKGDLHRPDNSKVDAVDNDWDQFASFKVYD 81

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            FT AWL A RR+LK +G +WVIGSYHN+FR+GT LQN  FWILND+VWRKSNPMPNFRG
Sbjct: 82  DFTHAWLKAARRILKKDGAIWVIGSYHNVFRMGTELQNQGFWILNDVVWRKSNPMPNFRG 141

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +R  NAHETLIWAS S  +K  TFNY+ALKA NE +QMRSDW++PIC+G ERL+N  G+K
Sbjct: 142 KRLTNAHETLIWASKSETSKP-TFNYEALKALNEGIQMRSDWVLPICTGHERLKNDQGDK 200

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKPE+LL R+L+ +T PGD++LDPFFG+GT+GAVAK L R +IGIE + +Y  +A 
Sbjct: 201 AHPTQKPESLLHRVLLGTTNPGDVVLDPFFGTGTTGAVAKMLGRDYIGIEREAEYRAVAA 260

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           +R+A ++   +  L V   KR EPRV F  +VERG+++PG+ L +  G   A V ADGTL
Sbjct: 261 RRLAKIRKFDSEALEVTQSKRAEPRVPFGQVVERGMLRPGEELWSMNGRHKAKVRADGTL 320

Query: 323 ISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           I     GSIH+VGA    + +CNGW +W+F + G+   I+ LR  +R E+
Sbjct: 321 IGADAKGSIHQVGAACENAPSCNGWTYWHFRRDGKKVPIDLLRQQIRSEM 370


>gi|220921468|ref|YP_002496769.1| DNA methylase N-4/N-6 domain-containing protein [Methylobacterium
           nodulans ORS 2060]
 gi|219946074|gb|ACL56466.1| DNA methylase N-4/N-6 domain protein [Methylobacterium nodulans ORS
           2060]
          Length = 368

 Score =  442 bits (1138), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 214/353 (60%), Positives = 265/353 (75%), Gaps = 2/353 (0%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLN-GQLYRPDHSLVDAVTDSWDKFSSFE 79
           D++I G+ I+ L+ LP  SVDL+FADPPYNLQL    L RPD S VDAV D WD+F+SFE
Sbjct: 13  DEVIHGDCIAALDALPPSSVDLVFADPPYNLQLGPASLLRPDQSAVDAVDDDWDQFASFE 72

Query: 80  AYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPN 139
           AYDAFTR WL ACRRV+KPN TLWVIGSYHNIFR+G+ LQ+L FWILNDIVWRK+NPMPN
Sbjct: 73  AYDAFTRQWLQACRRVMKPNATLWVIGSYHNIFRVGSALQDLGFWILNDIVWRKANPMPN 132

Query: 140 FRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKD 199
           FRG+RF NAHETLIWAS S + KGYTF+Y+ALK  N+D+QMRSDW +P+C+G ERL+  D
Sbjct: 133 FRGKRFTNAHETLIWASRSAQ-KGYTFHYEALKGGNDDLQMRSDWFLPLCTGEERLKGAD 191

Query: 200 GEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYID 259
           G KLHPTQKPEAL++R ++S++ PGD++LDPFFG+GT+GA AK+L R FIGIE +  Y+ 
Sbjct: 192 GRKLHPTQKPEALVARTILSASNPGDVVLDPFFGTGTTGAAAKRLGRRFIGIEREPAYVQ 251

Query: 260 IATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCAD 319
            A +RIA+V+PL    L     KR EPRV F  L+E GLI+ G  LT+ +    A V  D
Sbjct: 252 AARERIAAVEPLSTAALLTAPTKRAEPRVPFLSLLEAGLIRAGSQLTDERRRFKALVRPD 311

Query: 320 GTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           GT+ +G   GSIH++GA V G   CNGW FW+ E+ G L  I+  R  +R  L
Sbjct: 312 GTISAGPACGSIHKIGALVQGLPACNGWTFWHAERGGRLVPIDAFRAEIRAGL 364


>gi|83594540|ref|YP_428292.1| DNA methylase N-4/N-6 [Rhodospirillum rubrum ATCC 11170]
 gi|83577454|gb|ABC24005.1| DNA methylase N-4/N-6 [Rhodospirillum rubrum ATCC 11170]
          Length = 367

 Score =  442 bits (1138), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 202/359 (56%), Positives = 270/359 (75%), Gaps = 5/359 (1%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           ++I +G+SI V+  LP+ S+D+IFADPPYN+ L G+L RPD+S VD V D WD+F S  A
Sbjct: 8   NRIYQGDSIEVMRSLPSASIDMIFADPPYNMMLGGELLRPDNSRVDGVDDEWDRFESQRA 67

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           Y  FTR+WL   RR+LK NGT+WVIGSYHNI+R+G  LQ+L FW LND+VWRK+NPMPNF
Sbjct: 68  YAEFTRSWLREARRLLKDNGTIWVIGSYHNIYRVGAELQDLGFWTLNDVVWRKANPMPNF 127

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           +G RF NAHETL+W + S +A+ YTFNY+A+K+ NE +QMRSDW +P+C+G ERL+ +DG
Sbjct: 128 KGTRFTNAHETLLWCAKSAEAR-YTFNYEAMKSLNEGLQMRSDWTLPLCNGKERLKAEDG 186

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
           +K+HPTQKPE+LL R+++SST PGDIILDPFFG+GT+GAVAK L R +IG+E  + YI  
Sbjct: 187 KKVHPTQKPESLLYRVILSSTHPGDIILDPFFGTGTTGAVAKLLGRQWIGLERDEAYIAA 246

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADG 320
           A +RIA V+P+ ++ L +   K++EPR+ F  +VERGL+ PG +L ++Q   +A V ADG
Sbjct: 247 ARQRIAQVEPIKDLRLLITPSKKSEPRIPFGTVVERGLLAPGSLLCDSQRRWTAKVRADG 306

Query: 321 TLIS----GTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKELYNC 375
           TL++    G   GSIH+VGA V G+  CNGW FW+ ++ G    I+ LR  VR EL  C
Sbjct: 307 TLVATSSHGDHRGSIHQVGAAVQGAPACNGWTFWHIDRPGGAVPIDVLRQQVRAELEAC 365


>gi|209966434|ref|YP_002299349.1| modification methylase, putative [Rhodospirillum centenum SW]
 gi|209959900|gb|ACJ00537.1| modification methylase, putative [Rhodospirillum centenum SW]
          Length = 366

 Score =  442 bits (1137), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 204/357 (57%), Positives = 271/357 (75%), Gaps = 5/357 (1%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           ++I+ G+ I ++ ++PA SVD++FADPPYNLQL+G+L RP+HS VD V + WD+FS    
Sbjct: 11  NRILVGDCIQLMSQMPAGSVDMVFADPPYNLQLSGELLRPNHSRVDGVDEEWDRFSDLPT 70

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YD FTR WL A R  LK +GTLWVIGSYHNIFR+G++LQ+L FWILNDIVWRKSNPMPNF
Sbjct: 71  YDRFTRDWLGAARHALKDDGTLWVIGSYHNIFRVGSILQDLGFWILNDIVWRKSNPMPNF 130

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           +GRRF NAHETLIW + S +AK Y F Y+A+K  NE++QMRSDW +P+C+G+ERLR +DG
Sbjct: 131 KGRRFTNAHETLIWVAKSREAK-YYFAYEAMKNLNEELQMRSDWTLPLCTGAERLRGEDG 189

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
           +K HPTQKPEALL R+L+++T+P D++LDPFFG+GT+GAVAK+LRR +IGIE + +Y  +
Sbjct: 190 QKAHPTQKPEALLYRVLLAATRPDDLVLDPFFGTGTTGAVAKQLRRRWIGIEREHEYARL 249

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADG 320
           A  RIA+V+ L   EL  +  +RT+PRV F  LVERGL++PG  L + +  + A V ADG
Sbjct: 250 ANARIAAVEELAEPELVDVPARRTQPRVPFGHLVERGLLKPGTNLFDQRRRVIAKVRADG 309

Query: 321 TLIS----GTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKELY 373
           TL++    G   GSIH+VGA V G   CNGW +W+F++   L  I+ LR  V  E++
Sbjct: 310 TLVAQNHLGQHSGSIHKVGAAVQGLPACNGWTYWHFQEGKSLAPIDVLRQKVIAEMH 366


>gi|329850291|ref|ZP_08265136.1| modification methylase CcrMI [Asticcacaulis biprosthecum C19]
 gi|328840606|gb|EGF90177.1| modification methylase CcrMI [Asticcacaulis biprosthecum C19]
          Length = 374

 Score =  442 bits (1137), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 201/352 (57%), Positives = 258/352 (73%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           D I  G  I VL+ LP  SVDL+FADPPYNLQL G L RPD+S VDAV D WD+F+SFE 
Sbjct: 22  DTIHIGECIEVLKSLPDASVDLVFADPPYNLQLGGDLLRPDNSKVDAVDDEWDQFASFEV 81

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YD FTR W+  CRRVLK +G +WVIGSYHNIFR+G  +Q+L FW++ND++WRK+NPMPNF
Sbjct: 82  YDKFTREWMRECRRVLKDDGAMWVIGSYHNIFRLGVAMQDLGFWVMNDVIWRKANPMPNF 141

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           +G RF NAHETLIWA+ +   K YTFNYDALKA NED QMRSDWLI +C+G ERL++++G
Sbjct: 142 KGTRFTNAHETLIWATKAKGQKRYTFNYDALKAFNEDTQMRSDWLISLCTGDERLKDENG 201

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
            K HPTQKPE+LL R+L++ +KPG ++LDPFFG+GT+GA AK+L R FIGIE  + Y   
Sbjct: 202 NKAHPTQKPESLLYRVLLACSKPGQVVLDPFFGTGTTGAAAKRLGRHFIGIERDETYARH 261

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADG 320
           A +RIA V P     L V+  K+ EPR+ F  LVE GL+QPG +L   +G+ +A + ADG
Sbjct: 262 ARERIAKVIPTTAENLNVVGSKKAEPRIPFGSLVEAGLLQPGDMLYTPKGDKTAKIRADG 321

Query: 321 TLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           +L+ G   GSIH++GA +  S  CNGW +W F+    L  I+ LR  +R ++
Sbjct: 322 SLVYGDLSGSIHKMGAMMEQSPACNGWTYWRFKTDAGLKPIDDLRARIRGDM 373


>gi|114769696|ref|ZP_01447306.1| Site-specific DNA-methyltransferase [alpha proteobacterium
           HTCC2255]
 gi|114549401|gb|EAU52283.1| Site-specific DNA-methyltransferase [alpha proteobacterium
           HTCC2255]
          Length = 368

 Score =  442 bits (1137), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 212/352 (60%), Positives = 266/352 (75%), Gaps = 1/352 (0%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           + II G+ + V+  LP  S+DLIFADPPYNLQL G L+RPD+S VDAV D WD+F SF  
Sbjct: 16  NNIIDGDCVEVMNSLPENSIDLIFADPPYNLQLKGDLHRPDNSKVDAVDDHWDQFDSFAI 75

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YD F+R WL A RRVLKPNG LWVIGSYHNIFR+GT LQ+  FWILND++WRKSNPMPNF
Sbjct: 76  YDKFSRNWLKAARRVLKPNGALWVIGSYHNIFRVGTALQDAGFWILNDVIWRKSNPMPNF 135

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           RG R  NAHET+IWA  + K+K  TFNY+ALKA N+ VQMRSDW +PIC+G+ERL+N  G
Sbjct: 136 RGVRLTNAHETMIWAGKTEKSKP-TFNYEALKALNDGVQMRSDWHLPICNGNERLKNDAG 194

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
           +K HPTQKPE+LL R++V ST  GD+ILDPFFGSGT+GAVAKKL R+FIGIE +++Y  +
Sbjct: 195 DKAHPTQKPESLLHRVIVGSTNEGDVILDPFFGSGTTGAVAKKLGRNFIGIEREEEYRKV 254

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADG 320
           A KRI +++      L V T KR EPRV F  +VERG+++PG  L +  G  SA + ADG
Sbjct: 255 AKKRIKAIKKYDVESLKVSTSKRAEPRVPFGQVVERGMLKPGDQLYSLNGRHSAKIHADG 314

Query: 321 TLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           TL++  + GSIH+VGA + G+ +CNGW +W F+K GE   I+ LR  +R E+
Sbjct: 315 TLVAHDQRGSIHQVGAALEGAPSCNGWTYWCFKKRGEAIPIDMLRKKIRAEM 366


>gi|307294524|ref|ZP_07574366.1| DNA methylase N-4/N-6 domain protein [Sphingobium chlorophenolicum
           L-1]
 gi|306878998|gb|EFN10216.1| DNA methylase N-4/N-6 domain protein [Sphingobium chlorophenolicum
           L-1]
          Length = 379

 Score =  441 bits (1134), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 200/345 (57%), Positives = 262/345 (75%), Gaps = 2/345 (0%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           D +++G+ I+ + KLP   +D+IFADPPYNLQL G L+RP+   VDAV + WDKF +  +
Sbjct: 28  DCLLRGDCIAEMAKLPDACIDMIFADPPYNLQLGGDLFRPEGGRVDAVDNDWDKFDTLGS 87

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YD FT+AWL   RR+LKPNG++WVIGSYHNIFR+GT LQ+  FWILNDI+WRKSNPMPNF
Sbjct: 88  YDRFTKAWLREARRILKPNGSIWVIGSYHNIFRVGTALQDEGFWILNDIIWRKSNPMPNF 147

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           +G RF NAHETLIWAS    AK YTFNY A+K  N+++QMRSDW++PIC G ERL+ ++G
Sbjct: 148 KGTRFTNAHETLIWASQGEDAK-YTFNYKAMKTLNDELQMRSDWVLPICGGQERLK-RNG 205

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
            K HPTQKPEALL R++++ TKPGD++LDPFFG+GT+GAVAK+L R +IGIE + DYI++
Sbjct: 206 TKAHPTQKPEALLYRVMLACTKPGDVVLDPFFGTGTTGAVAKRLGRKWIGIEREDDYIEV 265

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADG 320
           A +RI +  PL    LT++   R +P+VAF  LVE G +QPG +LT+A+    A V ADG
Sbjct: 266 ALERIEAALPLDESALTIMQTARQQPKVAFGTLVETGYLQPGAVLTDAKRRWQAVVRADG 325

Query: 321 TLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLR 365
           +L  G + GSIH++GA + G+ +CNGW FW+ E  G L  I+ LR
Sbjct: 326 SLSVGKDTGSIHKMGATLQGAPSCNGWTFWHCEIDGALKPIDALR 370


>gi|300024384|ref|YP_003756995.1| DNA methylase N-4/N-6 domain protein [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299526205|gb|ADJ24674.1| DNA methylase N-4/N-6 domain protein [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 375

 Score =  440 bits (1132), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 200/350 (57%), Positives = 259/350 (74%), Gaps = 1/350 (0%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           +I+ G+ I+ L+K+   SVDL+FADPPYNLQL G L RP+++ VD V D+WDKF  F  Y
Sbjct: 14  RILVGDCINELKKIATASVDLVFADPPYNLQLAGDLLRPNNTKVDGVDDAWDKFQDFAEY 73

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFR 141
           D+F RAWL  CRRVLKP+G +WVIGSYHNIFR+G  +Q+L FWI ND++WRK NPMPNFR
Sbjct: 74  DSFCRAWLKECRRVLKPDGAIWVIGSYHNIFRLGVAIQDLGFWIQNDVIWRKVNPMPNFR 133

Query: 142 GRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGE 201
           G+RF NAHET+IWA    K++  TFNY++LKA+N+D+QMRSDWL PICSG ERL++  G 
Sbjct: 134 GKRFTNAHETMIWAGRDRKSR-VTFNYESLKASNDDLQMRSDWLFPICSGPERLKDDGGR 192

Query: 202 KLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIA 261
           K HPTQKPEALL RI+++STKPGD +LDPFFG+GT+GAVAK+L R FIGIE   DY   A
Sbjct: 193 KAHPTQKPEALLHRIMIASTKPGDTVLDPFFGTGTTGAVAKRLGRKFIGIERDTDYARAA 252

Query: 262 TKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGT 321
            +RIA V+PL    +  +  KR+EPR+ F  ++E G+++PGQ L   +  + A V ADGT
Sbjct: 253 DERIAKVRPLDLDAIEAIPSKRSEPRIPFGQILELGILEPGQKLFGPRREVRAEVRADGT 312

Query: 322 LISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKE 371
           L    +  SIHR+GA V G   CNGW +W+FE  G+L  I+ LR   +++
Sbjct: 313 LACAGQQASIHRLGAMVQGKAACNGWTYWHFEAEGKLRPIDVLRGEAKRQ 362


>gi|114570743|ref|YP_757423.1| DNA methylase N-4/N-6 domain-containing protein [Maricaulis maris
           MCS10]
 gi|114341205|gb|ABI66485.1| DNA methylase N-4/N-6 domain protein [Maricaulis maris MCS10]
          Length = 359

 Score =  436 bits (1122), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 197/354 (55%), Positives = 263/354 (74%), Gaps = 1/354 (0%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           D+I++G  + V++ LP +SVDL+FADPPYNLQL G L+RPD+S V AV + WD+   F+ 
Sbjct: 7   DQILEGECVEVMKSLPDESVDLVFADPPYNLQLGGDLHRPDNSKVSAVDNDWDQIGGFDE 66

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YD FT  W+   RRVLKPNG +WVIGSYHNIFR+G +LQ+  FW+LNDI+WRKSNPMPNF
Sbjct: 67  YDLFTWNWMEEARRVLKPNGAIWVIGSYHNIFRVGGILQDAGFWVLNDIIWRKSNPMPNF 126

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           +G RF NAHETLIWA+ +  A+  TFNY A+KA N+ VQMRSDW +PIC+G ERL+++DG
Sbjct: 127 KGTRFTNAHETLIWAAKTKDARP-TFNYAAMKALNDGVQMRSDWTLPICTGGERLKDEDG 185

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
           +K HPTQKPE+LL R+L+S+T PGD++LDPFFG+GT+GA AK+L R +IGIE    Y+D+
Sbjct: 186 KKAHPTQKPESLLHRVLLSTTNPGDVVLDPFFGTGTTGAAAKRLGRHYIGIERDTAYLDV 245

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADG 320
           A KR+A++    +  L V   KR +PR+ F  LVERG+++PG  L   +G  +A V ADG
Sbjct: 246 ARKRLAAITRGASDTLDVTQSKRAQPRIPFGALVERGMLKPGDTLYCPKGRNTARVRADG 305

Query: 321 TLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKELYN 374
           TLI+GT  GSIH+VGA++  + +CNGW +W+      L  I+ +R  +R  L N
Sbjct: 306 TLIAGTSAGSIHQVGAQLQSAPSCNGWTYWHIRTKQGLAPIDVMRAEIRATLEN 359


>gi|23016143|ref|ZP_00055902.1| COG0863: DNA modification methylase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 358

 Score =  436 bits (1122), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 205/353 (58%), Positives = 268/353 (75%), Gaps = 4/353 (1%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           I+ G+ I+++  LPA SVDL+FADPPYNLQL G+L RP++S V+ V + WD+FS F AYD
Sbjct: 8   ILSGDCIAMMNSLPAGSVDLVFADPPYNLQLGGELLRPNNSKVEGVDEDWDRFSDFAAYD 67

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
           AFTR WL A RRVLK +G LWVIGSYHNIFR+G +LQ+L FW+LNDIVWRK+NPMPNF+G
Sbjct: 68  AFTREWLKAARRVLKDDGGLWVIGSYHNIFRVGAILQDLGFWMLNDIVWRKTNPMPNFKG 127

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
            RF NAHET+IW + S  ++ YTFNYD++K+ N+D+QMRSDW +P+C+G+ERLR K G K
Sbjct: 128 TRFTNAHETMIWCAKSSDSR-YTFNYDSMKSLNDDLQMRSDWTLPLCTGAERLR-KAGRK 185

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKPE+LL R++++STKPGD++LDPFFG+GT+GAVAKKL R+FIG E   DYI  A 
Sbjct: 186 THPTQKPESLLYRVIMASTKPGDVVLDPFFGTGTTGAVAKKLGRNFIGCERDPDYIAAAK 245

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQIL-TNAQGNISATVCADGT 321
           +RIA V  + +  L +   KR EPR+ F  ++ERGL+ PG +L    + +  A V ADGT
Sbjct: 246 ERIAKVIQVADPSLLMTPSKRAEPRIPFGTVLERGLLTPGDLLFGGTRHDKVAKVRADGT 305

Query: 322 LISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELH-SINTLRILVRKELY 373
           LI+    GSIH+VGA V G+  CNGW +W+F+  GE +  I+ LR  +R EL+
Sbjct: 306 LITDDHRGSIHKVGALVQGAPACNGWTYWHFQASGEDYLPIDVLRQKIRAELH 358


>gi|296284401|ref|ZP_06862399.1| modification methylase [Citromicrobium bathyomarinum JL354]
          Length = 383

 Score =  436 bits (1121), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 200/346 (57%), Positives = 255/346 (73%), Gaps = 1/346 (0%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           +I+ G+ +  + +LP  SVDL+FADPPYNLQL G L RPD S VDAVTD WD+F SF+ Y
Sbjct: 32  QILDGDCVEAMRRLPDNSVDLVFADPPYNLQLGGDLNRPDGSHVDAVTDHWDQFDSFKVY 91

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFR 141
           D F++AWL  CRRVLKP+G LWVIGSYHNI+R+G  LQ+L FWILNDIVWRK+NPMPNFR
Sbjct: 92  DDFSKAWLAECRRVLKPDGALWVIGSYHNIYRLGATLQDLGFWILNDIVWRKTNPMPNFR 151

Query: 142 GRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGE 201
           G RF NAHETLIWAS   KA+ Y FNY A+K  N+++QMRSDW  PICSG ERL++  G 
Sbjct: 152 GTRFTNAHETLIWASQGEKAR-YHFNYRAMKTLNDELQMRSDWTFPICSGGERLKDDAGH 210

Query: 202 KLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIA 261
           K HPTQKPEALL R+L+++T+ GD++LDPFFG+GT+GA+AK+L R +IG E ++ Y  +A
Sbjct: 211 KAHPTQKPEALLYRVLLATTEWGDVVLDPFFGTGTTGAIAKRLGREWIGCEREESYRKVA 270

Query: 262 TKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGT 321
             RI    PL    LT +  KRT PRVAF  LVE G ++PG  + + Q   +ATV ADG+
Sbjct: 271 RARIEKELPLDESALTTMQSKRTAPRVAFGTLVEAGFVKPGTQVFDKQRRWTATVRADGS 330

Query: 322 LISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRIL 367
           L+     GSIH+VG  + G+ +CNGW FW+FE  G + +++  R L
Sbjct: 331 LVHEKLNGSIHQVGKDLQGAPSCNGWTFWHFEDEGAVKALDAARQL 376


>gi|170739049|ref|YP_001767704.1| DNA methylase N-4/N-6 domain-containing protein [Methylobacterium
           sp. 4-46]
 gi|168193323|gb|ACA15270.1| DNA methylase N-4/N-6 domain protein [Methylobacterium sp. 4-46]
          Length = 396

 Score =  436 bits (1120), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 217/353 (61%), Positives = 266/353 (75%), Gaps = 2/353 (0%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLN-GQLYRPDHSLVDAVTDSWDKFSSFE 79
           D++I+G+ ++ L+ LP  SVDL+FADPPYNLQL    L RPD S VDAV D WD+F+SFE
Sbjct: 41  DEVIQGDCLAALDALPPSSVDLVFADPPYNLQLGEAALLRPDQSAVDAVDDDWDQFASFE 100

Query: 80  AYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPN 139
           AYDAFTR WL ACRRV+KPN TLWVIGSYHNIFR+G+ LQ+L FWILNDIVWRK+NPMPN
Sbjct: 101 AYDAFTRQWLQACRRVMKPNATLWVIGSYHNIFRVGSALQDLGFWILNDIVWRKANPMPN 160

Query: 140 FRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKD 199
           FRG+RF NAHETLIWAS S + KGYTF+Y++LK  N+D+QMRSDW +P+C+G ERL+ +D
Sbjct: 161 FRGKRFTNAHETLIWASRSAQ-KGYTFHYESLKGGNDDLQMRSDWFLPLCTGEERLKGED 219

Query: 200 GEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYID 259
           G KLHPTQKPEALL+R ++S++ PGD++LDPFFG+GT+GAVAK+L R FIGIE +  Y  
Sbjct: 220 GRKLHPTQKPEALLARTILSASNPGDVVLDPFFGTGTTGAVAKRLGRRFIGIERESAYAA 279

Query: 260 IATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCAD 319
            A  RIA+V+PL    L     KR EPRV F  L+E GLI PG  LT+ +    A V  D
Sbjct: 280 AARARIAAVEPLSTAALLTAPAKRAEPRVPFLNLIEAGLIAPGSQLTDERRRFRALVRPD 339

Query: 320 GTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           GTL  G   GSIH++GA V G   CNGW FW+ E+ G L  I+ LR  +R  L
Sbjct: 340 GTLSVGPACGSIHKIGALVQGLPACNGWTFWHTERGGRLVVIDALRAQIRAGL 392


>gi|170747153|ref|YP_001753413.1| DNA methylase N-4/N-6 domain-containing protein [Methylobacterium
           radiotolerans JCM 2831]
 gi|170653675|gb|ACB22730.1| DNA methylase N-4/N-6 domain protein [Methylobacterium
           radiotolerans JCM 2831]
          Length = 368

 Score =  436 bits (1120), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 212/355 (59%), Positives = 271/355 (76%), Gaps = 1/355 (0%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQL-NGQLYRPDHSLVDAVTDSWDKFSSFE 79
           D+++ G+ I+ +  LPA SVD +FADPPYNLQL +  L RPD S VDAV D WDKF++FE
Sbjct: 13  DQVLVGDCIAAMNALPASSVDCVFADPPYNLQLGDAGLLRPDQSRVDAVDDDWDKFATFE 72

Query: 80  AYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPN 139
           AYD FTR WL ACRRV+KPN TLWVIGSYHNIFR+G+ LQ+L +WILNDIVWRK+NPMPN
Sbjct: 73  AYDTFTRDWLSACRRVMKPNATLWVIGSYHNIFRVGSALQDLGYWILNDIVWRKANPMPN 132

Query: 140 FRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKD 199
           FRG+RF NAHETLIWAS S  +KGYTF+Y+ALK  NED+QMRSDW IP+C+G ERL++ +
Sbjct: 133 FRGKRFTNAHETLIWASRSADSKGYTFHYEALKGGNEDLQMRSDWFIPLCTGEERLKDAE 192

Query: 200 GEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYID 259
           G K+HPTQKPEALL+R L+++T PGD++LDPFFG+GT+GAVAK+L R FIGIE +  Y +
Sbjct: 193 GRKVHPTQKPEALLARTLLAATNPGDVVLDPFFGTGTTGAVAKRLGRRFIGIEREATYAE 252

Query: 260 IATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCAD 319
            A +RIA+V+ L    L V   KR EPRV F  ++E G I+PG+ +T+ +    ATV  D
Sbjct: 253 AARERIAAVETLSRAALMVAPTKRAEPRVPFLSVIEAGHIRPGETVTDERRRFRATVRPD 312

Query: 320 GTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKELYN 374
           G L +G  +GSIH++GA V G   CNGW FW+ E+ G+   I+T R  +R+ + N
Sbjct: 313 GQLDNGLVIGSIHKIGALVQGLPACNGWTFWHVERGGKPVVIDTFRAGLRQAMAN 367


>gi|288962308|ref|YP_003452603.1| adenine-specific DNA-methyltransferase [Azospirillum sp. B510]
 gi|288914574|dbj|BAI76059.1| adenine-specific DNA-methyltransferase [Azospirillum sp. B510]
          Length = 360

 Score =  435 bits (1119), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 203/358 (56%), Positives = 268/358 (74%), Gaps = 5/358 (1%)

Query: 20  KDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFE 79
           +++I+ G+ I+++  LP  SVDL+FADPPYNLQL G+L RP+H+ V  V D WDKF  FE
Sbjct: 4   ENRILVGDCIALMNDLPPASVDLVFADPPYNLQLGGELLRPNHTRVAGVDDEWDKFDDFE 63

Query: 80  AYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPN 139
           AYD FTR W+ A RR+LKP G+LWVIGSYHNIFR+G  LQNL FWILNDIVWRK+NPMPN
Sbjct: 64  AYDRFTRDWMTAARRILKPEGSLWVIGSYHNIFRVGATLQNLGFWILNDIVWRKTNPMPN 123

Query: 140 FRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKD 199
           FRG RF NAHET+IWA+    A+ Y FNYDA+K  NED+QMRSDWL+PICSG ERLR+++
Sbjct: 124 FRGTRFANAHETMIWAALDKDAR-YRFNYDAMKNLNEDLQMRSDWLLPICSGGERLRDEE 182

Query: 200 GEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYID 259
           G+K HPTQKPE+LL R+++SS++PGD++LDPFFG+GT+GAVAK+L R +IG+E    Y+ 
Sbjct: 183 GKKTHPTQKPESLLYRVILSSSRPGDVVLDPFFGTGTTGAVAKRLGRKWIGLERDDTYVK 242

Query: 260 IATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCAD 319
            A  RI +V+   +  +     KR+ PR+ F  +VERGL++PG  L + +  ++A V AD
Sbjct: 243 AAQARIDAVEEAPDTAILDTPPKRSAPRIPFGWVVERGLLRPGSTLFDQRRRVAARVRAD 302

Query: 320 GTLIS----GTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKELY 373
           GTLI     G   GSIH+VGA ++G   CNGW FW++E+  +L  I+ LR  +R E++
Sbjct: 303 GTLIGSGPRGDHRGSIHQVGAAMAGLPACNGWTFWHYEEGEDLRPIDVLRERIRSEMH 360


>gi|332188931|ref|ZP_08390632.1| DNA methylase family protein [Sphingomonas sp. S17]
 gi|332011042|gb|EGI53146.1| DNA methylase family protein [Sphingomonas sp. S17]
          Length = 379

 Score =  434 bits (1116), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 209/346 (60%), Positives = 260/346 (75%), Gaps = 3/346 (0%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           D+I+ G+ I+ L  LP KSVD++FADPPYNLQL G+L+RPD S VDAVTD+WDKF +F A
Sbjct: 27  DQILMGDCIAALRSLPDKSVDMVFADPPYNLQLGGELFRPDGSHVDAVTDAWDKFDTFAA 86

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YDAFTRAWL  C RVLK NG+LWVIGSYHNIFR+GT +Q+L FWILNDI+WRKSNPMPNF
Sbjct: 87  YDAFTRAWLAECYRVLKDNGSLWVIGSYHNIFRVGTAVQDLGFWILNDIIWRKSNPMPNF 146

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           +G RF NAHETLIWAS   KAK YTFNY ++K  N+++QMRSDW  PIC G ERL+ KDG
Sbjct: 147 KGTRFTNAHETLIWASKGEKAK-YTFNYRSMKTLNDEIQMRSDWEFPICGGQERLK-KDG 204

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
            K+HPTQKPEALL RIL++ T+PGD+I DPFFG+GT+GAVAK+L R +IGIE +  Y   
Sbjct: 205 HKVHPTQKPEALLYRILLACTRPGDVIADPFFGTGTTGAVAKRLGRRWIGIEREPTYCAA 264

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADG 320
           A +RI +  PL    L  +   + +P+VAF  LVE G + PG  L +A+    ATV ADG
Sbjct: 265 AIERIEAALPLDESALATMQSPKAQPKVAFGTLVETGYLAPGMPLMDAKRKWRATVRADG 324

Query: 321 TLISGT-ELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLR 365
           +L+S   + GSIHR+G+ +    TCNGW FW++E  G L  I+ +R
Sbjct: 325 SLLSDCGQAGSIHRLGSLLQNRPTCNGWTFWHYELEGALKPIDAMR 370


>gi|296444555|ref|ZP_06886519.1| DNA methylase N-4/N-6 domain protein [Methylosinus trichosporium
           OB3b]
 gi|296257823|gb|EFH04886.1| DNA methylase N-4/N-6 domain protein [Methylosinus trichosporium
           OB3b]
          Length = 390

 Score =  433 bits (1114), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 201/349 (57%), Positives = 260/349 (74%), Gaps = 1/349 (0%)

Query: 20  KDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFE 79
           ++ ++ G+++ ++  LPA+SVDL+FADPPYNLQL   L RPD S VDAV D WDKF+ F 
Sbjct: 32  RNSVLLGDNVPLMAGLPAESVDLVFADPPYNLQLANALTRPDQSRVDAVDDDWDKFADFS 91

Query: 80  AYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPN 139
           AYD+FTR WL A RRV+KPN T++VIGSYHNIFR+G M+Q+L FWILNDIVWRK+NPMPN
Sbjct: 92  AYDSFTRDWLAAARRVMKPNATIFVIGSYHNIFRVGAMMQDLGFWILNDIVWRKTNPMPN 151

Query: 140 FRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKD 199
           FRGRRF NAHETLIWA+     + YTF+Y+ALKA NED QMRSDWL+PIC+G ERL++  
Sbjct: 152 FRGRRFTNAHETLIWAARDSSCRSYTFHYEALKAGNEDCQMRSDWLLPICTGGERLKDAA 211

Query: 200 GEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYID 259
           G K HPTQKPEALL+R++++++ PGD++LDPFFGSGT+GAVAK+L R ++G+E    Y  
Sbjct: 212 GRKTHPTQKPEALLARVMLAASNPGDLVLDPFFGSGTTGAVAKRLGRDYLGLERDPAYAA 271

Query: 260 IATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCAD 319
            A +RIA+++PL +  +     KR+ PR+AF  LVE GL+  G +LT+  G   A V  D
Sbjct: 272 AARERIAAIEPLPDEAIAAAPTKRSAPRIAFASLVESGLVAAGAMLTDLHGRHRAMVRPD 331

Query: 320 GTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEK-LGELHSINTLRIL 367
           G L  G  +GSIH++GA   G   CNGW FW+FE   G L  I+ LR +
Sbjct: 332 GALALGQIVGSIHKIGALAQGLPACNGWTFWHFESGGGALAPIDDLRTI 380


>gi|83313087|ref|YP_423351.1| modification methylase CcrMI [Magnetospirillum magneticum AMB-1]
 gi|82947928|dbj|BAE52792.1| Modification methylase CcrmI [Magnetospirillum magneticum AMB-1]
          Length = 358

 Score =  433 bits (1114), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 206/353 (58%), Positives = 264/353 (74%), Gaps = 4/353 (1%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           I+ G+ I+++  LPA SVDLIFADPPYNLQL G+L RP++S V+ V + WD+FS F AYD
Sbjct: 8   ILSGDCIAMMNSLPAGSVDLIFADPPYNLQLGGELLRPNNSKVEGVDEEWDRFSDFAAYD 67

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
           +FTR WL A RRVLK +G LWVIGSYHNIFR+G++LQ+L FW+LNDIVWRKSNPMPNF+G
Sbjct: 68  SFTRDWLKAARRVLKDDGGLWVIGSYHNIFRVGSILQDLGFWMLNDIVWRKSNPMPNFKG 127

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
            RF NAHET+IW + S  ++ YTFNYD +KA N+D+QMRSDW +P+C+G ERLRN  G K
Sbjct: 128 TRFTNAHETMIWCAKSSDSR-YTFNYDTMKALNDDLQMRSDWTLPLCTGGERLRNA-GRK 185

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKPE+LL R++++STKPGD++LDPFFG+GT+GAVAKKL R+FIG E   +YI  A 
Sbjct: 186 THPTQKPESLLYRVIMASTKPGDVVLDPFFGTGTTGAVAKKLGRNFIGCERDPEYIAAAK 245

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQIL-TNAQGNISATVCADGT 321
            RIA V P+ +  L +   KR EPRV F  ++ERGL+  G +L    + +  A V ADGT
Sbjct: 246 DRIAKVIPVADPSLLLTPSKRAEPRVPFGTVLERGLLTAGDLLFGGTRHDKVAKVRADGT 305

Query: 322 LISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGE-LHSINTLRILVRKELY 373
           LI+    GSIH+VGA V G+  CNGW +W+F+   E    I+ LR  +R EL+
Sbjct: 306 LITDDHRGSIHKVGALVQGAPACNGWTYWHFQASSEDFLPIDVLRQKIRAELH 358


>gi|103486455|ref|YP_616016.1| DNA methylase N-4/N-6 [Sphingopyxis alaskensis RB2256]
 gi|98976532|gb|ABF52683.1| DNA methylase N-4/N-6 [Sphingopyxis alaskensis RB2256]
          Length = 379

 Score =  428 bits (1100), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 204/346 (58%), Positives = 251/346 (72%), Gaps = 3/346 (0%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           D I++G+ ++++  LPA SVD+IFADPPYNLQL G L RPD S VDAV D WDKF S   
Sbjct: 27  DSILQGDCVAMMRGLPAASVDMIFADPPYNLQLGGDLLRPDGSQVDAVDDDWDKFDSLAT 86

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YD FT AWL   RR+LKP G++WVIGSYHNIFR+G  LQ+  +WILNDIVWRK+NPMPNF
Sbjct: 87  YDRFTHAWLKEARRILKPGGSIWVIGSYHNIFRVGAALQDQGYWILNDIVWRKANPMPNF 146

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           +G RF NAHETLIWAS   KA+ YTFNY A+K  N+++QMRSDWLIPIC G ERL+ K G
Sbjct: 147 KGTRFTNAHETLIWASMGEKAR-YTFNYRAMKTLNDELQMRSDWLIPICGGPERLK-KGG 204

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
            K+HPTQKPEALL RIL++ + PGD+ILDPFFG+GT+GAVAK+L R +IGIE + DYI  
Sbjct: 205 HKVHPTQKPEALLYRILLACSNPGDVILDPFFGTGTTGAVAKRLGRHYIGIEREDDYIAA 264

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADG 320
           A +RI    PL    +  +   +   RVAF  LVE GLI PG +LT+A+    A V  DG
Sbjct: 265 AKERIELALPLDESAVKTMMAPKAATRVAFGTLVECGLIAPGTVLTDAKRRWKAKVRVDG 324

Query: 321 TL-ISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLR 365
           +L   G   GSIH+VGA V G+ +CNGW FW+ +   EL  I+ +R
Sbjct: 325 SLDCEGQAPGSIHKVGAGVQGAPSCNGWTFWHVDTGQELRVIDAVR 370


>gi|296536588|ref|ZP_06898668.1| site-specific DNA-methyltransferase (adenine-specific) [Roseomonas
           cervicalis ATCC 49957]
 gi|296263084|gb|EFH09629.1| site-specific DNA-methyltransferase (adenine-specific) [Roseomonas
           cervicalis ATCC 49957]
          Length = 363

 Score =  427 bits (1097), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 199/346 (57%), Positives = 254/346 (73%), Gaps = 2/346 (0%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           D I++G+ I +L  LP  SV  IFADPPYNLQL G+L RPD S+VD V D+WD+FS    
Sbjct: 10  DCILEGDCIEMLRALPPASVHAIFADPPYNLQLKGELRRPDESVVDGVDDAWDRFSDLAT 69

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YD+FTRAWL   RRVL+ +GT+WVIGSYHN+FR+G  LQ+L+FWILND++WRK+NPMPNF
Sbjct: 70  YDSFTRAWLTEARRVLRKDGTIWVIGSYHNVFRLGVALQDLDFWILNDVIWRKANPMPNF 129

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           RGRRF NAHETLIWAS   +++ Y FNY A+K+ N+DVQMRSDW IP+C+GSERLR++ G
Sbjct: 130 RGRRFTNAHETLIWASRGQESR-YKFNYTAMKSLNDDVQMRSDWFIPLCTGSERLRDEKG 188

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
           +K+HPTQKPEALL R+++S T PGD++LDPF GSGT+ AVA++L R +IGIE    Y   
Sbjct: 189 QKVHPTQKPEALLHRVILSCTSPGDVVLDPFLGSGTTAAVARRLGRRYIGIERDPTYAAA 248

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADG 320
           A  RI +V+PL    + V   KR +PR+ F  LVERGL+ PG  L +      A V ADG
Sbjct: 249 ARARIQAVEPLSESAMLVTPTKREQPRIPFGALVERGLVPPGARLVDRHRRFVAEVGADG 308

Query: 321 TLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKL-GELHSINTLR 365
           +L  G   GSIH+VGA V  + +CNGW FW+ E+  G L  ++ LR
Sbjct: 309 SLRCGKAQGSIHQVGAAVQEAPSCNGWLFWHVERRDGTLRLLDELR 354


>gi|149185912|ref|ZP_01864227.1| modification methylase [Erythrobacter sp. SD-21]
 gi|148830473|gb|EDL48909.1| modification methylase [Erythrobacter sp. SD-21]
          Length = 380

 Score =  426 bits (1094), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 197/346 (56%), Positives = 257/346 (74%), Gaps = 2/346 (0%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           +I+ G+ +  + ++P+ S+DL+FADPPYNLQL G L RPD S VDAVTD WDKF +F AY
Sbjct: 30  QILDGDCVEAMRQIPSASIDLVFADPPYNLQLGGDLNRPDGSHVDAVTDDWDKFDTFSAY 89

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFR 141
           D FTR WL+  +R+LKP+G LWVIGSYHNI+R+G +LQ+L FWILNDIVWRKSNPMPNFR
Sbjct: 90  DTFTRDWLIEAKRILKPDGALWVIGSYHNIYRVGAILQDLGFWILNDIVWRKSNPMPNFR 149

Query: 142 GRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGE 201
           G RF NAHETL+W S   KAK Y FNY A+K  N+++QMRSDW++PIC+G+ERL+ + G 
Sbjct: 150 GTRFTNAHETLLWCSQGEKAK-YHFNYRAMKTLNDELQMRSDWVLPICNGAERLK-EGGH 207

Query: 202 KLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIA 261
           K+HPTQKPEALL R+L+S+T+ GD++LDPFFG+GT+GAVAK+L R +IG E +  Y + A
Sbjct: 208 KVHPTQKPEALLYRVLLSTTERGDVVLDPFFGTGTTGAVAKRLGREWIGCEREGVYRNAA 267

Query: 262 TKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGT 321
            KRI    PL    LT +   R+ P+VAF  LVE G I PG  L + +   +ATV ADG+
Sbjct: 268 LKRIEKELPLDESALTTMQAGRSAPKVAFGALVENGYIAPGTKLFDKKRRWTATVRADGS 327

Query: 322 LISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRIL 367
           L    + GSIH +G ++ G+ +CNGW FW++E  GE+  I+  R L
Sbjct: 328 LACEKQTGSIHGLGKELQGAPSCNGWTFWHYENGGEVKPIDAARQL 373


>gi|294085234|ref|YP_003551994.1| DNA methylase N-4/N-6 [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292664809|gb|ADE39910.1| DNA methylase N-4/N-6 [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 363

 Score =  424 bits (1091), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 195/351 (55%), Positives = 267/351 (76%), Gaps = 3/351 (0%)

Query: 20  KDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFE 79
           K+ +++G+ +  L+ L   SVDL+FADPPYNLQL+  L RPD S V +V DSWD+F SF 
Sbjct: 3   KNIVLQGDCVETLKTLAKNSVDLVFADPPYNLQLSELLVRPDQSSVVSVDDSWDQFDSFA 62

Query: 80  AYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPN 139
           AYD FT AW+   RRVLKPNG +WVIGSYHNIFR+G ++Q+L FW+LND++WRK+NPMPN
Sbjct: 63  AYDEFTLAWMREVRRVLKPNGAIWVIGSYHNIFRVGKIMQDLGFWVLNDVIWRKTNPMPN 122

Query: 140 FRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKD 199
           FRGRRF NAHET+IWA+ S KAK +TFNY+A+KA N+DVQMRSDW +P+C+G ERL+ ++
Sbjct: 123 FRGRRFTNAHETMIWAAKSQKAK-HTFNYEAMKALNDDVQMRSDWELPLCTGHERLK-EN 180

Query: 200 GEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYID 259
           G++ HPTQKPE+LL+R++++STK  D+ILDPFFG+GT+GAVA++L R+FIGIE   DY+ 
Sbjct: 181 GKRAHPTQKPESLLARVILASTKRDDVILDPFFGTGTTGAVARRLNRNFIGIEQNPDYVK 240

Query: 260 IATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCAD 319
           +A  RI  V P+ + +L     KR  P++ F  L+ERG++QPG  L +A+   SA V AD
Sbjct: 241 LARDRIDQVTPIASPDLLASEQKRALPKIPFGTLIERGILQPGDRLFDAKKRFSAQVRAD 300

Query: 320 GTLISGT-ELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVR 369
           G+L++ + E GSIH +GA++    +CNGW FW+ E+ G+   I+  R  +R
Sbjct: 301 GSLVTDSKESGSIHSLGAQLQSLPSCNGWIFWHVERDGKPVLIDRFREDIR 351


>gi|85707872|ref|ZP_01038938.1| Site-specific DNA-methyltransferase [Erythrobacter sp. NAP1]
 gi|85689406|gb|EAQ29409.1| Site-specific DNA-methyltransferase [Erythrobacter sp. NAP1]
          Length = 379

 Score =  424 bits (1091), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 200/348 (57%), Positives = 256/348 (73%), Gaps = 2/348 (0%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           +I+ G+ I  +  LP  SVD +FADPPYNLQL G L RPD S VDAVTD WD+F SF AY
Sbjct: 29  QILDGDCIEAMRSLPDNSVDCVFADPPYNLQLGGDLNRPDGSEVDAVTDHWDQFDSFRAY 88

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFR 141
           D FTR WL   RRVLKP+G+LWVIGSYHNIFR G +LQ+L FWILNDIVWRK+NPMPNF+
Sbjct: 89  DDFTREWLTEARRVLKPDGSLWVIGSYHNIFRCGAILQDLGFWILNDIVWRKTNPMPNFK 148

Query: 142 GRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGE 201
           G RF NAHETLIWAS   KA+ Y FNY A+K  N+++QMRSDW++PICSG ERL+ ++G+
Sbjct: 149 GTRFTNAHETLIWASQGEKAR-YHFNYRAMKTLNDELQMRSDWVLPICSGGERLK-ENGK 206

Query: 202 KLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIA 261
           K HPTQKPEALL R+L+++T+ GD++LDPFFG+GT+GAVAK+L R +IG E ++ Y  +A
Sbjct: 207 KAHPTQKPEALLYRVLLATTEKGDVVLDPFFGTGTTGAVAKRLGREWIGCEREEFYRGVA 266

Query: 262 TKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGT 321
            KRI    PL    LT +  K+  PRVAF  +VE GLI PG  + + +    ATV ADG+
Sbjct: 267 MKRIEKELPLDESALTTMQSKKAAPRVAFGAVVENGLIPPGTQVFDKKRRWVATVRADGS 326

Query: 322 LISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVR 369
           L    ++GSIH +G ++  + +CNGW FW++E  GE+  ++  R L R
Sbjct: 327 LDCDGKVGSIHGLGKELQEAPSCNGWTFWHYENGGEIKPVDAARELYR 374


>gi|240139930|ref|YP_002964407.1| site-specific DNA-methyltransferase (adenine-specific)
           [Methylobacterium extorquens AM1]
 gi|240009904|gb|ACS41130.1| site-specific DNA-methyltransferase (adenine-specific)
           [Methylobacterium extorquens AM1]
          Length = 398

 Score =  423 bits (1087), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 216/352 (61%), Positives = 270/352 (76%), Gaps = 2/352 (0%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLN-GQLYRPDHSLVDAVTDSWDKFSSFE 79
           D+I+ G+ I+ +++LPA+SVD +FADPPYNLQL    L RPD S+VDAV D WDKFSSF 
Sbjct: 45  DEILIGDCIAAMDRLPAESVDCVFADPPYNLQLGEAGLTRPDQSVVDAVDDDWDKFSSFS 104

Query: 80  AYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPN 139
           AYD FTRAWL A RRV+KPNGTLWVIGSYHNIFR+G+ LQ+L +WILNDIVWRK+NPMPN
Sbjct: 105 AYDDFTRAWLKAARRVMKPNGTLWVIGSYHNIFRVGSALQDLGYWILNDIVWRKANPMPN 164

Query: 140 FRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKD 199
           FRG+RF NAHETLIWAS SP+AK YTF+YDALKA NED+QMRSDW IP+C+G ERL+++ 
Sbjct: 165 FRGKRFTNAHETLIWASRSPQAK-YTFHYDALKAGNEDLQMRSDWFIPLCTGEERLKDEA 223

Query: 200 GEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYID 259
           G K+HPTQKPEALL+R L+++T PGD++LDPFFG+GT+GAVAK+L R FIG E    Y  
Sbjct: 224 GRKVHPTQKPEALLARTLLAATNPGDVVLDPFFGTGTTGAVAKRLGRHFIGCERDPTYAT 283

Query: 260 IATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCAD 319
            A  RI S++ L    L + T KR+EPR+ F  +VE G ++PG+ LT+ +    ATV  D
Sbjct: 284 AARARIDSIETLSAASLALATPKRSEPRIPFLSVVEAGHVRPGETLTDERRRFRATVRPD 343

Query: 320 GTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKE 371
           G L  G  +GSIH+VGA V G   CNGW FW+ E+ G+L  I+  R  +R +
Sbjct: 344 GQLSVGPAMGSIHKVGALVQGLPACNGWTFWHAERGGKLVCIDDFRTEMRGQ 395


>gi|260752543|ref|YP_003225436.1| DNA methylase N-4/N-6 domain protein [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
 gi|283856387|ref|YP_162740.2| DNA methylase N-4/N-6 domain-containing protein [Zymomonas mobilis
           subsp. mobilis ZM4]
 gi|163881967|gb|ABY48039.1| cell cycle regulating DNA methyltransferase [Zymomonas mobilis
           subsp. mobilis]
 gi|258551906|gb|ACV74852.1| DNA methylase N-4/N-6 domain protein [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
 gi|283775386|gb|AAV89629.2| DNA methylase N-4/N-6 domain protein [Zymomonas mobilis subsp.
           mobilis ZM4]
          Length = 382

 Score =  423 bits (1087), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 198/346 (57%), Positives = 257/346 (74%), Gaps = 2/346 (0%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           + I+ GN I +L+ LP  SVDLIFADPPYNLQL+G+L+RP+ S VDAV ++WDKF +F A
Sbjct: 30  NSILAGNCIEILKTLPDNSVDLIFADPPYNLQLSGELFRPEGSRVDAVNNAWDKFDTFAA 89

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YD FTR WL    RVLK +GT+WVIGSYHNIFR+GT LQ+  FWILNDI+WRKSNPMPNF
Sbjct: 90  YDHFTRLWLKEAHRVLKEDGTIWVIGSYHNIFRVGTALQDQGFWILNDIIWRKSNPMPNF 149

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           +GRRF NAHETLIWAS S K++ Y FNY +LK  N+D+QMRSDWL+PICSG+ERL+ ++G
Sbjct: 150 KGRRFTNAHETLIWASKSDKSR-YVFNYASLKTFNDDLQMRSDWLLPICSGNERLKGENG 208

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
           +K+HPTQKPEALL RI+++S++P D+ILDPFFG+GT+G +A+ LRR +IGIE    YI  
Sbjct: 209 QKIHPTQKPEALLYRIILASSRPDDVILDPFFGTGTTGVIARHLRRHWIGIEQDPTYIKA 268

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADG 320
           A  RI   +      +   + KR +PRV F  L+E G I+PG IL +++    A V  DG
Sbjct: 269 AQARIDKAEVFDEALMGQASNKRKQPRVTFGCLMENGFIRPGHILYDSRRRFKAVVNVDG 328

Query: 321 TLISGT-ELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLR 365
            L S     GSIH++GA++  + +CNGW FW+FE+   L  ++ LR
Sbjct: 329 ALQSADGRSGSIHKLGAQLQQAVSCNGWIFWHFEENNILLPLDILR 374


>gi|85373286|ref|YP_457348.1| modification methylase [Erythrobacter litoralis HTCC2594]
 gi|84786369|gb|ABC62551.1| modification methylase [Erythrobacter litoralis HTCC2594]
          Length = 380

 Score =  421 bits (1081), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 195/346 (56%), Positives = 253/346 (73%), Gaps = 2/346 (0%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           +I+ G+ +  +  LP  SVDL+FADPPYNLQL G L RPD S VDAVTD WD+F SF  Y
Sbjct: 30  QILSGDCVEAMRSLPDASVDLVFADPPYNLQLGGDLNRPDGSHVDAVTDHWDQFDSFAIY 89

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFR 141
           D FTR WL   +R+LKP+G LWVIGSYHNI+R+G +LQ+L FWILNDIVWRK+NPMPNFR
Sbjct: 90  DQFTREWLTEAKRILKPDGALWVIGSYHNIYRVGAILQDLGFWILNDIVWRKTNPMPNFR 149

Query: 142 GRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGE 201
           G RF NAHETL+WAS   KAK Y FNY A+K  N+++QMRSDW+IPIC+G+ERL+ ++G 
Sbjct: 150 GTRFTNAHETLLWASQGEKAK-YHFNYTAMKTLNDELQMRSDWVIPICNGAERLK-ENGT 207

Query: 202 KLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIA 261
           K HPTQKPEALL R+L+++T+ GD+++DPFFG+GT+GAVAK+L R +IG E +  Y  +A
Sbjct: 208 KAHPTQKPEALLYRVLLATTEKGDVVVDPFFGTGTTGAVAKRLGREWIGCEREDVYRGVA 267

Query: 262 TKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGT 321
            KRI    PL    L V+  KR  P+VAF  LVE G ++PG  + + +    ATV ADG+
Sbjct: 268 MKRIEKELPLDESALKVMQSKRAAPKVAFGALVEAGFLKPGTEVFDTKRRWVATVRADGS 327

Query: 322 LISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRIL 367
           L  G + GSIH +G ++ G+ +CNGW FW++E  G    ++  R L
Sbjct: 328 LECGKQTGSIHGLGKELQGAPSCNGWTFWHYEDEGVAKPLDAARQL 373


>gi|163852596|ref|YP_001640639.1| DNA methylase N-4/N-6 domain-containing protein [Methylobacterium
           extorquens PA1]
 gi|163664201|gb|ABY31568.1| DNA methylase N-4/N-6 domain protein [Methylobacterium extorquens
           PA1]
          Length = 398

 Score =  421 bits (1081), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 215/352 (61%), Positives = 268/352 (76%), Gaps = 2/352 (0%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLN-GQLYRPDHSLVDAVTDSWDKFSSFE 79
           D+I+ G+ I+ +++LPA+SVD +FADPPYNLQL    L RPD S+VDAV D WDKFSSF 
Sbjct: 45  DEILIGDCIAAMDRLPAESVDCVFADPPYNLQLGEAGLTRPDQSVVDAVDDDWDKFSSFS 104

Query: 80  AYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPN 139
           AYD FTRAWL A RRV+KPN TLWVIGSYHNIFR+G+ LQ+L +WILNDIVWRK+NPMPN
Sbjct: 105 AYDDFTRAWLKAARRVMKPNATLWVIGSYHNIFRVGSALQDLGYWILNDIVWRKANPMPN 164

Query: 140 FRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKD 199
           FRG+RF NAHETLIWAS SP+AK YTF+YDALKA NED+QMRSDW IP+C+G ERL+++ 
Sbjct: 165 FRGKRFTNAHETLIWASRSPQAK-YTFHYDALKAGNEDLQMRSDWFIPLCTGEERLKDEA 223

Query: 200 GEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYID 259
           G K+HPTQKPEALL+R L+++T PGD++LDPFFG+GT+GAVAK+L R FIG E    Y  
Sbjct: 224 GRKVHPTQKPEALLARTLLAATNPGDVVLDPFFGTGTTGAVAKRLGRHFIGCERDPTYAT 283

Query: 260 IATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCAD 319
            A  RI S++ L    L + T KR EPR+ F  +VE G ++PG+ LT+ +    ATV  D
Sbjct: 284 AARARIDSIETLSAASLALATPKRAEPRIPFLSVVEAGHVRPGETLTDERRRFRATVRPD 343

Query: 320 GTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKE 371
           G L  G  +GSIH+VGA V G   CNGW FW+ E+ G+L  I+  R  +R +
Sbjct: 344 GQLSVGPAMGSIHKVGALVQGLPACNGWTFWHAERGGKLVCIDDFRTEMRGQ 395


>gi|148292196|dbj|BAF62911.1| putative adenine DNA methyltransferase [uncultured bacterium]
          Length = 358

 Score =  420 bits (1079), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 209/354 (59%), Positives = 264/354 (74%), Gaps = 2/354 (0%)

Query: 20  KDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFE 79
           KD II GN +  L  LP  SVDL+FADPPYNLQL+G L RPD S+VDAV D WDKF SF 
Sbjct: 3   KDVIICGNCVDQLAGLPDNSVDLVFADPPYNLQLSGNLTRPDQSVVDAVDDDWDKFDSFA 62

Query: 80  AYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPN 139
           AYD  + AWL  CRRVLK +G LWVIGSYHNIFR+G +LQ+L +WILND+VWRKSNPMPN
Sbjct: 63  AYDQLSEAWLRECRRVLKDDGALWVIGSYHNIFRLGRLLQDLGYWILNDVVWRKSNPMPN 122

Query: 140 FRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKD 199
           FRGRRF NAHETLIWA+ S  +K YTFNYDA+KA NE VQMRSDW +PIC+G+ERL+++ 
Sbjct: 123 FRGRRFTNAHETLIWAAKSEASK-YTFNYDAMKALNEGVQMRSDWYMPICTGAERLKDQA 181

Query: 200 GEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYID 259
           G+K HPTQKPE LL+R+++SSTK GD ILDPFFG+GT+GAVA++L R +IGIE  +DY  
Sbjct: 182 GQKAHPTQKPENLLARVILSSTKRGDTILDPFFGTGTTGAVARRLGRHYIGIEQNEDYAK 241

Query: 260 IATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCAD 319
           +A +RIA+VQP+ +  +     KR +PRV F  LVE G +  G  L +   ++ A VCAD
Sbjct: 242 LAAERIAAVQPIVDDVILSTPEKRAQPRVPFGALVEGGWLAAGDTLFDKTKSVRARVCAD 301

Query: 320 GTLISG-TELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           G+L++   + GSIH +GA +    +CNGW +W+  + G+  SI+ LR   RK +
Sbjct: 302 GSLVTDKAQKGSIHGLGATLQNQPSCNGWQYWHVTRDGKDVSIDLLRAEYRKSM 355


>gi|218531437|ref|YP_002422253.1| DNA methylase N-4/N-6 domain protein [Methylobacterium
           chloromethanicum CM4]
 gi|218523740|gb|ACK84325.1| DNA methylase N-4/N-6 domain protein [Methylobacterium
           chloromethanicum CM4]
          Length = 398

 Score =  419 bits (1078), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 214/352 (60%), Positives = 268/352 (76%), Gaps = 2/352 (0%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLN-GQLYRPDHSLVDAVTDSWDKFSSFE 79
           D+I+ G+ I+ +++LPA+SVD +FADPPYNLQL    L RPD S+VDAV D WDKFSSF 
Sbjct: 45  DEILIGDCIAAMDRLPAESVDCVFADPPYNLQLGEAGLTRPDQSVVDAVDDDWDKFSSFS 104

Query: 80  AYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPN 139
           AYD FTRAWL A RRV+KPN TLWVIGSYHNIFR+G+ LQ+L +WILNDIVWRK+NPMPN
Sbjct: 105 AYDDFTRAWLKAARRVMKPNATLWVIGSYHNIFRVGSALQDLGYWILNDIVWRKANPMPN 164

Query: 140 FRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKD 199
           FRG+RF NAHETLIWAS SP+AK YTF+YDALKA NED+QMRSDW IP+C+G ERL+++ 
Sbjct: 165 FRGKRFTNAHETLIWASRSPQAK-YTFHYDALKAGNEDLQMRSDWFIPLCTGEERLKDEA 223

Query: 200 GEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYID 259
           G K+HPTQKPEALL+R L+++T PGD++LDPFFG+GT+GAVAK+L R FIG E    Y  
Sbjct: 224 GRKVHPTQKPEALLARTLLAATNPGDVVLDPFFGTGTTGAVAKRLGRHFIGCERDPTYAT 283

Query: 260 IATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCAD 319
            A  RI  ++ L    L + T KR+EPR+ F  +VE G ++PG+ LT+ +    ATV  D
Sbjct: 284 AARARIDGIETLSAASLALATPKRSEPRIPFLSVVEAGHVRPGETLTDERRRFRATVRPD 343

Query: 320 GTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKE 371
           G L  G  +GSIH+VGA V G   CNGW FW+ E+ G+L  I+  R  +R +
Sbjct: 344 GQLSVGPAMGSIHKVGALVQGLPACNGWTFWHAERSGKLVCIDDFRTEMRGQ 395


>gi|241761782|ref|ZP_04759868.1| DNA methylase N-4/N-6 domain protein [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|241373696|gb|EER63256.1| DNA methylase N-4/N-6 domain protein [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
          Length = 382

 Score =  419 bits (1078), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 197/346 (56%), Positives = 256/346 (73%), Gaps = 2/346 (0%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           + I+ GN I +L+ LP  SVDLIFADPPYNLQL+G+L+RP+ S VDAV ++WDKF +F A
Sbjct: 30  NSILAGNCIEILKTLPDNSVDLIFADPPYNLQLSGELFRPEGSRVDAVNNAWDKFDTFAA 89

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YD FT  WL    RVLK +GT+WVIGSYHNIFR+GT LQ+  FWILNDI+WRKSNPMPNF
Sbjct: 90  YDHFTCLWLKEAHRVLKEDGTIWVIGSYHNIFRVGTALQDQGFWILNDIIWRKSNPMPNF 149

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           +GRRF NAHETLIWAS S K++ Y FNY +LK  N+D+QMRSDWL+PICSG+ERL+ ++G
Sbjct: 150 KGRRFTNAHETLIWASKSDKSR-YVFNYASLKTFNDDLQMRSDWLLPICSGNERLKGENG 208

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
           +K+HPTQKPEALL RI+++S++P D+ILDPFFG+GT+G +A+ LRR +IGIE    YI  
Sbjct: 209 QKIHPTQKPEALLYRIILASSRPDDVILDPFFGTGTTGVIARHLRRHWIGIEQDPTYIKA 268

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADG 320
           A  RI   +      +   + KR +PRV F  L+E G I+PG IL +++    A V  DG
Sbjct: 269 AQARIDKAEVFDEALMGQASNKRKQPRVTFGCLMENGFIRPGHILYDSRRRFKAVVNVDG 328

Query: 321 TLISGT-ELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLR 365
            L S     GSIH++GA++  + +CNGW FW+FE+   L  ++ LR
Sbjct: 329 ALQSADGRSGSIHKLGAQLQQAVSCNGWIFWHFEENNILLPLDILR 374


>gi|254562354|ref|YP_003069449.1| site-specific DNA-methyltransferase [Methylobacterium extorquens
           DM4]
 gi|254269632|emb|CAX25603.1| site-specific DNA-methyltransferase (adenine-specific)
           [Methylobacterium extorquens DM4]
          Length = 398

 Score =  418 bits (1075), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 214/352 (60%), Positives = 267/352 (75%), Gaps = 2/352 (0%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLN-GQLYRPDHSLVDAVTDSWDKFSSFE 79
           D+I+ G+ I+ +++LPA+SVD +FADPPYNLQL    L RPD S+VDAV D WDKFSSF 
Sbjct: 45  DEILIGDCIAAMDRLPAESVDCVFADPPYNLQLGEAGLTRPDQSVVDAVDDDWDKFSSFS 104

Query: 80  AYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPN 139
           AYD FTRAWL A RRV+KPN TLWVIGSYHNIFR+G+ LQ+L +WILNDIVWRK+NPMPN
Sbjct: 105 AYDDFTRAWLKAARRVMKPNATLWVIGSYHNIFRVGSALQDLGYWILNDIVWRKANPMPN 164

Query: 140 FRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKD 199
           FRG+RF NAHETLIWAS SP+AK YTF+YDALKA NED+QMRSDW IP+C+G ERL+++ 
Sbjct: 165 FRGKRFTNAHETLIWASRSPQAK-YTFHYDALKAGNEDLQMRSDWFIPLCTGEERLKDEA 223

Query: 200 GEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYID 259
           G K+HPTQKPEALL+R L+++T PGD++LDPFFG+GT+GAVAK+L R FIG E    Y  
Sbjct: 224 GRKVHPTQKPEALLARTLLAATNPGDVVLDPFFGTGTTGAVAKRLGRHFIGCERDPTYAT 283

Query: 260 IATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCAD 319
            A  RI S++ L    L +   KR EPR+ F  +VE G ++PG+ LT+ +    ATV  D
Sbjct: 284 AARARIDSIETLSAASLALAMPKRAEPRIPFLSVVEAGHVRPGETLTDERRRFRATVRPD 343

Query: 320 GTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKE 371
           G L  G  +GSIH+VGA V G   CNGW FW+ E+ G+L  I+  R  +R +
Sbjct: 344 GQLSVGPAMGSIHKVGALVQGLPACNGWTFWHAERGGKLVCIDDFRTEMRGQ 395


>gi|254456346|ref|ZP_05069775.1| site-specific DNA methyltransferase [Candidatus Pelagibacter sp.
           HTCC7211]
 gi|207083348|gb|EDZ60774.1| site-specific DNA methyltransferase [Candidatus Pelagibacter sp.
           HTCC7211]
          Length = 356

 Score =  417 bits (1072), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 192/348 (55%), Positives = 259/348 (74%), Gaps = 2/348 (0%)

Query: 18  EWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSS 77
           ++K+KII G+S+  L+K+P+++ DL+FADPPYNLQL  +L RPD S V AV D WD+F +
Sbjct: 4   DFKNKIINGDSLEELKKIPSETFDLVFADPPYNLQLKNKLTRPDRSKVSAVDDKWDQFEN 63

Query: 78  FEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPM 137
           F+ YD FT AWL  C+R+LK NG +WVIGSYHNIFR+GT +QNL FWILND++W K+NPM
Sbjct: 64  FKKYDEFTYAWLTECKRILKKNGAIWVIGSYHNIFRVGTTIQNLGFWILNDVIWNKNNPM 123

Query: 138 PNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRN 197
           PNFRG RF NAHETLIWAS S K+K YTFNY +LK  N+D+QMRS+W +PIC+G+ERL+ 
Sbjct: 124 PNFRGTRFTNAHETLIWASKSEKSK-YTFNYQSLKCLNDDLQMRSNWNLPICNGTERLK- 181

Query: 198 KDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDY 257
           K+G+K+H TQKPEALL RIL++S+   D+ILDPF GSGT+  VAKKL R+F GIE ++ Y
Sbjct: 182 KNGKKVHSTQKPEALLHRILLASSNKDDMILDPFLGSGTTATVAKKLGRNFYGIEKEKTY 241

Query: 258 IDIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVC 317
              A KRI + +P  +  L  L   R++PR+ F  LVE G+I+PG  + + +  I+A + 
Sbjct: 242 FKAAEKRIKNAKPFEDNFLDTLKNNRSKPRIPFGSLVELGIIKPGTNIFDNKKKITARIM 301

Query: 318 ADGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLR 365
           ADG++      GSIH+V A + G+E+CNGW +W+ +  G  + I+ LR
Sbjct: 302 ADGSIKHNQAEGSIHKVAATILGAESCNGWTYWHCDINGRTYPIDYLR 349


>gi|114798609|ref|YP_760602.1| modification methylase CcrM [Hyphomonas neptunium ATCC 15444]
 gi|114738783|gb|ABI76908.1| modification methylase CcrM [Hyphomonas neptunium ATCC 15444]
          Length = 360

 Score =  412 bits (1058), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 192/354 (54%), Positives = 254/354 (71%), Gaps = 2/354 (0%)

Query: 20  KDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFE 79
           ++ II+G+ I VL ++P KSVDL+FADPPYNLQL G L RPD S+VD V D WDKF+SF+
Sbjct: 5   RNTIIQGDCIEVLSRIPDKSVDLVFADPPYNLQLGGGLTRPDQSVVDGVDDEWDKFASFD 64

Query: 80  AYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPN 139
            YD FT  WL  CRRVLK +G +WVIGSYHNIFR+GT+LQ+  FWI ND++W KSNPMPN
Sbjct: 65  DYDLFTHQWLEECRRVLKDDGAIWVIGSYHNIFRVGTVLQDQGFWIQNDVIWLKSNPMPN 124

Query: 140 FRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKD 199
           F+G RFQNAHETLIWA  S  ++  TFNYDALK  NED QMRSDW IP+C+G ERL+++ 
Sbjct: 125 FKGTRFQNAHETLIWAGKSKDSR-VTFNYDALKTFNEDKQMRSDWTIPLCTGGERLKDEA 183

Query: 200 GEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYID 259
           G K HPTQKPE+LL R+L++++ P D++LDPF G+GT+ A A++L R FIGIE ++ Y  
Sbjct: 184 GRKAHPTQKPESLLHRVLLATSNPRDLVLDPFSGTGTTAAAARRLGRDFIGIEREEGYAR 243

Query: 260 IATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCAD 319
           ++  RI ++ PL    L     K++  RV F  L+E G ++PG  L +AQ    A +  D
Sbjct: 244 LSRARINAITPLEGEVLETERSKKSLARVPFGALIETGWLKPGDRLFSAQRRHQARIRVD 303

Query: 320 GTLISGTELGSIHRVGAKVSGSETCNGWNFWYFE-KLGELHSINTLRILVRKEL 372
           G+L +G   GSIHR+GA+V  +  CNGW +W++E    +L  I+ LR   R+E+
Sbjct: 304 GSLTTGAITGSIHRLGAQVQQAPACNGWTYWHYETDKRDLAPIDLLRRRYREEM 357


>gi|188582617|ref|YP_001926062.1| DNA methylase N-4/N-6 domain protein [Methylobacterium populi
           BJ001]
 gi|179346115|gb|ACB81527.1| DNA methylase N-4/N-6 domain protein [Methylobacterium populi
           BJ001]
          Length = 370

 Score =  411 bits (1056), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 212/350 (60%), Positives = 265/350 (75%), Gaps = 2/350 (0%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLN-GQLYRPDHSLVDAVTDSWDKFSSFE 79
           D+I+ G+ I+ +++LPA+SVD +FADPPYNLQL    L RPD S+VDAV D WDKFSSF 
Sbjct: 17  DEILIGDCIAAMDRLPAESVDCVFADPPYNLQLGEAGLTRPDQSVVDAVDDDWDKFSSFA 76

Query: 80  AYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPN 139
           AYD FTRAWL A RRV+KPN TLWVIGSYHNIFR+G+ LQ+L +WILNDIVWRK+NPMPN
Sbjct: 77  AYDDFTRAWLKAARRVMKPNATLWVIGSYHNIFRVGSALQDLGYWILNDIVWRKANPMPN 136

Query: 140 FRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKD 199
           FRG+RF NAHETLIWAS SP+AK YTF+YDALKA NED+QMRSDW IP+C+G ERL+++ 
Sbjct: 137 FRGKRFTNAHETLIWASRSPQAK-YTFHYDALKAGNEDLQMRSDWFIPLCTGEERLKDEA 195

Query: 200 GEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYID 259
           G K+HPTQKPEALL+R L+++T PGD++LDPFFG+GT+GAVA++L R FIG E    Y  
Sbjct: 196 GRKVHPTQKPEALLARTLLAATNPGDVVLDPFFGTGTTGAVARRLGRHFIGCERDPTYAA 255

Query: 260 IATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCAD 319
            A  RI  ++ L    L + T KR EPR+ F  +VE G ++ G+ LT+ +    ATV  D
Sbjct: 256 AARTRIDGIETLSAASLALATPKRAEPRIPFLSVVEAGHVRAGETLTDERRRFRATVRPD 315

Query: 320 GTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVR 369
           G L  G  +GSIH+VGA V G   CNGW FW+ E+ G+L  I+  R  +R
Sbjct: 316 GQLSVGPAMGSIHKVGALVQGLPACNGWTFWHAERGGKLICIDDYRSEMR 365


>gi|162149132|ref|YP_001603593.1| DNA methylase [Gluconacetobacter diazotrophicus PAl 5]
 gi|209545124|ref|YP_002277353.1| DNA methylase N-4/N-6 domain-containing protein [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161787709|emb|CAP57305.1| putative DNA methylase [Gluconacetobacter diazotrophicus PAl 5]
 gi|209532801|gb|ACI52738.1| DNA methylase N-4/N-6 domain protein [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 370

 Score =  411 bits (1056), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 197/345 (57%), Positives = 257/345 (74%), Gaps = 1/345 (0%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           D+I++G+ + +++ LP  S+D IFADPPYNLQL G+L RPD S+VD V D WDKFS    
Sbjct: 12  DQILRGDCVELMQTLPTGSIDCIFADPPYNLQLRGELRRPDDSVVDGVDDDWDKFSDLAE 71

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YD FTRAWL   RR+L+ +GT+WVIGSYHNIFRIG +LQ+L FWILND++WRKSNPMPNF
Sbjct: 72  YDRFTRAWLGEARRLLRKDGTIWVIGSYHNIFRIGAILQDLGFWILNDVIWRKSNPMPNF 131

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           RGRRF NAHETLIWA+    ++ Y FNY A+KA N+DVQMRSDW +P+C+G ERLRN  G
Sbjct: 132 RGRRFTNAHETLIWAARGADSR-YRFNYQAMKALNDDVQMRSDWYLPLCTGGERLRNSHG 190

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
            KLHPTQKPE+LL R+LV+ST   DI+LDPF G+GT+ A+A++LRR FIGIE   DY + 
Sbjct: 191 LKLHPTQKPESLLHRVLVASTNVDDIVLDPFAGTGTTTAMARRLRRRFIGIERHPDYAEA 250

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADG 320
           A  R    +P+    +     KR  PRV F  LVERGL+  G ++ +    +SATV  DG
Sbjct: 251 AIGRARRERPVPLDSVLTTPAKRETPRVPFGSLVERGLLPVGTVMYDRHQRVSATVAPDG 310

Query: 321 TLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLR 365
           TL+SGT+ GSIH++GA ++ + +CNGW FW+ ++ G++  ++TLR
Sbjct: 311 TLVSGTQRGSIHKLGALLTNAPSCNGWTFWHLQRDGQMIPLDTLR 355


>gi|71082817|ref|YP_265536.1| site-specific DNA methyltransferase [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|71061930|gb|AAZ20933.1| site-specific DNA methyltransferase [Candidatus Pelagibacter ubique
           HTCC1062]
          Length = 356

 Score =  410 bits (1055), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 191/347 (55%), Positives = 255/347 (73%), Gaps = 2/347 (0%)

Query: 19  WKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSF 78
           +K+KII G+S+  L+K+P+++ DL+FADPPYNLQL   L RPD S V+AV D WD F SF
Sbjct: 5   FKNKIINGDSLEELKKIPSETFDLVFADPPYNLQLKNSLTRPDRSKVNAVNDKWDHFESF 64

Query: 79  EAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
           + YD FT AWL  C+R+LK +G +WVIGSYHNIFR+GT +QNL FWILND++W K+NPMP
Sbjct: 65  KKYDEFTVAWLSECKRILKKDGAIWVIGSYHNIFRVGTAIQNLGFWILNDVIWNKNNPMP 124

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
           NFRG RF NAHETLIWAS S K+K YTFNY +LK  N+D+QMRSDW +PIC+G+ERL+ K
Sbjct: 125 NFRGTRFTNAHETLIWASKSEKSK-YTFNYQSLKCLNDDLQMRSDWNLPICNGAERLK-K 182

Query: 199 DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYI 258
           +G+K+H TQKPE+LL R+L++S+  GD+ILDPF GSGT+  VAKKL R + GIE ++ Y 
Sbjct: 183 NGKKVHSTQKPESLLHRVLLASSNKGDMILDPFLGSGTTATVAKKLGRKYYGIEKEKVYF 242

Query: 259 DIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCA 318
             A +R+ + +PL +  L  L   R++PR+ F  LVE G+I+PG  + + +  I A + A
Sbjct: 243 KAAEERLKNTKPLEDNFLDTLKNNRSKPRIPFGSLVELGIIKPGTSIFDQKKKIVAKIMA 302

Query: 319 DGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLR 365
           DG++      GSIH+V A + GSE+CNGW +W+    G    I+ LR
Sbjct: 303 DGSIKHNQAEGSIHKVAATILGSESCNGWTYWHCTVNGVSVPIDNLR 349


>gi|58038819|ref|YP_190783.1| adenine DNA methyltransferase [Gluconobacter oxydans 621H]
 gi|58001233|gb|AAW60127.1| Adenine DNA methyltransferase [Gluconobacter oxydans 621H]
          Length = 361

 Score =  410 bits (1053), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 194/345 (56%), Positives = 256/345 (74%), Gaps = 1/345 (0%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           D+I++G  I  ++ LP  SVD IFADPPYNLQL G+L RPD ++VD V D WDKF+ +  
Sbjct: 8   DQILRGECIETMKTLPDGSVDCIFADPPYNLQLRGELRRPDETVVDGVDDDWDKFADYAT 67

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YD FTR WL   RR+L  +GT+WVIGSYHN+FR+G ++Q+L FWILNDIVWRKSNPMPNF
Sbjct: 68  YDNFTREWLSEARRILHKDGTIWVIGSYHNVFRLGAIMQDLGFWILNDIVWRKSNPMPNF 127

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           RGRRF NAHETLIWA+  P++K Y FNY A+KA N+D+QMRSDW +P+C+G+ERL+N+ G
Sbjct: 128 RGRRFTNAHETLIWAARGPQSK-YRFNYQAMKALNDDLQMRSDWYLPLCTGNERLKNEHG 186

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
            KLHPTQKPE+LL R+LV+ST   D++LDPF GSGT+ A+AK+L R +I IE   DY+  
Sbjct: 187 LKLHPTQKPESLLHRVLVASTNANDVVLDPFCGSGTTPAMAKRLGRHYIAIERHPDYVKA 246

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADG 320
           A +R+A  + L + +L     KR  PR+ F   VE G++  G +L + Q  + ATV  DG
Sbjct: 247 ARERVAREERLTSEQLATTPAKREMPRIPFGSFVETGVLPAGTLLYDRQKRLKATVTPDG 306

Query: 321 TLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLR 365
           TL+SG + GSIH++GA ++ + +CNGW FWYFE+ G+   I+ LR
Sbjct: 307 TLVSGNQRGSIHKLGAMLTNAPSCNGWTFWYFERDGQYVQIDVLR 351


>gi|255603684|ref|XP_002538097.1| Modification methylase CcrMI, putative [Ricinus communis]
 gi|223513836|gb|EEF24286.1| Modification methylase CcrMI, putative [Ricinus communis]
          Length = 311

 Score =  410 bits (1053), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 190/298 (63%), Positives = 229/298 (76%), Gaps = 1/298 (0%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           + II+G+ I  +  LP KSVDLIFADPPYNLQL G L RPD+S VDAV D WD+F SF A
Sbjct: 6   ETIIQGDCIEAMNALPEKSVDLIFADPPYNLQLGGDLLRPDNSKVDAVDDHWDQFESFAA 65

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YD FTR WL A RRVLK +G +WVIGSYHNIFR+G  +Q+L FWILND++WRK+NPMPNF
Sbjct: 66  YDKFTREWLKAARRVLKDDGAIWVIGSYHNIFRVGVAVQDLGFWILNDVIWRKTNPMPNF 125

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           +G RF NAHETLIWAS S  AK YTFNYDALK AN++VQMRSDW IP+C+G ER++  DG
Sbjct: 126 KGTRFANAHETLIWASKSQNAKRYTFNYDALKMANDEVQMRSDWTIPLCTGEERIKGADG 185

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
           +K HPTQKPEALL R+++S+TKPGD+ILDPFFG GT+GA AK+L R FIGIE + +YI+ 
Sbjct: 186 QKAHPTQKPEALLYRVILSTTKPGDVILDPFFGVGTTGAAAKRLGRKFIGIEREAEYIEH 245

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCA 318
           A  RIA V P+   +L +   KR EPRV F  +VE GL+ PG  L  A+G  +A  CA
Sbjct: 246 ARTRIAQVTPIAPQDLEMTGSKRAEPRVPFGAIVENGLLHPGDTLYCAKGAHAAK-CA 302


>gi|91762760|ref|ZP_01264725.1| site-specific DNA methyltransferase [Candidatus Pelagibacter ubique
           HTCC1002]
 gi|91718562|gb|EAS85212.1| site-specific DNA methyltransferase [Candidatus Pelagibacter ubique
           HTCC1002]
          Length = 356

 Score =  408 bits (1049), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 190/347 (54%), Positives = 254/347 (73%), Gaps = 2/347 (0%)

Query: 19  WKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSF 78
           +K+KII G+S+  L+K+P+++ DL+FADPPYNLQL   L RPD S V AV D WD+F SF
Sbjct: 5   FKNKIINGDSLEELKKIPSETFDLVFADPPYNLQLKNSLTRPDRSKVSAVNDKWDQFESF 64

Query: 79  EAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
           + YD FT AWL  CRR+LK +G +WVIGSYHNIFR+GT +QNL FWILND++W K+NPMP
Sbjct: 65  KKYDDFTVAWLSECRRILKKDGAIWVIGSYHNIFRVGTAIQNLGFWILNDVIWNKNNPMP 124

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
           NFRG RF NAHETLIWAS S K+K YTFNY +LK  N+D+QMRS+W +PIC+G+ERL+ K
Sbjct: 125 NFRGTRFTNAHETLIWASKSEKSK-YTFNYQSLKCLNDDLQMRSNWNLPICNGAERLK-K 182

Query: 199 DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYI 258
           +G+K+H TQKPE+LL R+L++S+   D+ILDPF GSGT+  VAKKL R + GIE ++ Y 
Sbjct: 183 NGKKVHSTQKPESLLHRVLLASSNKDDLILDPFLGSGTTATVAKKLGRKYYGIEKEKTYF 242

Query: 259 DIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCA 318
             A +R+ + +PL +  L  L   R++PR+ F  LVE G+I+PG  + + +  I A + A
Sbjct: 243 KAAEERLKNTKPLEDNFLDTLKNNRSKPRIPFGSLVELGIIKPGTSIFDQKKKIVAKIMA 302

Query: 319 DGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLR 365
           DG++      GSIH+V A + GSE+CNGW +W+    G    I+ LR
Sbjct: 303 DGSIKHNQAEGSIHKVAATILGSESCNGWTYWHCTVNGVSVPIDNLR 349


>gi|304319996|ref|YP_003853639.1| modification methylase [Parvularcula bermudensis HTCC2503]
 gi|303298899|gb|ADM08498.1| modification methylase [Parvularcula bermudensis HTCC2503]
          Length = 344

 Score =  406 bits (1044), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 194/341 (56%), Positives = 253/341 (74%), Gaps = 2/341 (0%)

Query: 32  LEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLA 91
           ++ +P  SVDLIFADPPYNLQL   L RPD S VD V D+WD+F SF AYDAF RAWL  
Sbjct: 1   MKMIPDGSVDLIFADPPYNLQLGDGLTRPDQSTVDGVNDAWDQFGSFAAYDAFCRAWLSE 60

Query: 92  CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHET 151
            RR+LKP+G +WVIG+YHNIFR+G+++Q+L +WI ND+VW K+NPMPNFRG R QNAHET
Sbjct: 61  ARRLLKPDGAIWVIGTYHNIFRLGSIIQDLEYWIQNDVVWVKTNPMPNFRGTRLQNAHET 120

Query: 152 LIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPEA 211
           LIWA+   +++  TFNY +LK AN+D+QMRSDW  P+C+G ERL+N  G+KLHPTQKPEA
Sbjct: 121 LIWAARGKESRP-TFNYHSLKTANDDLQMRSDWTFPLCTGQERLKN-GGKKLHPTQKPEA 178

Query: 212 LLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPL 271
           LL RIL+ +T PGD++LDPFFG+GT+GAVAK+L R +IGIE +  YID A +RIA+++P 
Sbjct: 179 LLHRILLGTTNPGDLVLDPFFGTGTTGAVAKRLGRHYIGIEREAAYIDAAAERIAAIEPE 238

Query: 272 GNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTLISGTELGSI 331
               +T +   R E R+ F  LVE GL+ PG +L  A+    A V ADG+L +    GSI
Sbjct: 239 AAEMVTPMPSPRREARIPFGRLVEDGLLSPGTVLYCAKRRYRAKVKADGSLATPGATGSI 298

Query: 332 HRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           H++GA +  + +CNGW FW+ E+ G L  I+TLR  VR ++
Sbjct: 299 HKIGAHLQNAPSCNGWTFWHVERQGRLLPIDTLRQTVRAQM 339


>gi|148654551|ref|YP_001274756.1| DNA methylase N-4/N-6 domain-containing protein [Roseiflexus sp.
           RS-1]
 gi|148566661|gb|ABQ88806.1| DNA methylase N-4/N-6 domain protein [Roseiflexus sp. RS-1]
          Length = 373

 Score =  406 bits (1043), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 197/354 (55%), Positives = 260/354 (73%), Gaps = 5/354 (1%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           ++II+G+ + VL+  PAKSVDLIFADPPYNLQL  QL RP+ ++VD V D WD+F++   
Sbjct: 18  NEIIQGDCVEVLKTFPAKSVDLIFADPPYNLQLRNQLLRPNQTVVDGVDDEWDQFANVAE 77

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YDAFTR WL ACRRVLK +GT+WVIGSYHNIFRIGT++ +L +WILND++W K+NPMPNF
Sbjct: 78  YDAFTRNWLSACRRVLKDDGTIWVIGSYHNIFRIGTIMMDLGYWILNDVIWYKTNPMPNF 137

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           RG RFQNA ETLIWA  S + K YTFNY A+K  N++ QM++ W IP+C+G ER++  +G
Sbjct: 138 RGTRFQNATETLIWAKKSVEQKKYTFNYHAMKHLNDEKQMQNVWHIPLCTGPERIK-LNG 196

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
           +K+H TQKPEALL R++++S+ PGD++LDPFFGSGT+GAVAKKL+R++IGIE++  YIDI
Sbjct: 197 KKVHSTQKPEALLYRVILASSNPGDVVLDPFFGSGTTGAVAKKLKRNYIGIELEPAYIDI 256

Query: 261 ATKRIASVQPLGNIELTVLT--GKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCA 318
           A KRI ++ P+  ++ T L    KRT PRV+F  L+E   I  GQ + +    + ATV A
Sbjct: 257 ARKRIDTL-PMSLLDETELVTPSKRTVPRVSFGQLIESHYITVGQKVFSKDRKVVATVKA 315

Query: 319 DGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFE-KLGELHSINTLRILVRKE 371
           D  L+ G   GSIHR+ A        NGW +WY E + G + SI+ LR   R E
Sbjct: 316 DSHLLWGNVTGSIHRIAALAQNKPAFNGWEYWYCEDQEGNVISIDALRERYRIE 369


>gi|309792788|ref|ZP_07687231.1| DNA methylase N-4/N-6 domain-containing protein [Oscillochloris
           trichoides DG6]
 gi|308225152|gb|EFO78937.1| DNA methylase N-4/N-6 domain-containing protein [Oscillochloris
           trichoides DG6]
          Length = 357

 Score =  405 bits (1041), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 190/353 (53%), Positives = 254/353 (71%), Gaps = 3/353 (0%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           + I+ G+ I +L  LP K VDLIFADPPYNLQL  +L RP+ ++VDAVTD+WD+F+ F A
Sbjct: 2   NHILHGSCIDLLPSLPEKCVDLIFADPPYNLQLQNELIRPNQTVVDAVTDTWDQFADFAA 61

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YD FT  WL ACRRVLK +GT+WVIGSYHNIFR+G ++ +L +WILND++W K+NPMPNF
Sbjct: 62  YDHFTEQWLSACRRVLKDDGTIWVIGSYHNIFRVGKIMMDLGYWILNDVIWHKTNPMPNF 121

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           RG RFQNA ET+IWA  S + K YTF+Y A+K  N+D QM++ W IP+C+G+ER++  DG
Sbjct: 122 RGTRFQNATETMIWAKKSREQKKYTFHYQAMKNFNDDKQMQNVWYIPLCTGAERIK-IDG 180

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
           +K H TQKPEALL R+LV+S+ PGD++LDPFFGSGT+GAVAK+L+R++IGIE   +Y++I
Sbjct: 181 KKAHSTQKPEALLYRVLVASSNPGDMVLDPFFGSGTTGAVAKRLQRNYIGIERSAEYVEI 240

Query: 261 ATKRIASVQPLGNIELTVLT-GKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCAD 319
           A +RIA++         +LT  KR  PR++F  L+E   I  GQ + +    ++A V AD
Sbjct: 241 ARQRIAAISATCLEHGELLTRSKRNAPRISFGQLLEAQYISVGQPIFSQDRAVTAIVKAD 300

Query: 320 GTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEK-LGELHSINTLRILVRKE 371
             LI   + GSIH++ A V      NGW +WY+E   G L SI+ LR   R E
Sbjct: 301 AQLICNDQTGSIHKIAASVQNRAAANGWEYWYYEDAAGNLVSIDELRERYRHE 353


>gi|156742203|ref|YP_001432332.1| DNA methylase N-4/N-6 domain-containing protein [Roseiflexus
           castenholzii DSM 13941]
 gi|156233531|gb|ABU58314.1| DNA methylase N-4/N-6 domain protein [Roseiflexus castenholzii DSM
           13941]
          Length = 369

 Score =  403 bits (1035), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 193/361 (53%), Positives = 258/361 (71%), Gaps = 8/361 (2%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           ++II+G+ + +L  LP  S+DLIFADPPY+LQL  +L+RP+ + VDAV D WDKF S +A
Sbjct: 6   NQIIEGDCVEILNTLPETSIDLIFADPPYHLQLQNELHRPNMTKVDAVDDDWDKFESMQA 65

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YD FTR WL AC+RVLKP GT+WVIG+YHNIFR+G M+Q+L FWILND++W K NPMPNF
Sbjct: 66  YDEFTRTWLTACKRVLKPTGTIWVIGTYHNIFRVGAMMQDLGFWILNDVIWIKLNPMPNF 125

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSD-WLIPICSGSERLRNKD 199
           RG RF NAHETLIWAS    A  YTFNY A+K  N++ QMRSD WL+P+ +GSER++N+ 
Sbjct: 126 RGVRFTNAHETLIWASTGKDAT-YTFNYYAMKGLNDEKQMRSDWWLLPLATGSERVKNEH 184

Query: 200 GEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYID 259
           G+K H TQKPEALL R+++SS+ PGD++LDPFFGSGT+G VAK+L R++IGIE ++ Y+ 
Sbjct: 185 GDKAHSTQKPEALLYRVILSSSNPGDVVLDPFFGSGTTGVVAKRLHRNWIGIEKEKRYVQ 244

Query: 260 IATKRIASVQP--LGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNIS-ATV 316
           IA KRI ++QP         V +  ++ P+V F++LVE G +QPGQ L   +     AT+
Sbjct: 245 IAQKRIDAMQPEMFDAATFDVKSKAKSAPKVEFSVLVEHGYVQPGQRLFFGKDKTKVATI 304

Query: 317 CADGTLISGTEL-GSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLR--ILVRKELY 373
             D  L +     GSIH+ G+    +  CNGW  W+ E  G++ S++ +R    V K LY
Sbjct: 305 KPDARLRTADGFEGSIHQAGSHYMNNAPCNGWEHWFIEVDGQMISLDEVREKFRVDKGLY 364

Query: 374 N 374
           N
Sbjct: 365 N 365


>gi|148260450|ref|YP_001234577.1| DNA methylase N-4/N-6 domain-containing protein [Acidiphilium
           cryptum JF-5]
 gi|146402131|gb|ABQ30658.1| DNA methylase N-4/N-6 domain protein [Acidiphilium cryptum JF-5]
          Length = 360

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 186/349 (53%), Positives = 256/349 (73%), Gaps = 1/349 (0%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           D+++ G+++ ++  LP  S+D +FADPPYNLQL G+L RPD S+VD V D WDKF+ F A
Sbjct: 12  DQLLLGDAVEMMRMLPDASIDCVFADPPYNLQLRGELRRPDDSVVDGVDDDWDKFTDFAA 71

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YD F+RAWL   RR++  + T+WVIGSYHNIFR+G ++Q+L FWILND++WRK+NPMPNF
Sbjct: 72  YDEFSRAWLSEARRLMHKDATIWVIGSYHNIFRLGAIMQDLGFWILNDVIWRKTNPMPNF 131

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           RGRRF NAHETLIWA+  PK++ Y FNY A+K+ N+D QMRSDW IP+C+G ERLRN+ G
Sbjct: 132 RGRRFTNAHETLIWAAREPKSR-YRFNYQAMKSLNDDTQMRSDWTIPLCTGGERLRNQHG 190

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
            KLHPTQKPEALL R+++++T P D++LDPF G+ T+  VAK+L R FIGIE    Y++ 
Sbjct: 191 LKLHPTQKPEALLHRVILAATNPDDVVLDPFSGTATTATVAKRLNRHFIGIERHPAYVEA 250

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADG 320
              R+  ++         +  +R  PR+AF +LVERGL+ PG +L +    +SATV AD 
Sbjct: 251 GWARLREMRAAPAHLTRPMPSRREAPRIAFGVLVERGLVPPGTLLHDRLRRVSATVAADA 310

Query: 321 TLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVR 369
           ++I+G   GSIH+VGA V  + +CNGW FW+ E+ G L +++ +R  +R
Sbjct: 311 SIIAGAHRGSIHQVGAAVQNAASCNGWTFWHIEREGRLVALDHVRETLR 359


>gi|326403643|ref|YP_004283725.1| hypothetical protein ACMV_14960 [Acidiphilium multivorum AIU301]
 gi|325050505|dbj|BAJ80843.1| hypothetical protein ACMV_14960 [Acidiphilium multivorum AIU301]
          Length = 358

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 186/349 (53%), Positives = 256/349 (73%), Gaps = 1/349 (0%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           D+++ G+++ ++  LP  S+D +FADPPYNLQL G+L RPD S+VD V D WDKF+ F A
Sbjct: 10  DQLLLGDAVEMMRMLPDASIDCVFADPPYNLQLRGELRRPDDSVVDGVDDDWDKFTDFAA 69

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YD F+RAWL   RR++  + T+WVIGSYHNIFR+G ++Q+L FWILND++WRK+NPMPNF
Sbjct: 70  YDEFSRAWLSEARRLMHKDATIWVIGSYHNIFRLGAIMQDLGFWILNDVIWRKTNPMPNF 129

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           RGRRF NAHETLIWA+  PK++ Y FNY A+K+ N+D QMRSDW IP+C+G ERLRN+ G
Sbjct: 130 RGRRFTNAHETLIWAAREPKSR-YRFNYQAMKSLNDDTQMRSDWTIPLCTGGERLRNQHG 188

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
            KLHPTQKPEALL R+++++T P D++LDPF G+ T+  VAK+L R FIGIE    Y++ 
Sbjct: 189 LKLHPTQKPEALLHRVILAATNPDDVVLDPFSGTATTATVAKRLNRHFIGIERHPAYVEA 248

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADG 320
              R+  ++         +  +R  PR+AF +LVERGL+ PG +L +    +SATV AD 
Sbjct: 249 GWARLREMRAAPAHLTRPMPSRREAPRIAFGVLVERGLVPPGTLLHDRLRRVSATVAADA 308

Query: 321 TLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVR 369
           ++I+G   GSIH+VGA V  + +CNGW FW+ E+ G L +++ +R  +R
Sbjct: 309 SIIAGAHRGSIHQVGAAVQNAASCNGWTFWHIEREGRLVALDHVRETLR 357


>gi|49420962|gb|AAT65821.1| M.EsaWC2I [uncultured bacterium]
          Length = 366

 Score =  402 bits (1033), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 193/357 (54%), Positives = 253/357 (70%), Gaps = 6/357 (1%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           ++II+G+ I  L   P KS+DLIFADPPYNLQL  +L+RP+ + VDAV D WDKF S +A
Sbjct: 6   NQIIEGDCIETLSTFPEKSIDLIFADPPYNLQLQNELHRPNMTKVDAVDDQWDKFESLQA 65

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YD FTR WL AC+RVLKP GT+WVIG+YHNIFR+G ++Q+L FWILND++W K+NPMPNF
Sbjct: 66  YDEFTRRWLTACKRVLKPTGTIWVIGTYHNIFRVGAIMQDLGFWILNDVIWIKTNPMPNF 125

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSD-WLIPICSGSERLRNKD 199
           RG RF NAHETLIWAS + K   YTFN+ A+K  N+D QMRSD WL+ + +GSER+++  
Sbjct: 126 RGVRFTNAHETLIWAS-TGKGATYTFNHQAMKGLNDDKQMRSDWWLLSLATGSERVKDDH 184

Query: 200 GEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYID 259
           GEK H TQKPEALL R+++SS+ PGD++LDPFFGSGT+G VAK+L R++IG+E ++ YI+
Sbjct: 185 GEKAHSTQKPEALLYRVILSSSNPGDVVLDPFFGSGTTGVVAKRLHRNWIGVEREKKYIE 244

Query: 260 IATKRIASVQP--LGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQIL-TNAQGNISATV 316
           IA KRI +VQP     +   V +  +T PRV F+ LVE G +QPGQ L      N  A +
Sbjct: 245 IARKRIDAVQPEVFNPVVFDVRSKAKTAPRVEFSTLVEHGYVQPGQTLFFRKDTNKVAFI 304

Query: 317 CADGTLISGTEL-GSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
             D  L +G    GSIH+ G+    +  CNGW  W+ +  G   S+  LR   R ++
Sbjct: 305 KPDARLRTGDGFEGSIHQAGSYYMNNAPCNGWEHWFVQVNGHFISLGDLREQFRMDM 361


>gi|219850190|ref|YP_002464623.1| DNA methylase N-4/N-6 domain-containing protein [Chloroflexus
           aggregans DSM 9485]
 gi|219544449|gb|ACL26187.1| DNA methylase N-4/N-6 domain protein [Chloroflexus aggregans DSM
           9485]
          Length = 369

 Score =  402 bits (1033), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 193/361 (53%), Positives = 257/361 (71%), Gaps = 8/361 (2%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           +++I+G+ + +L  LP  S+DLIFADPPY+LQL  +LYRP+ + VDAV D WDKF S +A
Sbjct: 6   NQVIEGDCVEILNTLPETSIDLIFADPPYHLQLQNELYRPNMTKVDAVDDDWDKFESMQA 65

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YD FTR WL AC+RVLKP GT+WVIG+YHNIFR+G ++Q+L FWILND++W K NPMPNF
Sbjct: 66  YDEFTRTWLTACKRVLKPTGTIWVIGTYHNIFRVGAIMQDLGFWILNDVIWIKLNPMPNF 125

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSD-WLIPICSGSERLRNKD 199
           RG RF NAHETLIWAS    A  YTFNY A+K  N++ QMRSD WL+P+ +GSER++N++
Sbjct: 126 RGVRFTNAHETLIWASTGKDAT-YTFNYYAMKGLNDEKQMRSDWWLLPLATGSERVKNEN 184

Query: 200 GEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYID 259
           G+K H TQKPEALL R+++SS+ PGD++LDPFFGSGT+G VAK+L R++IGIE ++ YI 
Sbjct: 185 GDKAHSTQKPEALLYRVILSSSNPGDVVLDPFFGSGTTGVVAKRLHRNWIGIEKEKKYIQ 244

Query: 260 IATKRIASVQP--LGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNIS-ATV 316
           IA KRI +VQP         V +  ++ P+V F++LVE G +QPGQ L   +     AT+
Sbjct: 245 IAQKRIDAVQPEMFDAATFDVKSKAKSAPKVEFSVLVEHGYVQPGQRLFFGKDKTKVATI 304

Query: 317 CADGTLISGTEL-GSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLR--ILVRKELY 373
             D  L +     GSIH+ G+    +  CNGW  W+ E  G++  +  +R    V K LY
Sbjct: 305 KPDSRLRTADGFEGSIHQAGSHYMNNAPCNGWEHWFIEVDGQMIGLGEVREKFRVDKGLY 364

Query: 374 N 374
           N
Sbjct: 365 N 365


>gi|159899562|ref|YP_001545809.1| DNA methylase N-4/N-6 domain-containing protein [Herpetosiphon
           aurantiacus ATCC 23779]
 gi|159892601|gb|ABX05681.1| DNA methylase N-4/N-6 domain protein [Herpetosiphon aurantiacus
           ATCC 23779]
          Length = 375

 Score =  400 bits (1029), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 204/355 (57%), Positives = 255/355 (71%), Gaps = 7/355 (1%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           D+I+ G+   VL  LP  SVDLIFADPPYNLQL G L RP+ + VDAV D WD F  F A
Sbjct: 9   DQILLGDCRDVLPLLPPASVDLIFADPPYNLQLRGDLLRPNMTHVDAVDDDWDSFRDFAA 68

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YDAFTRAWL AC+RVLK NGT+WVIGSYHNI+R+GT+LQ+L FWILNDIVW K NPMPNF
Sbjct: 69  YDAFTRAWLQACQRVLKDNGTMWVIGSYHNIYRVGTILQDLGFWILNDIVWIKRNPMPNF 128

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           RG R  NAHETLIW +  P  K YTFNY AL+  N+D QMRSDW  P+C+G+ERLR  +G
Sbjct: 129 RGVRLTNAHETLIWCAKLPGQK-YTFNYHALRHLNDDKQMRSDWEFPLCTGNERLR-ING 186

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
            K+H TQKPEALL R+L++S+  GD++LDPFFG+GT+GAVAK+L R +IGIE    Y++ 
Sbjct: 187 NKVHSTQKPEALLYRVLLASSNVGDVVLDPFFGTGTTGAVAKRLARHYIGIERDPSYVEA 246

Query: 261 ATKRIASVQ-PLGNIELTVL-TGKRTEPRVAFNLLVERGLIQPGQIL-TNAQGNISATVC 317
           A  RIA+++ P     L  L + KR  PR+ F  L+E GL+Q GQ L  N   N+ AT+ 
Sbjct: 247 ARGRIAAIESPSSTDALQALPSNKRRIPRIPFGNLLEHGLLQAGQQLWFNRDPNLVATLL 306

Query: 318 ADGTL-ISGTELGSIHRVGAKVSGSETCNGWNFWYFEKL-GELHSINTLRILVRK 370
           AD +L +S    GSIH++G  ++G  +CNGW  W+F+   G L SI+ LR  VR+
Sbjct: 307 ADASLRMSDGTRGSIHKLGTILTGQPSCNGWEHWFFQASDGTLTSIDVLRQEVRR 361


>gi|320161362|ref|YP_004174586.1| putative modification methylase [Anaerolinea thermophila UNI-1]
 gi|319995215|dbj|BAJ63986.1| putative modification methylase [Anaerolinea thermophila UNI-1]
          Length = 368

 Score =  399 bits (1024), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 201/356 (56%), Positives = 257/356 (72%), Gaps = 7/356 (1%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           ++I++G+   +L  LP +S+DLIFADPPYNLQL   LYRPD S VDAV DSWD+F+SF  
Sbjct: 11  NQILQGDCRQILPSLPDQSIDLIFADPPYNLQLQQDLYRPDRSRVDAVNDSWDQFTSFAE 70

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YD F+R+WL  CRRVLK +G +WVIG+YHNIFR+GT+LQ+L FWILND+VW KSNPMPNF
Sbjct: 71  YDEFSRSWLTECRRVLKDDGAIWVIGTYHNIFRLGTILQDLGFWILNDVVWIKSNPMPNF 130

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           RG RF NAHETLIWA  S +A  YTFN+ A+KA NED+QMRSDW IPICSG+ER+R   G
Sbjct: 131 RGVRFTNAHETLIWAVKSRRA-NYTFNHHAMKALNEDLQMRSDWYIPICSGTERIRIH-G 188

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
           +K+H TQKPEALL RI++++T+PGD+ILDPFFG+GT+GAVA++L R++IGIE +  YI++
Sbjct: 189 KKVHSTQKPEALLYRIILATTRPGDVILDPFFGTGTTGAVARRLGRNWIGIEKEPRYIEL 248

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQIL-TNAQGNISATVCAD 319
           A +RI  ++P     L +    R + R+ F  LVE+ L+QPGQIL  +    I A V +D
Sbjct: 249 ARQRIEQIEPYPQQALALPVRSR-KSRLPFGRLVEQNLVQPGQILFFDRNPEIRAVVLSD 307

Query: 320 GTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKELYNC 375
           G L      GSIH    K+ G  T NGW  W+F  L E      + IL +K L N 
Sbjct: 308 GHLSVNGWKGSIHMTAEKICGHPT-NGWERWFF--LDEQGIFQPISILRQKYLSNV 360


>gi|262276831|ref|ZP_06054624.1| modification methylase CcrMI (Adenine-specificmethyltransferase
           CcrMI) (M.CcrMI) [alpha proteobacterium HIMB114]
 gi|262223934|gb|EEY74393.1| modification methylase CcrMI (Adenine-specificmethyltransferase
           CcrMI) (M.CcrMI) [alpha proteobacterium HIMB114]
          Length = 353

 Score =  393 bits (1009), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 181/346 (52%), Positives = 250/346 (72%), Gaps = 2/346 (0%)

Query: 27  NSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTR 86
           + +  L+++ ++SVDLIFADPPYNLQL  +L+RPD S V AV D WDKF SF+ YD FT 
Sbjct: 10  DCLGKLKEIESESVDLIFADPPYNLQLKNKLFRPDASKVSAVNDYWDKFDSFKTYDDFTN 69

Query: 87  AWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQ 146
           +WL  C+R+LK NG++WVIGSYHNIFR+G ++Q+ ++WILND++W K NPMPNF+G R  
Sbjct: 70  SWLKECKRILKKNGSIWVIGSYHNIFRVGKLIQDNSYWILNDVIWNKRNPMPNFKGTRLT 129

Query: 147 NAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPT 206
           NAHETLIWA+ S K+K YTFNY ++K  NED Q+RSDW IPIC+GSER+ +K+ +K+H T
Sbjct: 130 NAHETLIWAAKSEKSK-YTFNYHSMKTFNEDKQLRSDWDIPICNGSERITSKN-KKIHST 187

Query: 207 QKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIA 266
           QKPEALL R+L+ ++   DI+LDPF G+GT+GAVAKKL R+FIGIE  + Y   A +RI 
Sbjct: 188 QKPEALLYRVLLCASNKNDIVLDPFMGTGTTGAVAKKLGRNFIGIEKDKKYFKAAEQRIK 247

Query: 267 SVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTLISGT 326
            ++ +       +T K+ E R+ F  LVE G+++PG  L + +    A V +DG++    
Sbjct: 248 RIKEIDENFNIPMTNKKKEKRIPFGYLVETGIVEPGLNLFDLKKRYKAKVMSDGSIYCNK 307

Query: 327 ELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
             GSIH+VGA++ G  +CNGW++W+F   G+L  I+ LR  +R  L
Sbjct: 308 IQGSIHKVGAEIQGMPSCNGWSYWHFNIEGKLEPIDYLRKKIRSSL 353


>gi|16082180|ref|NP_394624.1| adenine specific DNA methyltransferase [Thermoplasma acidophilum
           DSM 1728]
 gi|10640479|emb|CAC12293.1| probable adenine specific DNA methyltransferase [Thermoplasma
           acidophilum]
          Length = 381

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 188/351 (53%), Positives = 250/351 (71%), Gaps = 3/351 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           +I G+SI +++++P  SVDLIFADPPYNLQL  +LYRP+ + V+ V++ WDKF SF+ YD
Sbjct: 27  VISGDSIEIMKQIPDNSVDLIFADPPYNLQLENELYRPNETKVNGVSEDWDKFRSFQDYD 86

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            FT  WL  C+R+LK +GT+WVIG+YHNIFR+G ++Q+L FWILNDIVW K+NPMPNF+G
Sbjct: 87  DFTLNWLSQCKRILKESGTIWVIGTYHNIFRVGKIMQDLGFWILNDIVWIKTNPMPNFKG 146

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
            RF NAHETLIWAS   ++K YTFNY  +KA N+D+QMRSDW IPIC G ER++  +G+K
Sbjct: 147 TRFNNAHETLIWASKDKESK-YTFNYKTMKAYNDDLQMRSDWYIPICQGDERIK-INGQK 204

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
           LHPTQKPEALL RI+ +++KPGDI+LDPF G+GT+  VAKKL RSFIGIE +  Y+D   
Sbjct: 205 LHPTQKPEALLYRIITATSKPGDIVLDPFAGTGTTLVVAKKLGRSFIGIEKEPLYVDACR 264

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           +R+ +        L      R + RV F  L+E G ++ G+ L +  G   A V A+GTL
Sbjct: 265 ERLKNTASYQQKLLDYPLEIRPK-RVPFGSLIENGYVKAGEYLYSPDGEARALVLANGTL 323

Query: 323 ISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKELY 373
               + GSIH++ A +      NGW FWY ++ G+L SIN LR  + K+ Y
Sbjct: 324 SYEDKYGSIHKISAMILNKPANNGWAFWYVKRDGKLVSINDLRQKLLKDQY 374


>gi|156741987|ref|YP_001432116.1| DNA methylase N-4/N-6 domain-containing protein [Roseiflexus
           castenholzii DSM 13941]
 gi|156233315|gb|ABU58098.1| DNA methylase N-4/N-6 domain protein [Roseiflexus castenholzii DSM
           13941]
          Length = 370

 Score =  388 bits (996), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 185/346 (53%), Positives = 246/346 (71%), Gaps = 5/346 (1%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II+G+ I VL+  P +SVDLIFADPPYNLQL   L RPD ++VD V D+WD+F   + YD
Sbjct: 16  IIQGDCIQVLQMFPEQSVDLIFADPPYNLQLRHALLRPDQTVVDGVDDAWDRFEDVQEYD 75

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
           AFTRAWL ACRRVLK +GT+WVIG+YHNIFR+G ++ +L +WILND++W K+NPMPNFRG
Sbjct: 76  AFTRAWLGACRRVLKDDGTIWVIGTYHNIFRVGAIMMDLGYWILNDVIWHKTNPMPNFRG 135

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
            RFQNA ETLIWA  S   K YTFNY A+K  NE+ QM++ W +P+C+G+ER++  +G+K
Sbjct: 136 VRFQNATETLIWAKKSADQKKYTFNYHAMKHLNEEKQMQNVWHLPLCTGAERVK-INGKK 194

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            H TQKPEALL R+++SS+ PGD++LDPFFGSGT+G VA++L+R +IGIE+   Y++IA 
Sbjct: 195 AHSTQKPEALLYRVILSSSNPGDLVLDPFFGSGTTGVVARRLKRHYIGIELDPAYVEIAR 254

Query: 263 KRIASVQPLGNIELTVLT--GKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADG 320
            RI    P+   +  +L    KR  PRV F  LVE   ++ GQ L ++  N+ A V AD 
Sbjct: 255 TRIEKT-PVSVCDDAMLATRSKRDMPRVGFGQLVEAQYLRVGQNLYSSDRNVVAIVRADS 313

Query: 321 TLISGTELGSIHRVGAKVSGSETCNGWNFWYFE-KLGELHSINTLR 365
            L  G    SIHR+ A        NGW +W++E + G L SI++LR
Sbjct: 314 QLQWGNITSSIHRIAALAQHKPAFNGWEYWHYEDQAGRLVSIDSLR 359


>gi|330813680|ref|YP_004357919.1| modification methylase [Candidatus Pelagibacter sp. IMCC9063]
 gi|327486775|gb|AEA81180.1| modification methylase [Candidatus Pelagibacter sp. IMCC9063]
          Length = 350

 Score =  384 bits (986), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 179/299 (59%), Positives = 234/299 (78%), Gaps = 2/299 (0%)

Query: 13  QNSIFEWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSW 72
           +NS   +K+KI++GNSI +L+K+P ++ DL+FADPPYNLQL+  L RPD+S VDAV D W
Sbjct: 2   KNSKNPYKNKILQGNSIEILKKIPDETFDLVFADPPYNLQLDKSLERPDNSKVDAVDDQW 61

Query: 73  DKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWR 132
           D+FSSF+AYD FT  WL  CRRVLK NGT+WVIGSYHNIFR+G  +Q+LNFWILND+VW 
Sbjct: 62  DQFSSFKAYDLFTNQWLRECRRVLKKNGTIWVIGSYHNIFRVGKEIQDLNFWILNDVVWN 121

Query: 133 KSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGS 192
           K NPMPNF+G RF NAHETLIWA+   K+K YTFNY++LK  N+D Q+RSDW + ICSG+
Sbjct: 122 KRNPMPNFKGTRFTNAHETLIWAAKEQKSK-YTFNYNSLKCFNDDKQLRSDWELAICSGN 180

Query: 193 ERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIE 252
           ER + K+G K H TQKPEALL R+++S+T   D+ILDPFFG+GT+GAVAKKL R+F+GIE
Sbjct: 181 ERCK-KNGTKAHSTQKPEALLYRVILSTTNKDDLILDPFFGTGTTGAVAKKLGRNFLGIE 239

Query: 253 MKQDYIDIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGN 311
            ++ YI++A KRI  ++P+ +  L  +  KR E R+ F +LVE G+I+PG  L + + N
Sbjct: 240 KEKKYIEVAKKRIDKIRPIEDEYLKTIQKKRNEKRIPFGMLVESGIIEPGISLYDNKKN 298


>gi|218661107|ref|ZP_03517037.1| site-specific DNA-methyltransferase (adenine-specific) protein
           [Rhizobium etli IE4771]
          Length = 252

 Score =  376 bits (966), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 171/224 (76%), Positives = 206/224 (91%)

Query: 60  PDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQ 119
           PD SLVDAV D WD+F+SFEAYDAFTRAWLLACRRVLKP G++WVIGSYHNIFR+G  LQ
Sbjct: 29  PDQSLVDAVDDEWDQFASFEAYDAFTRAWLLACRRVLKPTGSIWVIGSYHNIFRVGATLQ 88

Query: 120 NLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQ 179
           +LNFWILNDI+WRK+NPMPNF+GRRFQNAHET+IWASP+ KAKGYTFNYDA+KAAN+DVQ
Sbjct: 89  DLNFWILNDIIWRKTNPMPNFKGRRFQNAHETMIWASPNAKAKGYTFNYDAMKAANDDVQ 148

Query: 180 MRSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGA 239
           MRSDWL PIC+G+ERL+ +DG+K+HPTQKPEALL+R++++STKPGDI+LDPFFGSGT+GA
Sbjct: 149 MRSDWLFPICNGNERLKGEDGKKVHPTQKPEALLARVIMASTKPGDIVLDPFFGSGTTGA 208

Query: 240 VAKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKR 283
           VAK+L   F+G+E +QDYID A+  IA+V+PLG  ELTV+TGK+
Sbjct: 209 VAKRLGCKFVGMEREQDYIDAASASIAAVEPLGKAELTVMTGKK 252


>gi|260495302|ref|ZP_05815429.1| DNA methylase [Fusobacterium sp. 3_1_33]
 gi|260197080|gb|EEW94600.1| DNA methylase [Fusobacterium sp. 3_1_33]
          Length = 357

 Score =  370 bits (951), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 177/354 (50%), Positives = 247/354 (69%), Gaps = 2/354 (0%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           +KI KG+SI VL+K+P++SVD IFADPPY +Q  G+L R D +  + V D WDKF +F+ 
Sbjct: 4   NKIFKGDSIEVLKKIPSESVDFIFADPPYYMQTEGELLRTDGTKFNGVEDEWDKFENFQD 63

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YD F++ WL  CRRVLK NGT+ VIGS+ NI+RIG ++Q+L +WILNDI+W+K+NP+PNF
Sbjct: 64  YDNFSKKWLGECRRVLKKNGTIAVIGSFQNIYRIGNIMQDLGYWILNDIIWKKTNPVPNF 123

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
            G+RF N+HET++W S   K+K  TFNY  +K  N D Q +S W IP+C+G+ERL++++G
Sbjct: 124 SGKRFCNSHETILWCSKDKKSK-ITFNYKTMKYLNGDKQEKSVWEIPLCTGNERLKDEEG 182

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
            KLH TQKPE LL +IL+S TKP DI+LDPFFG+GT+GAVA +  R++IGIE ++ YI  
Sbjct: 183 NKLHSTQKPEKLLYKILISMTKPNDIVLDPFFGTGTTGAVAVETGRNYIGIEREEKYIKA 242

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADG 320
           A KRIAS     N+ +T L  +   P+V    LVE+G ++  Q+L N+ G    TV ++G
Sbjct: 243 AEKRIASKIYQKNM-ITELLLEVKPPKVPLKKLVEKGYLKENQVLYNSLGEAKVTVLSNG 301

Query: 321 TLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKELYN 374
            +  G E  SIH++ AK+      NGW+++Y    G+L  +N LR    KE+ N
Sbjct: 302 DVFDGNEKLSIHKMSAKILNKTNNNGWDYFYVMNNGKLIPLNDLRYQYDKEVNN 355


>gi|256027628|ref|ZP_05441462.1| adenine specific DNA methyltransferase (HINFIM) [Fusobacterium sp.
           D11]
 gi|289765586|ref|ZP_06524964.1| methylase [Fusobacterium sp. D11]
 gi|289717141|gb|EFD81153.1| methylase [Fusobacterium sp. D11]
          Length = 357

 Score =  369 bits (947), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 177/354 (50%), Positives = 246/354 (69%), Gaps = 2/354 (0%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           +KI KG+SI VL+K+P++SVD IFADPPY +Q  G+L R D +  + V D WDKF +F+ 
Sbjct: 4   NKIFKGDSIEVLKKIPSESVDFIFADPPYYMQTEGELLRTDGTKFNGVEDEWDKFENFQD 63

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YD F++ WL  CRRVLK NGT+ VIGS+ NI+RIG ++Q+L +WILNDI+W+K+NP+PNF
Sbjct: 64  YDNFSKKWLGECRRVLKKNGTIAVIGSFQNIYRIGNIMQDLGYWILNDIIWKKTNPVPNF 123

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
            G+RF N+HET++W S   K+K  TFNY  +K  N D Q +S W IP+C+G+ERL++++G
Sbjct: 124 SGKRFCNSHETILWCSKDKKSK-ITFNYKTMKYLNGDKQEKSVWEIPLCTGNERLKDEEG 182

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
            KLH TQKPE LL +IL+S TKP DI+LDPFFG+GT GAVA +  R++IGIE ++ YI  
Sbjct: 183 NKLHSTQKPEKLLYKILISMTKPNDIVLDPFFGTGTIGAVAVETGRNYIGIEREEKYIKA 242

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADG 320
           A KRIAS     N+ +T L  +   P+V    LVE+G ++  Q+L N+ G    TV ++G
Sbjct: 243 AEKRIASKIYQKNM-ITELLLEVKPPKVPLKKLVEKGYLKENQVLYNSLGEAKVTVLSNG 301

Query: 321 TLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKELYN 374
            +  G E  SIH++ AK+      NGW+++Y    G+L  +N LR    KE+ N
Sbjct: 302 DVFDGNEKLSIHKMSAKILNKTNNNGWDYFYVMNNGKLIPLNDLRYQYDKEVNN 355


>gi|237743216|ref|ZP_04573697.1| modification methylase HinfI [Fusobacterium sp. 7_1]
 gi|229433512|gb|EEO43724.1| modification methylase HinfI [Fusobacterium sp. 7_1]
          Length = 357

 Score =  366 bits (939), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 176/354 (49%), Positives = 244/354 (68%), Gaps = 2/354 (0%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           +KI KG+SI VL+K+P++SVD IFADPPY +Q  G+L R D +  + V D WDKF +F+ 
Sbjct: 4   NKIFKGDSIEVLKKIPSESVDFIFADPPYYMQTEGELLRIDGTKFNGVEDEWDKFENFQD 63

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YD F++ WL  CRRVLK NGT+ VIGS+ NI+RIG ++Q+L +WILNDI+W+K+NP+PNF
Sbjct: 64  YDNFSKKWLGECRRVLKKNGTIAVIGSFQNIYRIGNIMQDLGYWILNDIIWKKTNPVPNF 123

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
            G+RF N+HET++W S   K+K  TFNY  +K  N D Q +S W IP+C+G+ERL++++G
Sbjct: 124 SGKRFCNSHETILWCSKDKKSK-ITFNYKTMKYLNGDKQEKSVWEIPLCTGNERLKDEEG 182

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
            KLH TQKPE LL +IL+S TKP DI+LDPFFG+GT+GAVA +  R++IGIE ++ YI  
Sbjct: 183 NKLHSTQKPEKLLYKILISMTKPNDIVLDPFFGTGTTGAVAVETGRNYIGIEREEKYIKA 242

Query: 261 ATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADG 320
           A KRIAS     N+ +T L  +   P+V    LVE+G ++  Q L N+ G     V ++G
Sbjct: 243 AEKRIASKIYQKNM-ITELLLEVKPPKVPLKKLVEKGYLKENQALYNSLGEAKVKVLSNG 301

Query: 321 TLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKELYN 374
            +  G E  SIH++ AK+      NGW+++Y    G+L  +N LR    KE  N
Sbjct: 302 DVFDGNEKLSIHKMSAKILNKTNNNGWDYFYVMNNGKLIPLNDLRYQYAKEFNN 355


>gi|237741481|ref|ZP_04571962.1| modification methylase HinfI [Fusobacterium sp. 4_1_13]
 gi|260497889|ref|ZP_05816008.1| DNA methylase [Fusobacterium sp. 3_1_33]
 gi|229429129|gb|EEO39341.1| modification methylase HinfI [Fusobacterium sp. 4_1_13]
 gi|260196555|gb|EEW94083.1| DNA methylase [Fusobacterium sp. 3_1_33]
          Length = 370

 Score =  357 bits (915), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 168/349 (48%), Positives = 243/349 (69%), Gaps = 2/349 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II+G++I  L++LP +S+D IFADPPY +Q  G+L R D +    V D WDKF  F+ YD
Sbjct: 10  IIEGDTIKNLKRLPDESIDFIFADPPYYMQTEGELLRVDGTKFKGVEDKWDKFKDFKDYD 69

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            FT+ WL  C+RVLK + T+ VIGS+ NI+RIG ++Q+L +WILNDI+W+K+NP+PNF G
Sbjct: 70  DFTKKWLKECKRVLKKDATIAVIGSFQNIYRIGNIMQDLGYWILNDIIWKKTNPVPNFSG 129

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +RF N+HET++W S + K+K  TFNY  +K  N + Q +S W I +C+G+ERL++++G K
Sbjct: 130 KRFCNSHETILWCSKNKKSK-ITFNYKTMKYLNNEKQEKSIWEISLCTGNERLKDENGNK 188

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
           LH +QKPE LL ++L+S+TKP DIILDPFFG+GT+GAVAK++ R++IGIE ++ Y++ A 
Sbjct: 189 LHSSQKPEKLLYKLLISATKPKDIILDPFFGTGTTGAVAKEIGRNYIGIEKEKVYVEAAE 248

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           KRIAS     ++ +T LT +   P+V    L+E+G +Q  Q L N+ G     V  DG +
Sbjct: 249 KRIASKNYQRSL-VTELTLEEKPPKVPVKKLLEKGYLQKNQELYNSLGERKGIVLEDGNI 307

Query: 323 ISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKE 371
             G E+ SIH++ AK+      NGW+++Y  + G L S+N LR    KE
Sbjct: 308 FDGIEILSIHKMSAKLLNKANNNGWDYFYIIEKGNLISLNDLRYRYNKE 356


>gi|237745127|ref|ZP_04575608.1| modification methylase HinfI [Fusobacterium sp. 7_1]
 gi|229432356|gb|EEO42568.1| modification methylase HinfI [Fusobacterium sp. 7_1]
          Length = 370

 Score =  357 bits (915), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 168/349 (48%), Positives = 242/349 (69%), Gaps = 2/349 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II+G++I  L++LP +S+D IFADPPY +Q  G+L R D +    V D WDKF  F+ YD
Sbjct: 10  IIEGDTIKNLKRLPDESIDFIFADPPYYMQTEGELLRVDGTKFKGVEDKWDKFKDFKDYD 69

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            FT+ WL  C+RVLK + T+ VIGS+ NI+R+G ++Q+L +WILNDI+W+K+NP+PNF G
Sbjct: 70  DFTKKWLKECKRVLKKDATIAVIGSFQNIYRVGNIMQDLGYWILNDIIWKKTNPVPNFSG 129

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +RF N+HET++W S + K+K  TFNY  +K  N + Q +S W I +C+G+ERL++K+G K
Sbjct: 130 KRFCNSHETILWCSKNKKSK-ITFNYKTMKYLNNEKQEKSIWEISLCTGNERLKDKNGNK 188

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
           LH +QKPE LL ++L+S+TKP DIILDPFFG+GT+GAVAK++ R++IGIE ++ Y++ A 
Sbjct: 189 LHSSQKPEKLLYKLLISATKPKDIILDPFFGTGTTGAVAKEIGRNYIGIEKEKVYVEAAE 248

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           KRIAS     ++ +T LT +   P+V    L+E+G +Q  Q L N+ G     V  DG +
Sbjct: 249 KRIASKNYQRSL-ITELTLEEKPPKVPVKKLLEKGYLQKNQELYNSLGEKKGIVLEDGNI 307

Query: 323 ISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKE 371
             G E  SIH++ AK+      NGW+++Y  + G L S+N LR    KE
Sbjct: 308 FDGIETLSIHKMSAKLLNKTNNNGWDYFYIIEKGNLISLNDLRYRYDKE 356


>gi|294785907|ref|ZP_06751195.1| modification methylase CcrM [Fusobacterium sp. 3_1_27]
 gi|294487621|gb|EFG34983.1| modification methylase CcrM [Fusobacterium sp. 3_1_27]
          Length = 370

 Score =  355 bits (910), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 167/349 (47%), Positives = 242/349 (69%), Gaps = 2/349 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II+G++I  L++LP +S+D IFADPPY +Q  G+L R D +    V D WDKF  F+ YD
Sbjct: 10  IIEGDTIKNLKRLPDESIDFIFADPPYYMQTEGELLRVDGTKFKGVEDKWDKFKDFKDYD 69

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            FT+ WL  C+RVLK + T+ VIGS+ NI+R+G ++Q+L +WILNDI+W+K+NP+PNF G
Sbjct: 70  NFTKKWLKECKRVLKKDATIAVIGSFQNIYRVGNIMQDLGYWILNDIIWKKTNPVPNFSG 129

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +RF N+HET++W S + K+K  TFNY  +K  N + Q +S W I +C+G+ERL++++G K
Sbjct: 130 KRFCNSHETILWCSKNKKSK-ITFNYKTMKYLNNEKQEKSIWEISLCTGNERLKDENGNK 188

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
           LH +QKPE LL ++L+S+TKP DIILDPFFG+GT+GAVAK++ R++IGIE ++ Y++ A 
Sbjct: 189 LHSSQKPEKLLYKLLISATKPKDIILDPFFGTGTTGAVAKEIGRNYIGIEKEKVYVEAAE 248

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           KRIAS     ++ +T LT +   P+V    L+E+G +Q  Q L N+ G     V  DG +
Sbjct: 249 KRIASKNYQRSL-ITELTLEEKPPKVPVKKLLEKGYLQKNQELYNSLGERKGIVLEDGKI 307

Query: 323 ISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKE 371
             G E  SIH++ AK+      NGW+++Y  + G L S+N LR    KE
Sbjct: 308 FDGIETLSIHKMSAKLLNKANNNGWDYFYIIEKGNLISLNDLRYRYDKE 356


>gi|315453389|ref|YP_004073659.1| adenine specific DNA methylase [Helicobacter felis ATCC 49179]
 gi|315132441|emb|CBY83069.1| adenine specific DNA methylase [Helicobacter felis ATCC 49179]
          Length = 351

 Score =  345 bits (885), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 169/347 (48%), Positives = 234/347 (67%), Gaps = 7/347 (2%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           DKI++GN + +L  LP++SVDLI ADPPY +Q  G L R +  +   V  +WD+F S +A
Sbjct: 3   DKILQGNCLELLPTLPSESVDLIIADPPYFMQTQGDLLRDNGEVFMGVRAAWDQFESLQA 62

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YD+F  AWL  CRRVLK +G++WV+GS+ NI+R+G ++QNL FWILNDI+W K NP+PNF
Sbjct: 63  YDSFCLAWLSECRRVLKAHGSIWVMGSFQNIYRLGYLMQNLGFWILNDIIWAKPNPVPNF 122

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           RG RF NAHE+L+W +    A+ YTFNY  +KA N + Q RS W I IC G+ERL+  D 
Sbjct: 123 RGSRFCNAHESLLWCAKDKSAR-YTFNYKTMKALNHNKQERSIWHISICMGAERLKGADR 181

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
           +KLHPTQKP+ALL +I++SS+KPGD+ILDPFFG+GT+GA+AKK +R F+GIE    ++  
Sbjct: 182 KKLHPTQKPQALLEKIILSSSKPGDLILDPFFGTGTTGAIAKKFKRHFLGIEQDPLFVQE 241

Query: 261 ATKRIASVQPLGN--IELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCA 318
           ATKRIA++ PL N  IE ++   +   P+V+   L + G +Q  Q   + + N    +  
Sbjct: 242 ATKRIANITPLSNPFIEASL---EIKPPKVSLKQLCKAGFLQEKQKFYDKEQNYICYLLE 298

Query: 319 DGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLR 365
           D  L    E  SIH++ AK    +  NGW ++Y    GE  S++ LR
Sbjct: 299 D-RLHDHQEHLSIHQMAAKHLHKKNHNGWTYFYVFWQGEFVSVDLLR 344


>gi|296126404|ref|YP_003633656.1| DNA methylase N-4/N-6 domain protein [Brachyspira murdochii DSM
           12563]
 gi|296018220|gb|ADG71457.1| DNA methylase N-4/N-6 domain protein [Brachyspira murdochii DSM
           12563]
          Length = 360

 Score =  344 bits (883), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 171/353 (48%), Positives = 237/353 (67%), Gaps = 12/353 (3%)

Query: 20  KDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFE 79
           K+ IIKG+++  L+K+P  S+DLIFADPPY +Q  G+L R + +    V D WDKF +FE
Sbjct: 8   KNTIIKGDALEELKKIPDDSIDLIFADPPYYMQTEGELLRTNGTKFSGVDDEWDKFKNFE 67

Query: 80  AYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPN 139
            YD F+  WL  CRRVLK  G++WVIGS+ NIFRIG ++Q+L FWILNDI+W K+NP+PN
Sbjct: 68  DYDNFSINWLKECRRVLKITGSIWVIGSFQNIFRIGKIMQDLGFWILNDIIWSKTNPVPN 127

Query: 140 FRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKD 199
           F G RF NAHETLIW   +   K YTFNY  +K  N D Q +S W I +C+G+ERL++KD
Sbjct: 128 FGGTRFCNAHETLIWCGKNKNTK-YTFNYKTMKHLNNDKQDKSIWNISLCTGNERLKDKD 186

Query: 200 GEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYID 259
           G K+H TQKPE LL ++++SS+KP DI+LDPFFG+GT+GAVAK+L R++IGIE +  YI 
Sbjct: 187 GNKVHSTQKPEELLFKVILSSSKPNDIVLDPFFGTGTTGAVAKRLSRNYIGIEREDKYIY 246

Query: 260 IATKRIASVQPLGNIELTVLTGKRTE---PRVAFNLLVERGLIQPGQILTNAQGNISATV 316
            A  RI +     N+E+T L     E   P+V    L+E+G ++  Q+L + +G+    +
Sbjct: 247 YAKDRIKNT----NVEMTDLINLDYEVKPPKVPIKNLIEKGYLKVNQVLYSKKGDEVCKL 302

Query: 317 CADGTLISGTELG--SIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRIL 367
             +G +    ELG  SIH++ AK+      NGWN++Y     +  SI+ LR +
Sbjct: 303 NENGNV--ENELGNFSIHQMSAKLQNLSKYNGWNYFYIYYKDKFISIDELRYI 353


>gi|127456|sp|P20590|MTH1_HAEIN RecName: Full=Modification methylase HinfI; Short=M.HinfI; AltName:
           Full=Adenine-specific methyltransferase HinfI
 gi|148945|gb|AAA24986.1| methylase [Haemophilus influenzae]
          Length = 359

 Score =  344 bits (882), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 157/353 (44%), Positives = 239/353 (67%), Gaps = 2/353 (0%)

Query: 13  QNSIFEWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSW 72
           + +I ++ + I+KG+ I  L+ +P +S+DLIFADPPY +Q  G+L R +      V D W
Sbjct: 3   KENINDFLNTILKGDCIEKLKTIPNESIDLIFADPPYFMQTEGKLLRTNGDEFSGVDDEW 62

Query: 73  DKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWR 132
           DKF+ F  YD+F   WL  C+R+LK  G++WVIGS+ NI+RIG ++QNL+FWILND++W 
Sbjct: 63  DKFNDFVEYDSFCELWLKECKRILKSTGSIWVIGSFQNIYRIGYIMQNLDFWILNDVIWN 122

Query: 133 KSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGS 192
           K+NP+PNF G RF NAHET++W S   K K +TFNY  +K  N++ Q RS W + +C+G 
Sbjct: 123 KTNPVPNFGGTRFCNAHETMLWCSKCKKNK-FTFNYKTMKHLNQEKQERSVWSLSLCTGK 181

Query: 193 ERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIE 252
           ER+++++G+K H TQKPE+LL ++++SS+KP D++LDPFFG+GT+GAVAK L R++IGIE
Sbjct: 182 ERIKDEEGKKAHSTQKPESLLYKVILSSSKPNDVVLDPFFGTGTTGAVAKALGRNYIGIE 241

Query: 253 MKQDYIDIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNI 312
            +Q YID+A KR+  ++P  N ++ +L+ +   P+V    L+E   ++ GQ L +   N 
Sbjct: 242 REQKYIDVAEKRLREIKPNPN-DIELLSLEIKPPKVPMKTLIEADFLRVGQTLFDKNENA 300

Query: 313 SATVCADGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLR 365
              V  DG +    E  SIH++ AK       NGW+++Y  +     ++++LR
Sbjct: 301 ICIVTQDGNVKDNEETLSIHKMSAKYLNKTNNNGWDYFYLFRNNNFITLDSLR 353


>gi|283953787|ref|ZP_06371318.1| hypothetical protein C414_000010156 [Campylobacter jejuni subsp.
           jejuni 414]
 gi|283794828|gb|EFC33566.1| hypothetical protein C414_000010156 [Campylobacter jejuni subsp.
           jejuni 414]
          Length = 359

 Score =  337 bits (864), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 162/346 (46%), Positives = 226/346 (65%), Gaps = 2/346 (0%)

Query: 20  KDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFE 79
           KD I +GN + +L+ +P KS+DLIFADPPY +Q  G+L R +  +   V D WDKF S +
Sbjct: 3   KDIIFQGNCLEILKTIPDKSIDLIFADPPYFMQTQGELLRTNGEVFSGVNDDWDKFESLK 62

Query: 80  AYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPN 139
           AYD F + WL  CRR+LK + ++WVIGS+ NIFR+G ++Q+L FWILNDI+W K NP+PN
Sbjct: 63  AYDDFCKIWLSECRRILKDDASIWVIGSFQNIFRLGYIMQDLGFWILNDIIWNKPNPVPN 122

Query: 140 FRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKD 199
           F+G RF N+HETLIW S    +K YTFNY  +K  N + Q +S W I IC G+ERL+  D
Sbjct: 123 FKGTRFCNSHETLIWCSKHKNSK-YTFNYKTMKFLNNNKQEKSIWNIGICIGNERLKGID 181

Query: 200 GEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYID 259
           G+K+H TQKPE LL +I++SSTK GD+ILDPFFG+GT+GA+AKKL R +IGIE ++ Y+ 
Sbjct: 182 GKKIHSTQKPEILLEKIILSSTKKGDLILDPFFGTGTTGAIAKKLGRYYIGIEQEKFYVK 241

Query: 260 IATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCAD 319
           IA  RI  +  + N E+T    +   P+V+   L+  G +   +   +   N    +   
Sbjct: 242 IAESRIRQINIIDN-EITRNELETKPPKVSLEELLNAGFLSENEKFYDKNKNYICYLVNG 300

Query: 320 GTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLR 365
             +    E+ SIH++ AK    E  NGW+++Y  K     SI++LR
Sbjct: 301 NKVSDENEILSIHKMAAKYLNKENHNGWSYFYIFKNENFISIDSLR 346


>gi|322379181|ref|ZP_08053573.1| adenine specific DNA methyltransferase (dpnA) [Helicobacter suis
           HS1]
 gi|322379987|ref|ZP_08054255.1| adenine specific DNA methyltransferase (dpnA) [Helicobacter suis
           HS5]
 gi|321147576|gb|EFX42208.1| adenine specific DNA methyltransferase (dpnA) [Helicobacter suis
           HS5]
 gi|321148383|gb|EFX42891.1| adenine specific DNA methyltransferase (dpnA) [Helicobacter suis
           HS1]
          Length = 357

 Score =  335 bits (859), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 155/349 (44%), Positives = 233/349 (66%), Gaps = 3/349 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           I++GN + +L+ LP++SVD IFADPPY +Q  G+L R   +  + V ++WD+F  F  YD
Sbjct: 7   ILQGNCLDILKDLPSQSVDFIFADPPYFMQTQGELLRVGGARFEGVQETWDQFKDFAHYD 66

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            F+  WL  CRR+LK  G++ VIGS+ NI+R+G ++QNL FWI+NDI+W K+NP+PNF G
Sbjct: 67  DFSCLWLAQCRRLLKNRGSICVIGSFQNIYRLGYLMQNLGFWIINDIIWHKTNPVPNFTG 126

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
            R  NAHE ++W +   KA  +TFNY  LK+ N++ Q +S W IP+C+GSERL+N++G K
Sbjct: 127 SRLCNAHEIILWCAKDKKA-SFTFNYKTLKSLNQNKQEKSVWFIPLCTGSERLKNQEGNK 185

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
           LHPTQKPE LL ++++ +TKP D+ILDPFFG+GT+GA+AKKL RSF+GIE  + YI  A 
Sbjct: 186 LHPTQKPEQLLEKLILMATKPHDLILDPFFGTGTTGAMAKKLGRSFLGIEKNEIYIKAAQ 245

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           +RI  +  +    +  L  ++  P+V+  +L++ G ++ G  L +        V ADG +
Sbjct: 246 RRIEQI-TISQDAMAYLELEKKPPKVSMKVLIDTGYLKIGDKLYSPDYQEKCQVLADGKV 304

Query: 323 ISGT-ELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRK 370
              + ++ SIH++ AK+      NGW+++Y +   +  S+N LR    K
Sbjct: 305 CDASGQVLSIHKMSAKILNKINHNGWDYFYIKDGMQFISLNQLRYCYHK 353


>gi|315453204|ref|YP_004073474.1| Adenine specific DNA methyltransferase [Helicobacter felis ATCC
           49179]
 gi|315132256|emb|CBY82884.1| Adenine specific DNA methyltransferase [Helicobacter felis ATCC
           49179]
          Length = 356

 Score =  331 bits (848), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 165/354 (46%), Positives = 236/354 (66%), Gaps = 5/354 (1%)

Query: 20  KDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFE 79
           ++ I++G+  ++L+ L + SVD IFADPPY +Q +G+L R   +    V + WDKF  F 
Sbjct: 2   QNTILQGDCAALLKTLSSSSVDFIFADPPYFMQTSGELLRVGGTKFAGVAEEWDKFKDFA 61

Query: 80  AYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPN 139
            YD+F  AWL  C+RVLK NG++ VIGS+ NI+R+G ++Q+L FW++NDI+W KSNP+PN
Sbjct: 62  HYDSFCEAWLTECKRVLKTNGSICVIGSFQNIYRLGALMQDLGFWVINDIIWAKSNPVPN 121

Query: 140 FRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKD 199
           F G R  NAHETL+W +   KA  +TFNY  LKA N D Q +S W IP+C G+ERL++K 
Sbjct: 122 FNGSRLCNAHETLLWCAKDKKA-SFTFNYKTLKALNGDKQEKSIWEIPLCVGAERLKDKQ 180

Query: 200 GEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYID 259
           G KLHPTQKPE LL ++L+ +T+PGD++LDPFFG+GT+GAVAK+L R+F+GIE   +YI 
Sbjct: 181 GHKLHPTQKPEKLLEKLLLMATRPGDLVLDPFFGTGTTGAVAKRLGRNFLGIEQDSNYIQ 240

Query: 260 IATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCAD 319
            A  RI +  P+     + L  ++  P+V    LV+ G +Q GQ+L +  G     V   
Sbjct: 241 AALARIKNT-PIKMNAFSRLECEKKPPKVPMKTLVDLGYLQVGQVLCSPSGVEQCQVLQS 299

Query: 320 GTL--ISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKE 371
           G +   SG  L SIH++ AK+      NGW+++Y +  G+L ++N LR L  K+
Sbjct: 300 GQVQDSSGAVL-SIHKMSAKILKKINHNGWDYFYTKHEGQLTALNDLRYLYDKD 352


>gi|208435249|ref|YP_002266915.1| adenine specific DNA methyltransferase [Helicobacter pylori G27]
 gi|208433178|gb|ACI28049.1| adenine specific DNA methyltransferase [Helicobacter pylori G27]
          Length = 359

 Score =  330 bits (846), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 164/351 (46%), Positives = 223/351 (63%), Gaps = 3/351 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II+G+ +  L+  P KSVD IFADPPY +Q  G+L R + +    V D WDKF SF+ YD
Sbjct: 11  IIEGDCLEKLKDFPNKSVDFIFADPPYFMQTEGELKRFEGTKFQGVEDHWDKFGSFKEYD 70

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            F   WL  C+R+LK NG++ VIGS+HNIFRIG  LQNL FWILNDI+W KSNP+PNF G
Sbjct: 71  TFCLGWLKECQRILKDNGSICVIGSFHNIFRIGFHLQNLGFWILNDIIWHKSNPVPNFAG 130

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +R  NAHETLIW +    +K  TFNY  +K  N D Q +S W IPIC G+ERL++  G+K
Sbjct: 131 KRLCNAHETLIWCAKHKNSK-VTFNYKTMKYLNNDKQEKSVWQIPICMGNERLKDAQGKK 189

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
           +H TQKPE LL +I++S+TKP DIILDPFFG+GT+GAVAK + R FIGIE    YI  AT
Sbjct: 190 VHSTQKPEVLLKKIILSATKPKDIILDPFFGTGTTGAVAKSMNRYFIGIEKDSFYIKEAT 249

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           KR+ + +   +  +T L  +   P++  +LL+ + L++ G  L ++       V  +G +
Sbjct: 250 KRLNNTRDKSDF-ITNLDLETKPPKIPMSLLISKQLLKIGDFLYSSNKEKICQVLENGQV 308

Query: 323 ISGTEL-GSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
                   SIH++ AK       NGW F+Y     +   ++ LR + +K+ 
Sbjct: 309 RDNENYETSIHKMSAKYLNRTNHNGWKFFYAYYQNQFLLLDELRYICQKDF 359


>gi|307638026|gb|ADN80476.1| adenine specific DNA methyltransferase [Helicobacter pylori 908]
 gi|325996628|gb|ADZ52033.1| adenine specific DNA methyltransferase [Helicobacter pylori 2018]
 gi|325998218|gb|ADZ50426.1| adenine specific DNA methyltransferase [Helicobacter pylori 2017]
          Length = 359

 Score =  329 bits (844), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 165/350 (47%), Positives = 222/350 (63%), Gaps = 3/350 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II+G+ +  L+  P KSVD IFADPPY +Q  G+L R + +    V D WDKF SFE YD
Sbjct: 11  IIEGDCLEKLKDFPNKSVDFIFADPPYFMQTEGELKRFEGTKFQGVEDHWDKFGSFEEYD 70

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            F   WL  C+R+LK NG++ VIGS+ NIFRIG  LQNL FWILNDIVW KSNP+PNF G
Sbjct: 71  TFCLGWLKECQRILKDNGSICVIGSFQNIFRIGFHLQNLGFWILNDIVWHKSNPVPNFAG 130

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +R  NAHETLIW +    +K  TFNY  +K  N D Q +S W IPIC G+ERL++  G+K
Sbjct: 131 KRLCNAHETLIWCAKHKNSK-VTFNYKTMKYLNNDKQEKSVWQIPICMGNERLKDAQGKK 189

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
           +H TQKPEALL +I++S+TKP DIILDPFFG+GT+GAVAK + R FIGIE    YI  A 
Sbjct: 190 VHSTQKPEALLKKIILSATKPKDIILDPFFGTGTTGAVAKSMNRYFIGIEKDSFYIKEAA 249

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           KR+ S +   +  +T L  +   P++  +LL+ + L++ G  L ++       V  +G +
Sbjct: 250 KRLNSARDKSDF-ITNLELETKPPKIPMSLLISKQLLKIGDFLYSSNKEKICQVLENGQV 308

Query: 323 ISGTEL-GSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKE 371
                   SIH++ AK       NGW F+Y     +   ++ LR + +++
Sbjct: 309 RDNENYETSIHKMSAKYLNKTNHNGWKFFYAYYQNQFLLLDELRYICQRD 358


>gi|108563725|ref|YP_628041.1| adenine specific DNA methyltransferase [Helicobacter pylori HPAG1]
 gi|107837498|gb|ABF85367.1| adenine specific DNA methyltransferase [Helicobacter pylori HPAG1]
          Length = 359

 Score =  329 bits (844), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 165/351 (47%), Positives = 222/351 (63%), Gaps = 3/351 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II+G+ +  L+  P KSVD IFADPPY +Q  G+L R + +    V D WDKF SFE YD
Sbjct: 11  IIEGDCLEKLKDFPNKSVDFIFADPPYFMQTEGELKRFEGTKFQGVEDHWDKFGSFEEYD 70

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
           AF   WL  C+R+LK NG++ VIGS+ NIFRIG  LQNL FWILNDI+W KSNP+PNF G
Sbjct: 71  AFCLGWLKECQRILKDNGSICVIGSFQNIFRIGFHLQNLGFWILNDIIWHKSNPVPNFAG 130

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +R  NAHETLIW +    +K  +FNY  +K  N D Q +S W IPIC G+ERL++  G+K
Sbjct: 131 KRLCNAHETLIWCAKHKNSK-VSFNYKTMKYLNNDKQEKSVWQIPICMGNERLKDAQGKK 189

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
           +H TQKPEALL +I++S+TKP DIILDPFFG+GT+GAVAK + R FIGIE    YI  A 
Sbjct: 190 VHSTQKPEALLKKIILSATKPKDIILDPFFGTGTTGAVAKSMNRYFIGIEKDSFYIKEAA 249

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           KR+ S +   +  +T L  +   P++  +LL+ + L++ G  L +        V  +G +
Sbjct: 250 KRLNSARDKSDF-ITNLELETKPPKIPMSLLISKQLLKIGDFLYSPNKEKICQVLENGQV 308

Query: 323 ISGTEL-GSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
                   SIH++ AK       NGW F+Y     +   ++ LR + +K+ 
Sbjct: 309 RDNENYETSIHKMSAKYLNRTNHNGWKFFYAYYQNQFLLLDELRYICQKDF 359


>gi|15612336|ref|NP_223989.1| type II DNA modification (methyltransferase [Helicobacter pylori
           J99]
 gi|4155885|gb|AAD06856.1| TYPE II DNA MODIFICATION ENZYME (METHYLTRANSFERASE) [Helicobacter
           pylori J99]
          Length = 359

 Score =  328 bits (842), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 165/350 (47%), Positives = 222/350 (63%), Gaps = 3/350 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II+G+ +  L+  P KSVD IFADPPY +Q  G+L R + +    V D WDKF SFE YD
Sbjct: 11  IIEGDCLEKLKDFPNKSVDFIFADPPYFMQTEGELKRFEGTKFQGVEDHWDKFGSFEEYD 70

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            F   WL  C+R+LK NG++ VIGS+ NIFRIG  LQNL FWILNDIVW KSNP+PNF G
Sbjct: 71  TFCLGWLKECQRILKDNGSICVIGSFQNIFRIGFHLQNLGFWILNDIVWHKSNPVPNFAG 130

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +R  NAHETLIW +    +K  TFNY  +K  N D Q +S W IPIC G+ERL++  G+K
Sbjct: 131 KRLCNAHETLIWCAKHKNSK-VTFNYKTMKYLNNDKQEKSVWQIPICMGNERLKDVQGKK 189

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
           +H TQKPEALL +I++S+TKP DIILDPFFG+GT+GAVAK + R FIGIE    YI  A 
Sbjct: 190 VHSTQKPEALLKKIILSATKPKDIILDPFFGTGTTGAVAKSMDRYFIGIEKDSFYIKEAA 249

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           KR+ S +   +  +T L  +   P++  +LL+ + L++ G  L ++       V  +G +
Sbjct: 250 KRLNSTRDKSDF-ITNLELETKPPKIPMSLLISKQLLKIGDFLYSSNKEKICQVLENGQV 308

Query: 323 ISGTEL-GSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKE 371
                   SIH++ AK       NGW F+Y     +   ++ LR + +++
Sbjct: 309 RDNENYETSIHKMSAKYLNKTNHNGWKFFYAYYQNQFLLLDELRYICQRD 358


>gi|317013139|gb|ADU83747.1| adenine specific DNA methyltransferase [Helicobacter pylori
           Lithuania75]
          Length = 359

 Score =  328 bits (842), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 162/351 (46%), Positives = 221/351 (62%), Gaps = 3/351 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II+G+ +  L+  P +SVD IFADPPY +Q  G+L R + +    V D WDKF SFE YD
Sbjct: 11  IIEGDCLEKLKDFPNRSVDFIFADPPYFMQTEGELKRFEGTKFQGVEDHWDKFGSFEEYD 70

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            F   WL  C+R+LK NG++ VIGS+HNIFRIG  LQNL FWILNDI+W KSNP+PNF G
Sbjct: 71  TFCLGWLKECQRILKDNGSICVIGSFHNIFRIGFHLQNLGFWILNDIIWHKSNPVPNFAG 130

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +R  NAHETLIW +    +K  TFNY  +K  N D Q +S W IPIC G+ERL++  G+K
Sbjct: 131 KRLCNAHETLIWCAKHKNSK-VTFNYKTMKYLNNDKQEKSVWQIPICMGNERLKDAQGKK 189

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
           +H TQKPE LL +I++S+TKP DI+LDPFFG+GT+GAVAK + R FIGIE    YI  A 
Sbjct: 190 VHSTQKPEVLLKKIILSATKPKDIVLDPFFGTGTTGAVAKSMNRYFIGIEKDSFYIKEAA 249

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           KR+   +   +  +T L  +   P++  +LL+ + L++ G  L ++       V  +G +
Sbjct: 250 KRLNDTRDKSDF-ITNLELETKPPKIPMSLLISKQLLKIGDFLYSSNKEKICQVLENGQV 308

Query: 323 ISGTEL-GSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
                   SIH++ AK       NGW F+Y     +   ++ LR + +K+ 
Sbjct: 309 RDNENYETSIHKMSAKYLNKTNHNGWKFFYAYYQNQFLLLDELRYICQKDF 359


>gi|317014745|gb|ADU82181.1| type II DNA modification (methyltransferase) [Helicobacter pylori
           Gambia94/24]
          Length = 359

 Score =  328 bits (840), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 164/350 (46%), Positives = 222/350 (63%), Gaps = 3/350 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II+G+ +  L+  P KSVD IFADPPY +Q  G+L R + +    V D WDKF SFE YD
Sbjct: 11  IIEGDCLEKLKDFPNKSVDFIFADPPYFMQTEGELKRFEGTKFQGVEDHWDKFGSFEEYD 70

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            F   WL  C+R+LK NG++ VIGS+ NIFRIG  LQNL FWILNDIVW KSNP+PNF G
Sbjct: 71  TFCLGWLKECQRILKDNGSICVIGSFQNIFRIGFHLQNLGFWILNDIVWHKSNPVPNFAG 130

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +R  NAHETLIW +    +K  TFNY  +K  N D Q +S W IPIC G+ERL++  G+K
Sbjct: 131 KRLCNAHETLIWCAKHKNSK-VTFNYKTMKYLNNDKQEKSVWQIPICMGNERLKDAQGKK 189

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
           +H TQKPEALL +I++S+TKP DIILDPFFG+GT+GAVAK + R FIGIE    YI  A 
Sbjct: 190 VHSTQKPEALLKKIILSATKPKDIILDPFFGTGTTGAVAKSMNRYFIGIEKDSFYIKEAI 249

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           KR+ + +   +  +T L  +   P++  +LL+ + L++ G  L ++       V  +G +
Sbjct: 250 KRLNNARDKSDF-ITNLDLETKPPKIPMSLLISKQLLKIGDFLYSSNKEKICQVLENGQV 308

Query: 323 ISGTEL-GSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKE 371
                   SIH++ AK       NGW F+Y     +   ++ LR + +++
Sbjct: 309 RDNENYETSIHKMSAKYLNKTNHNGWKFFYAYYQNQFLLLDELRYICQRD 358


>gi|308064128|gb|ADO06015.1| adenine specific DNA methyltransferase (HINFIM) [Helicobacter
           pylori Sat464]
          Length = 359

 Score =  327 bits (838), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 163/351 (46%), Positives = 222/351 (63%), Gaps = 3/351 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II+G+ +  L+  P +SVD IFADPPY +Q  G+L R + +    V D WDKF SF+ YD
Sbjct: 11  IIEGDCLEKLKDFPDRSVDFIFADPPYFMQTEGELKRFEGTKFQGVEDHWDKFGSFKEYD 70

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            F   WL  C+RVLK NG++ VIGS+ NIFRIG  LQNL FWILNDI+W KSNP+PNF G
Sbjct: 71  TFCLGWLKECQRVLKDNGSICVIGSFQNIFRIGFHLQNLGFWILNDIIWHKSNPVPNFAG 130

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +R  NAHETLIW +    +K  +FNY  +K  N D Q +S W IPIC G+ERL++  G+K
Sbjct: 131 KRLCNAHETLIWCAKHKNSK-VSFNYKTMKYLNNDKQEKSVWQIPICIGNERLKDAQGKK 189

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
           +H TQKPEALL +I++S+TKP DIILDPFFG+GT+GAVAK + R FIGIE    YI  A 
Sbjct: 190 VHSTQKPEALLKKIILSATKPKDIILDPFFGTGTTGAVAKSMNRYFIGIEKDSFYIKEAA 249

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           KR+ + +   +  +T L  +   P++  +LL+ + L++ G  L ++       V  +G +
Sbjct: 250 KRLNNTRDKSDF-ITNLVLETKPPKIPMSLLISKQLLKIGDFLYSSNKEKICQVLENGQV 308

Query: 323 ISGTEL-GSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
                   SIH++ AK       NGW F+Y     +   ++ LR + +KE 
Sbjct: 309 RDNENYETSIHKMSAKYLNKTNHNGWKFFYAYYQNQFLLLDELRYICQKEF 359


>gi|188528141|ref|YP_001910828.1| adenine specific DNA methyltransferase (HINFIM) [Helicobacter
           pylori Shi470]
 gi|188144381|gb|ACD48798.1| adenine specific DNA methyltransferase (HINFIM) [Helicobacter
           pylori Shi470]
          Length = 359

 Score =  327 bits (837), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 163/351 (46%), Positives = 222/351 (63%), Gaps = 3/351 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II+G+ +  L+  P +SVD IFADPPY +Q  G+L R + +    V D WDKF SF+ YD
Sbjct: 11  IIEGDCLEKLKDFPNRSVDFIFADPPYFMQTEGELKRFEGTKFQGVEDHWDKFGSFKEYD 70

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            F   WL  C+RVLK NG++ VIGS+ NIFRIG  LQNL FWILNDI+W KSNP+PNF G
Sbjct: 71  TFCLGWLKECQRVLKDNGSICVIGSFQNIFRIGFHLQNLGFWILNDIIWHKSNPVPNFAG 130

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +R  NAHETLIW +    +K  +FNY  +K  N D Q +S W IPIC G+ERL++  G+K
Sbjct: 131 KRLCNAHETLIWCAKHKNSK-VSFNYKTMKYLNNDKQEKSVWQIPICIGNERLKDAQGKK 189

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
           +H TQKPEALL +I++S+TKP DIILDPFFG+GT+GAVAK + R FIGIE    YI  A 
Sbjct: 190 VHSTQKPEALLKKIILSATKPKDIILDPFFGTGTTGAVAKSMNRYFIGIEKDSFYIKEAA 249

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           KR+ + +   +  +T L  +   P++  +LL+ + L++ G  L ++       V  +G +
Sbjct: 250 KRLNNTRDKSDF-ITNLVLETKPPKIPMSLLISKQLLKIGDFLYSSNKEKICQVLENGQV 308

Query: 323 ISGTEL-GSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
                   SIH++ AK       NGW F+Y     +   ++ LR + +KE 
Sbjct: 309 RDNENYETSIHKMSAKYLNKTNHNGWKFFYAYYQNQFLLLDELRYICQKEF 359


>gi|217034428|ref|ZP_03439841.1| hypothetical protein HP9810_11g10 [Helicobacter pylori 98-10]
 gi|216943098|gb|EEC22572.1| hypothetical protein HP9810_11g10 [Helicobacter pylori 98-10]
          Length = 359

 Score =  326 bits (836), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 163/351 (46%), Positives = 222/351 (63%), Gaps = 3/351 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II+G+ +  L+  P +SVD IFADPPY +Q  G+L R + +    V D WDKF SF+ YD
Sbjct: 11  IIEGDCLEKLKDFPDRSVDFIFADPPYFMQTEGELKRFEGTKFQGVEDHWDKFGSFKEYD 70

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            F   WL  C+RVLK NG++ VIGS+ NIFRIG  LQNL FWILNDI+W KSNP+PNF G
Sbjct: 71  TFCLGWLKECQRVLKDNGSICVIGSFQNIFRIGFHLQNLGFWILNDIIWHKSNPVPNFAG 130

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +R  NAHETLIW +    +K  +FNY  +K  N D Q +S W IPIC G+ERL++  G+K
Sbjct: 131 KRLCNAHETLIWCAKHKNSK-VSFNYKTMKYLNNDKQEKSVWQIPICIGNERLKDTQGKK 189

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
           +H TQKPEALL +I++S+TKP DIILDPFFG+GT+GAVAK + R FIGIE    YI  A 
Sbjct: 190 VHSTQKPEALLKKIILSATKPKDIILDPFFGTGTTGAVAKSMNRYFIGIEKDSFYIKEAA 249

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           KR+ + +   +  +T L  +   P++  +LL+ + L++ G  L ++       V  +G +
Sbjct: 250 KRLNNTRDKSDF-ITNLDLETKPPKIPMSLLISKQLLKIGDFLYSSNKEKICQVLENGQV 308

Query: 323 ISGTEL-GSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
                   SIH++ AK       NGW F+Y     +   ++ LR + +KE 
Sbjct: 309 RDNENYETSIHKMSAKYLNKTNHNGWKFFYAYYQNQFLLLDELRYICQKEF 359


>gi|332672842|gb|AEE69659.1| modification methylase BabI [Helicobacter pylori 83]
          Length = 359

 Score =  326 bits (836), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 163/351 (46%), Positives = 222/351 (63%), Gaps = 3/351 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II+G+ +  L+  P +SVD IFADPPY +Q  G+L R + +    V D WDKF SF+ YD
Sbjct: 11  IIEGDCLEKLKDFPDRSVDFIFADPPYFMQTEGELKRFEGTKFQGVEDHWDKFGSFKEYD 70

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            F   WL  C+RVLK NG++ VIGS+ NIFRIG  LQNL FWILNDI+W KSNP+PNF G
Sbjct: 71  TFCLGWLKECQRVLKDNGSICVIGSFQNIFRIGFHLQNLGFWILNDIIWHKSNPVPNFAG 130

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +R  NAHETLIW +    +K  +FNY  +K  N D Q +S W IPIC G+ERL++  G+K
Sbjct: 131 KRLCNAHETLIWCAKHKNSK-VSFNYKTMKYLNNDKQEKSVWQIPICIGNERLKDAQGKK 189

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
           +H TQKPEALL +I++S+TKP DIILDPFFG+GT+GAVAK + R FIGIE    YI  A 
Sbjct: 190 VHSTQKPEALLKKIILSATKPKDIILDPFFGTGTTGAVAKSMNRYFIGIEKDSFYIKEAA 249

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           KR+ + +   +  +T L  +   P++  +LL+ + L++ G  L ++       V  +G +
Sbjct: 250 KRLNNTRDKSDF-ITNLDLETKPPKIPMSLLISKQLLKIGDFLYSSNKEKICQVLENGQV 308

Query: 323 ISGTEL-GSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
                   SIH++ AK       NGW F+Y     +   ++ LR + +KE 
Sbjct: 309 RDNENYETSIHKMSAKYLNKTNHNGWKFFYAYYQNQFLLLDELRYICQKEF 359


>gi|254779898|ref|YP_003058004.1| Type II m6A methylase [Helicobacter pylori B38]
 gi|254001810|emb|CAX30048.1| Type II m6A methylase [Helicobacter pylori B38]
          Length = 359

 Score =  326 bits (835), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 161/351 (45%), Positives = 222/351 (63%), Gaps = 3/351 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II+G+ +  L+  P +SVD +FADPPY +Q  G+L R + +    V D WDKF SF+ YD
Sbjct: 11  IIEGDCLEKLKDFPNRSVDFVFADPPYFMQTEGELKRFEGTKFQGVEDHWDKFGSFKEYD 70

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            F   WL  C+R+LK NG++ VIGS+HNIFRIG  LQNL FWILNDI+W KSNP+PNF G
Sbjct: 71  TFCLGWLKECQRILKDNGSICVIGSFHNIFRIGFHLQNLGFWILNDIIWHKSNPVPNFAG 130

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +R  NAHETLIW +    +K  TFNY  +K  N D Q +S W IPIC G+ERL++  G+K
Sbjct: 131 KRLCNAHETLIWCAKHKNSK-VTFNYKTMKYLNNDKQEKSVWQIPICMGNERLKDARGKK 189

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
           +H TQKPEALL +I++S+TKP DI+LDPFFG+GT+GAVAK + R FIGIE    YI  A 
Sbjct: 190 VHSTQKPEALLKKIILSATKPKDIVLDPFFGTGTTGAVAKSMNRYFIGIEKDSFYIKEAA 249

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           KR+ + +   +  +T L  +   P++  +LL+ + L++ G  L +        V  +G +
Sbjct: 250 KRLNNTRDKSDF-ITNLELETKPPKIPMSLLISKQLLKIGDFLYSPNKEKICQVLENGQV 308

Query: 323 ISGTEL-GSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
                   SIH++ AK       NGW F+Y     +   ++ LR + +K+ 
Sbjct: 309 RDNENYETSIHKMSAKYLNKTNHNGWKFFYAYYQNQFLLLDELRYICQKDF 359


>gi|297380534|gb|ADI35421.1| Modification methylase [Helicobacter pylori v225d]
          Length = 359

 Score =  326 bits (835), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 163/351 (46%), Positives = 222/351 (63%), Gaps = 3/351 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II+G+ +  L+  P +SVD IFADPPY +Q  G+L R + +    V D WDKF SF+ YD
Sbjct: 11  IIEGDCLEKLKDFPNRSVDFIFADPPYFMQTEGELKRFEGTKFQGVEDHWDKFGSFKEYD 70

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            F   WL  C+RVLK NG++ VIGS+ NIFRIG  LQNL FWILNDI+W KSNP+PNF G
Sbjct: 71  TFCLGWLKECQRVLKDNGSICVIGSFQNIFRIGFHLQNLGFWILNDIIWHKSNPVPNFAG 130

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +R  NAHETLIW +    +K  +FNY  +K  N D Q +S W IPIC G+ERL++  G+K
Sbjct: 131 KRLCNAHETLIWCAKHKNSK-VSFNYKTMKYLNNDKQEKSVWQIPICIGNERLKDAQGKK 189

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
           +H TQKPEALL +I++S+TKP DIILDPFFG+GT+GAVAK + R FIGIE    YI  A 
Sbjct: 190 VHSTQKPEALLKKIILSATKPKDIILDPFFGTGTTGAVAKSMNRYFIGIEKDSFYIKEAE 249

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           KR+ + +   +  +T L  +   P++  +LL+ + L++ G  L ++       V  +G +
Sbjct: 250 KRLNNTRDKSDF-ITNLDLETKPPKIPMSLLISKQLLKIGDFLYSSNKEKICQVLENGQV 308

Query: 323 ISGTEL-GSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
                   SIH++ AK       NGW F+Y     +   ++ LR + +KE 
Sbjct: 309 RDNENYETSIHKMSAKYLNKTNHNGWKFFYAYYQNQFLLLDELRYICQKEF 359


>gi|317176855|dbj|BAJ54644.1| adenine specific DNA methyltransferase [Helicobacter pylori F16]
          Length = 359

 Score =  326 bits (835), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 162/351 (46%), Positives = 222/351 (63%), Gaps = 3/351 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II+G+ +  L+  P +SVD IFADPPY +Q  G+L R + +    V D WDKF SF+ YD
Sbjct: 11  IIEGDCLEKLKDFPNRSVDFIFADPPYFMQTEGELKRFEGTKFQGVEDHWDKFGSFKEYD 70

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            F   WL  C+R+LK NG++ VIGS+ NIFRIG  LQNL FWILNDI+W KSNP+PNF G
Sbjct: 71  TFCLGWLKECQRILKDNGSICVIGSFQNIFRIGFHLQNLGFWILNDIIWHKSNPVPNFAG 130

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +R  NAHETLIW +    +K  +FNY  +K  N D Q +S W IPIC G+ERL++  G+K
Sbjct: 131 KRLCNAHETLIWCAKHKNSK-VSFNYKTMKYLNNDKQEKSVWQIPICIGNERLKDAQGKK 189

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
           +H TQKPEALL +I++S+TKP DIILDPFFG+GT+GAVAK + R FIGIE    YI  A 
Sbjct: 190 VHSTQKPEALLKKIILSATKPKDIILDPFFGTGTTGAVAKSMNRYFIGIEKDSFYIKEAA 249

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           KR+ + +   +  +T L  +   P++  +LL+ + L++ G  L ++       V  +G +
Sbjct: 250 KRLNNTRDKSDF-ITNLDLETKPPKIPMSLLISKQLLKIGDFLYSSSKEKICQVLENGQV 308

Query: 323 ISGTEL-GSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
                   SIH++ AK       NGW F+Y     +   ++ LR + +KE 
Sbjct: 309 RDNENYETSIHKMSAKYLNKTNHNGWKFFYAYYQNQFLLLDELRYICQKEF 359


>gi|261838917|gb|ACX98682.1| adenine specific DNA methyltransferase (HINFIM) [Helicobacter
           pylori 52]
          Length = 359

 Score =  325 bits (834), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 163/351 (46%), Positives = 222/351 (63%), Gaps = 3/351 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II+G+ +  L+  P +SVD IFADPPY +Q  G+L R + +    V D WDKF SF+ YD
Sbjct: 11  IIEGDCLEKLKDFPDRSVDFIFADPPYFMQTEGELKRFEGTKFQGVEDHWDKFDSFKEYD 70

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            F   WL  C+R+LK NG++ VIGS+ NIFRIG  LQNL FWILNDI+W KSNP+PNF G
Sbjct: 71  TFCLGWLKECQRILKDNGSICVIGSFQNIFRIGFHLQNLGFWILNDIIWHKSNPVPNFAG 130

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +R  NAHETLIW +    +K  +FNY  +K  N D Q +S W IPIC G+ERL++  G+K
Sbjct: 131 KRLCNAHETLIWCAKHKNSK-VSFNYKTMKYLNNDKQEKSVWQIPICIGNERLKDAQGKK 189

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
           +H TQKPEALL +I++S+TKP DIILDPFFG+GT+GAVAK + R FIGIE    YI  A 
Sbjct: 190 VHSTQKPEALLKKIILSATKPKDIILDPFFGTGTTGAVAKSMNRYFIGIEKDSFYIKEAA 249

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           KR+ + +   +  +T L  +   P+V  +LL+ + L++ G  L ++       V  +G +
Sbjct: 250 KRLNNTRDKSDF-ITNLGLETKPPKVPMSLLISKQLLKIGDFLYSSNKEKICQVLENGQV 308

Query: 323 ISG-TELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
                   SIH++ AK       NGW F+Y     +   ++ LR + +KE 
Sbjct: 309 RDNENHETSIHKMSAKYLNKTNHNGWKFFYAYYQNQFLLLDELRYICQKEF 359


>gi|207091630|ref|ZP_03239417.1| adenine specific DNA methyltransferase (HINFIM) [Helicobacter
           pylori HPKX_438_AG0C1]
          Length = 359

 Score =  325 bits (832), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 161/351 (45%), Positives = 221/351 (62%), Gaps = 3/351 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II+G+ +  L+  P +SVD IFADPPY +Q  G+L R + +    V D WDKF SF+ YD
Sbjct: 11  IIEGDCLEKLKDFPNRSVDFIFADPPYFMQTEGELKRFEGTKFQGVEDHWDKFGSFKEYD 70

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            F   WL  C+R+LK NG++ VIGS+ NIFRIG  LQNL FWILNDI+W KSNP+PNF G
Sbjct: 71  TFCLGWLKECQRILKDNGSICVIGSFQNIFRIGFHLQNLGFWILNDIIWHKSNPVPNFAG 130

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +R  NAHETLIW +    +K  TFNY  +K  N D Q +S W IPIC G+ERL++  G+K
Sbjct: 131 KRLCNAHETLIWCAKHKNSK-VTFNYKTMKYLNNDKQEKSVWQIPICMGNERLKDAQGKK 189

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
           +H TQKPEALL +I++S+TKP DI+LDPFFG+GT+GAVAK + R FIGIE    YI  A 
Sbjct: 190 VHSTQKPEALLKKIILSTTKPKDIVLDPFFGTGTTGAVAKSMNRYFIGIEKDSFYIKEAA 249

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           KR+ + +   +  +T L  +   P++  +LL+ + L++ G  L +        V  +G +
Sbjct: 250 KRLNNTRDKSDF-ITNLELETKPPKIPMSLLISKQLLKIGDFLYSPNKEKICQVLENGQV 308

Query: 323 ISGTEL-GSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
                   SIH++ AK       NGW F+Y     +   ++ LR + +K+ 
Sbjct: 309 RDNENYETSIHKMSAKYLNKTNHNGWKFFYAYYQNQFLLLDELRYICQKDF 359


>gi|308183462|ref|YP_003927589.1| adenine specific DNA methyltransferase (HINFIM) [Helicobacter
           pylori PeCan4]
 gi|308065647|gb|ADO07539.1| adenine specific DNA methyltransferase (HINFIM) [Helicobacter
           pylori PeCan4]
          Length = 359

 Score =  325 bits (832), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 162/350 (46%), Positives = 222/350 (63%), Gaps = 3/350 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II+G+ +  L+  P +SVD IFADPPY +Q  G+L R + +    V D WDKF SF+ YD
Sbjct: 11  IIEGDCLEKLKDFPNRSVDFIFADPPYFMQTEGELKRFEGTKFQGVEDHWDKFGSFKEYD 70

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            F   WL  C+RVLK NG++ VIGS+ NIFRIG  LQNL FWILNDI+W KSNP+PNF G
Sbjct: 71  TFCLGWLKECQRVLKDNGSICVIGSFQNIFRIGFHLQNLGFWILNDIIWHKSNPVPNFAG 130

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +R  NAHETLIW +    +K  +FNY  +K  N D Q +S W IPIC G+ERL++  G+K
Sbjct: 131 KRLCNAHETLIWCAKHKNSK-VSFNYKTMKYLNNDKQEKSVWQIPICIGNERLKDAQGKK 189

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
           +H TQKPEALL +I++S+TKP DIILDPFFG+GT+GAVAK + R FIGIE    YI  A 
Sbjct: 190 VHSTQKPEALLKKIILSATKPKDIILDPFFGTGTTGAVAKSMNRYFIGIEKDSFYIKEAA 249

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           KR+ S +   +  +T L  +   P++  +LL+ + L++ G  L ++       V  +G +
Sbjct: 250 KRLNSTRDKSDF-ITNLELETKPPKIPMSLLISKQLLKIGDFLYSSNKEKICQVLENGQV 308

Query: 323 ISGTEL-GSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKE 371
                   SIH++ AK       NGW F+Y     +   ++ LR + +++
Sbjct: 309 RDNENYETSIHKMSAKYLNKTNHNGWKFFYAYYQNQFLLLDELRYICQRD 358


>gi|261837505|gb|ACX97271.1| type II m6A methylase [Helicobacter pylori 51]
          Length = 359

 Score =  324 bits (831), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 162/351 (46%), Positives = 221/351 (62%), Gaps = 3/351 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II+G+ +  L+  P +SVD IFADPPY +Q  G+L R + +    V D WDKF SF+ YD
Sbjct: 11  IIEGDCLEKLKDFPDRSVDFIFADPPYFMQTEGELKRFEGTKFQGVEDHWDKFGSFKEYD 70

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            F   WL  C+R+LK NG++ VIGS+ NIFRIG  LQNL FWILNDI+W KSNP+PNF G
Sbjct: 71  TFCLGWLKECQRILKDNGSICVIGSFQNIFRIGFHLQNLGFWILNDIIWHKSNPVPNFAG 130

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +R  NAHETLIW +    +K  +FNY  +K  N D Q +S W IPIC G+ERL++  G+K
Sbjct: 131 KRLCNAHETLIWCAKHKNSK-VSFNYKTMKYLNNDKQEKSVWQIPICIGNERLKDAQGKK 189

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
           +H TQKPEALL +I++S TKP DIILDPFFG+GT+GAVAK + R FIGIE    YI  A 
Sbjct: 190 VHSTQKPEALLKKIILSVTKPKDIILDPFFGTGTTGAVAKSMNRYFIGIEKDSFYIKEAA 249

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           KR+ + +   +  +T L  +   P++  +LL+ + L++ G  L ++       V  +G +
Sbjct: 250 KRLNNTRDKSDF-ITNLDLETKPPKIPMSLLISKQLLKIGDFLYSSNKEKICQVLENGQV 308

Query: 323 ISGTEL-GSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
                   SIH++ AK       NGW F+Y     +   ++ LR + +KE 
Sbjct: 309 RDNENYETSIHKMSAKYLNKTNHNGWKFFYAYYQNQFLLLDELRYICQKEF 359


>gi|317181339|dbj|BAJ59123.1| adenine specific DNA methyltransferase [Helicobacter pylori F57]
          Length = 359

 Score =  324 bits (831), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 161/351 (45%), Positives = 221/351 (62%), Gaps = 3/351 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II+G+ +  L+  P +SVD IFADPPY +Q  G+L R + +    V D WDKF SF+ YD
Sbjct: 11  IIEGDCLEKLKDFPNRSVDFIFADPPYFMQTEGELKRFEGTKFQGVEDHWDKFGSFKEYD 70

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            F   WL  C+R+LK NG++ VIGS+ NIFRIG  LQNL FWILNDI+W KSNP+PNF G
Sbjct: 71  TFCLGWLKECQRILKDNGSICVIGSFQNIFRIGFHLQNLGFWILNDIIWHKSNPVPNFAG 130

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +R  NAHETLIW +    +K  +FNY  +K  N D Q +S W IPIC G+ERL++  G+K
Sbjct: 131 KRLCNAHETLIWCAKHKNSK-VSFNYKTMKYLNNDKQEKSVWQIPICIGNERLKDAQGKK 189

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
           +H TQKPEALL +I++S+TKP DIILDPFFG+GT+GAVAK + R FIGIE    YI    
Sbjct: 190 VHSTQKPEALLKKIILSATKPKDIILDPFFGTGTTGAVAKSMNRYFIGIEKDSFYIKEVA 249

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           KR+ + +   +  +T L  +   P++  +LL+ + L++ G  L ++       V  +G +
Sbjct: 250 KRLNNTRDKSDF-ITNLELETKPPKIPMSLLISKQLLKIGDFLYSSNKEKICQVLENGQV 308

Query: 323 ISGTEL-GSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
                   SIH++ AK       NGW F+Y     +   ++ LR + +KE 
Sbjct: 309 RDNENYETSIHKMSAKYLNKTNHNGWKFFYAYYQNQFLLLDELRYICQKEF 359


>gi|15645965|ref|NP_208144.1| adenine specific DNA methyltransferase (HINFIM) [Helicobacter
           pylori 26695]
 gi|2314521|gb|AAD08395.1| adenine specific DNA methyltransferase (HINFIM) [Helicobacter
           pylori 26695]
          Length = 359

 Score =  324 bits (830), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 162/350 (46%), Positives = 221/350 (63%), Gaps = 3/350 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II+G+ +  L+  P +SVD IFADPPY +Q  G+L R + +    V D WDKF SF+ YD
Sbjct: 11  IIEGDCLEKLKDFPNRSVDFIFADPPYFMQTEGELKRFEGTKFQGVEDYWDKFGSFKEYD 70

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
           AF   WL  C+R+LK NG++ VIGS+ NIFRIG  LQNL FWILNDI+W KSNP+PNF G
Sbjct: 71  AFCLGWLKECQRILKDNGSICVIGSFQNIFRIGFHLQNLGFWILNDIIWHKSNPVPNFAG 130

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +R  NAHETLIW +    +K   FNY  +K  N D Q +S W IPIC G+ERL++  G+K
Sbjct: 131 KRLCNAHETLIWCAKHKNSK-VAFNYKTMKYLNNDKQEKSVWQIPICMGNERLKDAQGKK 189

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
           +H TQKPEALL +I++S+TKP DIILDPFFG+GT+GAVAK + R FIGIE    YI  A 
Sbjct: 190 VHSTQKPEALLKKIILSATKPKDIILDPFFGTGTTGAVAKSMNRYFIGIEKDSFYIKEAA 249

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           KR+ + +   +  +T L  +   P++  +LL+ + L++ G  L +        V  +G +
Sbjct: 250 KRLNNTRDKSDF-ITNLDLETKPPKIPMSLLISKQLLKIGDFLYSPNKEKICQVLENGQV 308

Query: 323 ISGTEL-GSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKE 371
                   SIH++ AK       NGW F+Y     +   ++ LR + +K+
Sbjct: 309 RDNENYETSIHKMSAKYLNKTNHNGWKFFYAYYQNQFLLLDELRYICQKD 358


>gi|308062636|gb|ADO04524.1| adenine specific DNA methyltransferase (HINFIM) [Helicobacter
           pylori Cuz20]
          Length = 359

 Score =  323 bits (829), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 162/351 (46%), Positives = 221/351 (62%), Gaps = 3/351 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II+G+ +  L+  P +SVD IFADPPY +Q  G+L R + +    V D WDKF SF+ YD
Sbjct: 11  IIEGDCLEKLKDFPNRSVDFIFADPPYFMQTEGELKRFEGTKFQGVEDHWDKFGSFKEYD 70

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            F   WL  C+RVLK NG++ VIGS+ NIFRIG  LQNL FWILNDI+W KSNP+PNF G
Sbjct: 71  TFCLGWLKECQRVLKDNGSICVIGSFQNIFRIGFHLQNLGFWILNDIIWHKSNPVPNFAG 130

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +R  NAHETLIW +    +K  +FNY  +K  N   Q +S W IPIC G+ERL++  G+K
Sbjct: 131 KRLCNAHETLIWCAKHKNSK-VSFNYKTMKYLNNGKQEKSVWQIPICIGNERLKDAQGKK 189

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
           +H TQKPEALL +I++S+TKP DIILDPFFG+GT+GAVAK + R FIGIE    YI  A 
Sbjct: 190 VHSTQKPEALLKKIILSATKPKDIILDPFFGTGTTGAVAKSMNRYFIGIEKDSFYIKEAA 249

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           KR+ + +   +  +T L  +   P++  +LL+ + L++ G  L ++       V  +G +
Sbjct: 250 KRLNNTRDKSDF-ITNLVLETKPPKIPMSLLISKQLLKIGDFLYSSNKEKICQVLENGQV 308

Query: 323 ISGTEL-GSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
                   SIH++ AK       NGW F+Y     +   ++ LR + +KE 
Sbjct: 309 RDNENYETSIHKMSAKYLNKTNHNGWKFFYAYYQNQFLLLDELRYICQKEF 359


>gi|317179845|dbj|BAJ57631.1| adenine specific DNA methyltransferase [Helicobacter pylori F32]
          Length = 359

 Score =  323 bits (827), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 161/351 (45%), Positives = 221/351 (62%), Gaps = 3/351 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II+G+ +  L+  P +SVD IFADPPY +Q  G+L R + +    V D WDKF SF+ YD
Sbjct: 11  IIEGDCLEKLKDFPNRSVDFIFADPPYFMQTEGELKRFEGTKFQGVEDHWDKFGSFKEYD 70

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            F   WL  C+R+LK NG++ VIGS+ NIFRIG  LQNL FWILNDI+W KSNP+PNF G
Sbjct: 71  TFCLGWLKECQRILKDNGSICVIGSFQNIFRIGFHLQNLGFWILNDIIWHKSNPVPNFAG 130

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +R  NAHETLIW +    +K  +FNY  +K  N   Q +S W IPIC G+ERL++  G+K
Sbjct: 131 KRLCNAHETLIWCAKHKNSK-VSFNYKTMKYLNNGKQEKSVWQIPICIGNERLKDAQGKK 189

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
           +H TQKPEALL +I++S+TKP DIILDPFFG+GT+GAVAK + R FIGIE    YI  A 
Sbjct: 190 VHSTQKPEALLKKIILSATKPKDIILDPFFGTGTTGAVAKSMNRHFIGIEKDSFYIKEAA 249

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           KR+ + +   +  +T L  +   P++  +LL+ + L++ G  L ++       V  +G +
Sbjct: 250 KRLNNTRDKSDF-ITNLDLETKPPKIPMSLLISKQLLKIGDFLYSSNKEKICQVLENGQV 308

Query: 323 ISGTEL-GSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
                   SIH++ AK       NGW F+Y     +   ++ LR + +KE 
Sbjct: 309 RDNENYETSIHKMSAKCLNKANHNGWKFFYAYYQNQFLLLDELRYICQKEF 359


>gi|315586043|gb|ADU40424.1| site-specific DNA-methyltransferase (adenine-specific)
           [Helicobacter pylori 35A]
          Length = 359

 Score =  321 bits (823), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 160/351 (45%), Positives = 221/351 (62%), Gaps = 3/351 (0%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II+G+ +  L+  P +SVD IFADPPY +Q   +L R + +    V D WDKF SF+ YD
Sbjct: 11  IIEGDCLEKLKDFPDRSVDFIFADPPYFMQTERELKRFEGTKFQGVEDHWDKFGSFKEYD 70

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            F   WL  C+R+LK NG++ VIGS+ NIFRIG  LQNL FWILNDI+W KSNP+PNF G
Sbjct: 71  TFCLGWLKECQRILKDNGSICVIGSFQNIFRIGFHLQNLGFWILNDIIWHKSNPVPNFAG 130

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           +R  NAHETLIW +    +K  +FNY  +K  N D Q +S W IPIC G+ERL++  G+K
Sbjct: 131 KRLCNAHETLIWCAKHKNSK-VSFNYKTMKYLNNDKQEKSVWQIPICIGNERLKDAQGKK 189

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
           +H TQKPEALL +I++S+TKP DIILDPFFG+GT+GAVAK + R FIGIE    YI  A 
Sbjct: 190 VHSTQKPEALLKKIILSATKPKDIILDPFFGTGTTGAVAKSMNRYFIGIEKDSFYIKEAA 249

Query: 263 KRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTL 322
           KR+ + +   +  +T L  +   P++  +LL+ + L++ G  L ++       V  +G +
Sbjct: 250 KRLNNTRDKSDF-ITNLDLEAKPPKIPMSLLISKQLLKIGDFLYSSNKEKICQVLENGQV 308

Query: 323 ISGTEL-GSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
                   SIH++ AK       NGW F+Y     +   ++ LR + +K+ 
Sbjct: 309 RDNENYETSIHKMSAKYLNKTNHNGWKFFYAYYQNQFLLLDELRYICQKDF 359


>gi|38906136|gb|AAR27819.1| adenine DNA methyltransferase [Staphylococcus sp. L1]
          Length = 350

 Score =  320 bits (819), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 159/346 (45%), Positives = 224/346 (64%), Gaps = 5/346 (1%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVT-DSWDKFSSFE 79
           + I++G+ I  L+ + + S+DLIFADPPYN+Q+ G+L R + S  + V+ +SWDKF S +
Sbjct: 7   NSILQGDCIEKLKLIESNSIDLIFADPPYNMQIQGELTRVNGSSFNGVSNESWDKFDSIK 66

Query: 80  AYDAFTRAWLLACRRVLKP-NGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
           AY  F R WL+ C+R+LK  N ++W+IGSY NI  IG +LQ L FW++NDI+W+KSNP P
Sbjct: 67  AYKDFCRKWLIECQRILKSKNSSIWIIGSYQNIHIIGDLLQELGFWLINDIIWKKSNPTP 126

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
           NFRG +F NA ETL+WA+PS K K YTFNY  +K  N   QM S W IP+ SGSERL++ 
Sbjct: 127 NFRGTKFTNAQETLLWATPSKKTK-YTFNYKTMKNINNGKQMTSIWKIPVASGSERLKDV 185

Query: 199 DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYI 258
           +G KLH TQKPE LL  I++SSTK GD ILDPF G+GT+  ++KKL R++IGIE  + YI
Sbjct: 186 EGNKLHQTQKPEKLLYNIIISSTKKGDTILDPFLGTGTTATISKKLGRNYIGIEQDKKYI 245

Query: 259 DIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCA 318
             A +RI +   + +  +  +  K+   RV F  LVE G I   + +        A +  
Sbjct: 246 HYAEQRIKNQVVIDDDYVNAVFDKKL-IRVPFKKLVEEGFIDKNEYIYFNNTEEYAVISD 304

Query: 319 DGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTL 364
           D  L+   +  SIH +   + G E  NGWN+WY ++  +++   +L
Sbjct: 305 DKELLYNGK-HSIHSLAGILKGLERANGWNYWYVKRNNKIYFYRSL 349


>gi|294155798|ref|YP_003560182.1| adenine-specific DNA modification methyltransferase [Mycoplasma
           crocodyli MP145]
 gi|291599976|gb|ADE19472.1| adenine-specific DNA modification methyltransferase [Mycoplasma
           crocodyli MP145]
          Length = 375

 Score =  291 bits (746), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 155/371 (41%), Positives = 222/371 (59%), Gaps = 18/371 (4%)

Query: 17  FEWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFS 76
            E K+ +I  +SI  ++ L   S+DLIFADPPY ++  G L R + +  D   D WDKF+
Sbjct: 1   MELKNILINDDSIEYMKSLDENSIDLIFADPPYWMRTTGTLKRVEGTNFDGCNDEWDKFN 60

Query: 77  SFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNP 136
           S + Y  FT+ WL+ C+R+LK +G+++VIG    I+ IG ++Q L+FW++NDI+W KSNP
Sbjct: 61  SLKDYKEFTKKWLIECKRILKKDGSIFVIGGMQCIYTIGAIMQELDFWLINDIIWHKSNP 120

Query: 137 MPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAAN------------EDVQMRSDW 184
            PNF+G R  N+HET+IWA+ S K+K  TFNY   K  N            E  QM S W
Sbjct: 121 TPNFKGTRLNNSHETIIWAAKSIKSK-VTFNYKTAKELNNENIEISKFTKGERKQMGSVW 179

Query: 185 LIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKL 244
             PICSG ERL++++  KLH TQKPEALL RI+  S+K GD ILDPF G+ T+GA+AKK+
Sbjct: 180 KFPICSGLERLKDEEYNKLHSTQKPEALLYRIIAISSKIGDTILDPFAGTMTTGAMAKKM 239

Query: 245 RRSFIGIEMKQDYIDIATKRIASVQPL-GNIELTVLTGKRTEPRVAFNLLVERGLIQPGQ 303
            R+ I IE    Y     KR+   + L G+IE ++   K T  +V F  L+ +  ++ G 
Sbjct: 240 GRNCIMIEKDLKYFTHGKKRVDFTKMLIGDIEKSIFDNKPT--KVHFKDLISKNYLKVGD 297

Query: 304 ILTNAQGNISATVCADGTLISGTELGSIHRVGAKVS--GSETCNGWNFWYFEKLGELHSI 361
             TN   +  AT+  DG L    E+  IH   AK +   ++  NG+++WY  +   L  +
Sbjct: 298 KFTNLSNDDYATLRDDGKLYYNNEVLDIHTCAAKFANKNADRINGFDYWYVVRNNHLVFL 357

Query: 362 NTLRILVRKEL 372
           N +R   RK++
Sbjct: 358 NDIREKARKDI 368


>gi|83682424|emb|CAJ31338.1| hypothetical protein [Helicobacter pylori]
          Length = 315

 Score =  290 bits (741), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 147/316 (46%), Positives = 198/316 (62%), Gaps = 3/316 (0%)

Query: 57  LYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGT 116
           L R + +    V D WDKF SFE YD F   WL  C+R+LK NG++ VIGS+ NIFRIG 
Sbjct: 1   LKRFEGTKFQGVEDHWDKFGSFEEYDTFCLGWLKECQRILKDNGSICVIGSFQNIFRIGF 60

Query: 117 MLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANE 176
            LQNL FWILNDIVW KSNP+PNF G+R  NAHETLIW +    +K  TFNY  +K  N 
Sbjct: 61  HLQNLGFWILNDIVWHKSNPVPNFAGKRLCNAHETLIWCAKHKNSK-VTFNYKTMKYLNN 119

Query: 177 DVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGT 236
           D Q +S W IPIC G+ERL++  G+K+H TQKPEALL +I++S+TKP DIILDPFFG+GT
Sbjct: 120 DKQEKSVWQIPICMGNERLKDAQGKKVHSTQKPEALLKKIILSATKPKDIILDPFFGTGT 179

Query: 237 SGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVER 296
           +GAVAK + R FIGIE    YI  A KR+ S +   +  +T L  +   P++  +LL+ +
Sbjct: 180 TGAVAKSMNRYFIGIEKDSFYIKEAAKRLNSARDKSDF-ITNLDLETKPPKIPMSLLISK 238

Query: 297 GLIQPGQILTNAQGNISATVCADGTLISGTEL-GSIHRVGAKVSGSETCNGWNFWYFEKL 355
            L++ G  L ++       V  +G +        SIH++ AK       NGW F+Y    
Sbjct: 239 QLLKIGDFLYSSNKERICQVLENGQVRDNENYETSIHKMSAKYLNKTNHNGWKFFYAYYQ 298

Query: 356 GELHSINTLRILVRKE 371
            +   ++ LR + +++
Sbjct: 299 NQFLLLDELRYICQRD 314


>gi|183508442|ref|ZP_02689152.2| DNA methylase [Ureaplasma parvum serovar 14 str. ATCC 33697]
 gi|182675852|gb|EDT87757.1| DNA methylase [Ureaplasma parvum serovar 14 str. ATCC 33697]
          Length = 363

 Score =  289 bits (740), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 152/358 (42%), Positives = 216/358 (60%), Gaps = 7/358 (1%)

Query: 19  WKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLN--GQLYRPDHSLVDAVTDSWDKFS 76
           +K+KI+ G +  ++++LP K+ D  F DPPY LQ N   +LYR + +  +   D WDKF 
Sbjct: 3   YKNKILVGETTLIMKELPEKTFDFCFTDPPYFLQTNENKKLYRVEGTKYEGTNDEWDKFD 62

Query: 77  SFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNP 136
           S E+Y  FT+ WL    R+LK +GT+ VI     I+ IG +L+ L FWI+NDI+W+KSNP
Sbjct: 63  SIESYKKFTKCWLSEVMRLLKDDGTICVISGMQTIYEIGNILKELGFWIINDIIWQKSNP 122

Query: 137 MPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLR 196
            PNF G R  N+HETLIWA  S  +K YTFNY   K  N   QM S W   +CSG+ERL+
Sbjct: 123 TPNFMGSRLNNSHETLIWAKKSKNSK-YTFNYKTGKYLNNGKQMGSVWNFSVCSGNERLK 181

Query: 197 NKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQD 256
           +++G KLH TQKPE+LL RI+   TK GD++LDPF G+ T+ AVAKK  R+F  IE  + 
Sbjct: 182 DENGLKLHNTQKPESLLYRIITLFTKKGDLVLDPFGGTMTTAAVAKKTGRNFTMIEKDEK 241

Query: 257 YIDIATKRIASVQP-LGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISAT 315
           Y+     RI ++   +G +E +    K    RV+   ++  G  + G+   N+ G  +  
Sbjct: 242 YVKYGLARINNISAKIGVVENSFFDQKPI--RVSMFEMISDGYFKLGEYFINSNGEKAKL 299

Query: 316 VCADGTLISGTELGSIHRVGAKVSGSE-TCNGWNFWYFEKLGELHSINTLRILVRKEL 372
             A+G L    E+ S+H V AK+ G E   N +N+ + E+ GE+ SIN +R   R+ L
Sbjct: 300 AKANGWLEYQGEINSMHEVAAKMIGRERRVNAFNYLFVERDGEIISINKIRENYRQHL 357


>gi|313678807|ref|YP_004056547.1| site-specific DNA-methyltransferase (adenine-specific) [Mycoplasma
           bovis PG45]
 gi|312950107|gb|ADR24702.1| site-specific DNA-methyltransferase (adenine-specific) [Mycoplasma
           bovis PG45]
          Length = 374

 Score =  273 bits (697), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 151/365 (41%), Positives = 214/365 (58%), Gaps = 19/365 (5%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II  + I  L++LP  S+DLIFADPPY ++ +  L R + +  + V D WDKF S E Y 
Sbjct: 9   IINADCIDALKQLPDNSIDLIFADPPYWMRTSNTLLRVEGTKFNGVEDEWDKFESNEDYA 68

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            FT+ WL  C RVLK NG+ WVIG    I+ IG ++Q L FWI+ND++W K+NP PNF+G
Sbjct: 69  KFTKNWLSECYRVLKKNGSFWVIGGMQCIYTIGGIMQELGFWIINDVIWHKTNPTPNFKG 128

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDV---------QMRSDWLIPICSGSE 193
            R QN+HETLIWA+ +  +K YTFNY   K  N +V         Q+ S W I + +G+E
Sbjct: 129 TRLQNSHETLIWATKNQSSK-YTFNYKTAKELNINVADYNKGNRKQLGSVWSISVVNGNE 187

Query: 194 RLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEM 253
           RL++ +G KLH TQKPE LL +I+  S+K  DI+LDPF G+ T+G VAK+  R +I IE 
Sbjct: 188 RLKDNEGIKLHSTQKPEELLYKIINISSKINDIVLDPFAGTMTTGKVAKQTGRKYIMIEQ 247

Query: 254 KQDYIDIATKRIASV-QPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPG-QILTNAQGN 311
            + Y    T RI    + +G+IEL     K    +V    ++E   +  G Q       +
Sbjct: 248 DEKYCHYGTNRIEKTKEKIGDIELATFDIKPL--KVGLKDMIENSFLHIGEQFYLKNINH 305

Query: 312 ISATVCADGTLI--SGTELGSIHRVGAKVSGSET--CNGWNFWYFEKLGELHSINTLRIL 367
            +  + +DG L   +G  L  IH   A++S  +    NG+++WY  +  +L SIN +R L
Sbjct: 306 KNVYLNSDGKLTDDNGQTL-DIHSGAAQLSNKKAHRVNGFDYWYVIRENKLVSINEIREL 364

Query: 368 VRKEL 372
            R+ L
Sbjct: 365 YREHL 369


>gi|291320655|ref|YP_003515920.1| modification methylase [Mycoplasma agalactiae]
 gi|290752991|emb|CBH40967.1| Modification methylase [Mycoplasma agalactiae]
          Length = 374

 Score =  270 bits (690), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 144/366 (39%), Positives = 213/366 (58%), Gaps = 21/366 (5%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II  + I  L+K+P  S+DLIFADPPY ++ +  L+R + +  + V D WDKF S + Y 
Sbjct: 9   IINADCIEALKKIPDNSIDLIFADPPYWMRTSKTLFRVEGTKFNGVEDEWDKFDSNDDYV 68

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            FT+ WL  C RVLKPNG+ WVIG    I+ IG ++Q+L FWI+ND++W K+NP PNF+G
Sbjct: 69  QFTKKWLSECHRVLKPNGSFWVIGGMQCIYTIGGLMQDLGFWIINDVIWHKTNPTPNFKG 128

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDV---------QMRSDWLIPICSGSE 193
            R QN+HETLIWA+ + K+K YTFNY   K  N +V         Q+ S W I + +GSE
Sbjct: 129 TRLQNSHETLIWATKNQKSK-YTFNYKTAKELNINVADYNKGNRKQLGSVWSISVVNGSE 187

Query: 194 RLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEM 253
           RL++ +G KLH TQKPE LL +I+  ++K  DI+LDPF G+ T+G +AK+  R +I IE 
Sbjct: 188 RLKDNEGLKLHSTQKPEELLYKIININSKINDIVLDPFAGTMTTGKIAKQTGRKYIMIEQ 247

Query: 254 KQDYIDIATKRIASV-QPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPG-QILTNAQGN 311
            + Y      RI    + +G+IEL     K    +V    ++    +  G Q       +
Sbjct: 248 DEKYCHYGANRIEKTKEKIGDIELATFDIKPL--KVDLKDMINDNFLHLGEQFYLKNINH 305

Query: 312 ISATVCADGTLISGTELGSIHRVGAKVS-----GSETCNGWNFWYFEKLGELHSINTLRI 366
            +  + +DG L    E   +H + +K +      +   NG+N+W+  +   + SI+ +R 
Sbjct: 306 KNVYLNSDGKLTDDNE--EVHDIHSKAALLLNKKASRVNGFNYWHVMRDNRIVSIDEIRN 363

Query: 367 LVRKEL 372
           L R+ L
Sbjct: 364 LYREYL 369


>gi|257456468|ref|ZP_05621664.1| DNA methylase [Treponema vincentii ATCC 35580]
 gi|257446128|gb|EEV21175.1| DNA methylase [Treponema vincentii ATCC 35580]
          Length = 372

 Score =  269 bits (687), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 151/367 (41%), Positives = 213/367 (58%), Gaps = 23/367 (6%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWD-KFSSFEAY 81
           II GN I  L+K+ A S++LIFADPPY ++++G L R + +  D   D WD +F S + Y
Sbjct: 6   IINGNCIEELKKIEANSINLIFADPPYWMRVSGVLKRVEGTDYDGCADEWDNQFESLDDY 65

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFR 141
             FTR WL  C RVL PNG++WVIG    I+ IG  +Q + +W++NDI+W K+NP PNF 
Sbjct: 66  IEFTRNWLKECYRVLSPNGSMWVIGGMQCIYSIGNAMQEIGYWLINDIIWYKTNPTPNFM 125

Query: 142 GRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDV------------QMRSDWLIPIC 189
           G R  N+HETLIWA+ S KAK YTF+Y   K  N D             QM S W  P+C
Sbjct: 126 GTRLNNSHETLIWATKSQKAK-YTFHYKTAKELNTDTVLVSDYEKGIRKQMGSIWRFPVC 184

Query: 190 SGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFI 249
           SG+ER+++  G+KLH TQKP ALL RI+   +  GD +LDPF G+ T+GA A +  R+FI
Sbjct: 185 SGNERIKDDAGKKLHSTQKPFALLYRIVAICSNIGDTVLDPFGGTFTTGAAAIQCGRNFI 244

Query: 250 GIEMKQDYIDIATKRIASVQPL-GNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNA 308
           GI+  + Y     KR++  + + GNIE      K    +V F  L++   + P +     
Sbjct: 245 GIDASELYCKYGEKRLSETKEMIGNIEKATFDIKPI--KVDFIDLIKNNFLLPDEKFFLK 302

Query: 309 QGNISATVCADGT--LISGTELGSIHRVGAKVSGSETC---NGWNFWYFEKLGELHSINT 363
             +  A + +DG   L S   +  IH+ GA + G++     NG++FWY E+  +  SI  
Sbjct: 303 NSDSFAILKSDGKIELPSKNIVTDIHK-GAAILGNKKAARVNGFDFWYVERNNKRKSIKD 361

Query: 364 LRILVRK 370
           +R   RK
Sbjct: 362 IREDYRK 368


>gi|148377930|ref|YP_001256806.1| modification methylase [Mycoplasma agalactiae PG2]
 gi|148291976|emb|CAL59368.1| Modification methylase [Mycoplasma agalactiae PG2]
          Length = 376

 Score =  269 bits (687), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 145/366 (39%), Positives = 212/366 (57%), Gaps = 21/366 (5%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II  + I  L+ LP  S+DLIFADPPY ++ +  L+R + +  + V D WDKF S + Y 
Sbjct: 9   IINADCIEALKVLPDNSIDLIFADPPYWMRTSKTLFRVEGTKFNGVEDEWDKFDSNDDYV 68

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            FT+ WL  C RVLKPNG+ WVIG    I+ IG ++Q+L FWI+ND++W K+NP PNF+G
Sbjct: 69  QFTKKWLSECHRVLKPNGSFWVIGGMQCIYTIGGLMQDLGFWIINDVIWHKTNPTPNFKG 128

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDV---------QMRSDWLIPICSGSE 193
            R QN+HETLIWA+ + K+K YTFNY   K  N +V         Q+ S W I + +GSE
Sbjct: 129 TRLQNSHETLIWATKNQKSK-YTFNYKTAKELNINVADYNKGSRNQLGSVWSISVVNGSE 187

Query: 194 RLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEM 253
           RL++ +G KLH TQKPE LL +I+  S+K  DI+LDPF G+ T+G +AK+  R +I IE 
Sbjct: 188 RLKDNEGLKLHSTQKPEELLYKIINISSKINDIVLDPFAGTMTTGKIAKQTGRKYIMIEQ 247

Query: 254 KQDYIDIATKRIASV-QPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPG-QILTNAQGN 311
            + Y      RI    + +G+IEL V   K    +V    ++    +  G Q       +
Sbjct: 248 DEKYCHYGANRIEKTKEKIGDIELAVFDIKPL--KVGLKDMINDNFLHLGEQFYLKNINH 305

Query: 312 ISATVCADGTLISGTELGSIHRVGAKVS-----GSETCNGWNFWYFEKLGELHSINTLRI 366
            +  + +DG L      G +H + +K +      +   NG+++W   +   + SI+ +R 
Sbjct: 306 KNVYLNSDGKLTDDN--GEVHDIHSKAALLLNKKASRVNGFDYWNVMRDNRIVSIDEIRN 363

Query: 367 LVRKEL 372
           L R+ L
Sbjct: 364 LYREYL 369


>gi|241888632|ref|ZP_04775939.1| DNA methylase [Gemella haemolysans ATCC 10379]
 gi|241864655|gb|EER69030.1| DNA methylase [Gemella haemolysans ATCC 10379]
          Length = 258

 Score =  230 bits (587), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 110/243 (45%), Positives = 156/243 (64%), Gaps = 6/243 (2%)

Query: 26  GNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFT 85
           G++  V+EK+ ++S+D+IFADPPY L  +G        +V      WDK SSFE    F 
Sbjct: 15  GDTFEVIEKIKSESIDMIFADPPYFLSNDG-FSNSGGKVVSVNKGDWDKISSFEEKHNFN 73

Query: 86  RAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRF 145
           R W+   +RVLKPNGT+W+ G+ HNI+ +G  L+   F ILN+I W+K+NP PN   R F
Sbjct: 74  REWIRKAKRVLKPNGTIWISGTLHNIYSVGMALEQEGFKILNNITWQKTNPAPNLSCRYF 133

Query: 146 QNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHP 205
            ++ ET++WA  + K   + +NYD +K  N   QM+  W  P+   SE+   K     HP
Sbjct: 134 THSTETILWARKADKYARHYYNYDLMKEINNGKQMKDVWTGPLTKISEKWAGK-----HP 188

Query: 206 TQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRI 265
           TQKPE LL RI+++ST+ GD +LDPF GSGT+G VAK+L R F GI+ K++Y+DIA +R+
Sbjct: 189 TQKPEYLLERIILASTEEGDYVLDPFVGSGTTGVVAKRLGRKFAGIDFKEEYLDIAKRRL 248

Query: 266 ASV 268
            +V
Sbjct: 249 EAV 251


>gi|289167373|ref|YP_003445642.1| DNA adenine methyltransferase, (adenine-specific methyltransferase
           DpnIIB) [Streptococcus mitis B6]
 gi|322377535|ref|ZP_08052026.1| DNA (cytosine-5-)-methyltransferase [Streptococcus sp. M334]
 gi|288906940|emb|CBJ21774.1| DNA adenine methyltransferase, (adenine-specific methyltransferase
           DpnIIB) [Streptococcus mitis B6]
 gi|321281735|gb|EFX58744.1| DNA (cytosine-5-)-methyltransferase [Streptococcus sp. M334]
          Length = 263

 Score =  224 bits (572), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 112/248 (45%), Positives = 156/248 (62%), Gaps = 8/248 (3%)

Query: 20  KDKII--KGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSS 77
           KDK+I    ++  +L K+  +S+D+IFADPPY L  NG +      +V      WDK SS
Sbjct: 20  KDKMILVHADTFKLLSKMKPESMDMIFADPPYFLS-NGGISNSGGQVVSVDKGDWDKISS 78

Query: 78  FEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPM 137
           FE    F R W+   + VLKPNGT+W+ GS HNI+ +G  L+   F ILN+I W+K+NP 
Sbjct: 79  FEEKHEFNRKWIRLAKEVLKPNGTIWISGSLHNIYSVGMALEQEGFKILNNITWQKTNPA 138

Query: 138 PNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRN 197
           PN   R F ++ ET++WA  + K   + +NYD +K  N+  QM+  W   +   +E+   
Sbjct: 139 PNLSCRYFTHSTETILWARKNDKKARHYYNYDLMKELNDGKQMKDVWTGALTKKAEKWAG 198

Query: 198 KDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDY 257
           K     HPTQKPE LL RI+++STK GD ILDPF GSGT+G VAK+L R FIGI+ +++Y
Sbjct: 199 K-----HPTQKPEYLLERIILASTKEGDYILDPFVGSGTTGVVAKRLGRRFIGIDAEKEY 253

Query: 258 IDIATKRI 265
           + IA KR+
Sbjct: 254 LKIAKKRL 261


>gi|322392398|ref|ZP_08065859.1| modification methylase BabI [Streptococcus peroris ATCC 700780]
 gi|321144933|gb|EFX40333.1| modification methylase BabI [Streptococcus peroris ATCC 700780]
          Length = 265

 Score =  224 bits (572), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 112/252 (44%), Positives = 157/252 (62%), Gaps = 8/252 (3%)

Query: 20  KDKII--KGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSS 77
           KDK+I    ++  +L K+  +S+D+IFADPPY L  NG +      +V      WDK SS
Sbjct: 20  KDKMILVHSDTFKLLSKMKPESMDMIFADPPYFLS-NGGISNSGGQVVSVDKGDWDKISS 78

Query: 78  FEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPM 137
           FE    F R W+   + VLKPNGT+W+ GS HNI+ +G  L+   F ILN+I W+K+NP 
Sbjct: 79  FEEKHEFNRKWIRLAKEVLKPNGTIWISGSLHNIYSVGMALEQEGFKILNNITWQKTNPA 138

Query: 138 PNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRN 197
           PN   R F ++ ET++WA  + K   + +NYD +K  N+  QM+  W   +   +E+   
Sbjct: 139 PNLSCRYFTHSTETILWARKNDKKARHYYNYDLMKELNDGKQMKDVWTGALTKKAEKWAG 198

Query: 198 KDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDY 257
           K     HPTQKPE LL RI+++STK GD ILDPF GSGT+G VAK+L R FIGI+ +++Y
Sbjct: 199 K-----HPTQKPEYLLERIILASTKEGDYILDPFVGSGTTGVVAKRLGRRFIGIDAEKEY 253

Query: 258 IDIATKRIASVQ 269
           + IA KR+   +
Sbjct: 254 LKIAKKRLEYTE 265


>gi|322375761|ref|ZP_08050273.1| DNA (cytosine-5-)-methyltransferase [Streptococcus sp. C300]
 gi|321279469|gb|EFX56510.1| DNA (cytosine-5-)-methyltransferase [Streptococcus sp. C300]
          Length = 270

 Score =  224 bits (571), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 112/248 (45%), Positives = 156/248 (62%), Gaps = 8/248 (3%)

Query: 20  KDKII--KGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSS 77
           KDK+I    ++  +L K+  +S+D+IFADPPY L  NG +      +V      WDK SS
Sbjct: 20  KDKMILVHADTFKLLSKMKPESMDMIFADPPYFLS-NGGISNSGGQVVSVDKGDWDKISS 78

Query: 78  FEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPM 137
           FE    F R W+   + VLKPNGT+W+ GS HNI+ +G  L+   F ILN+I W+K+NP 
Sbjct: 79  FEEKHEFNRKWIRLAKEVLKPNGTIWISGSLHNIYSVGMALEQEGFKILNNITWQKTNPA 138

Query: 138 PNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRN 197
           PN   R F ++ ET++WA  + K   + +NYD +K  N+  QM+  W   +   +E+   
Sbjct: 139 PNLSCRYFTHSTETILWARKNDKKARHYYNYDLMKELNDGKQMKDVWTGALTKKAEKWAG 198

Query: 198 KDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDY 257
           K     HPTQKPE LL RI+++STK GD ILDPF GSGT+G VAK+L R FIGI+ +++Y
Sbjct: 199 K-----HPTQKPEYLLERIILASTKEGDYILDPFVGSGTTGVVAKRLGRRFIGIDAEKEY 253

Query: 258 IDIATKRI 265
           + IA +RI
Sbjct: 254 LKIAKQRI 261


>gi|307705510|ref|ZP_07642364.1| modification methylase DpnIIB [Streptococcus mitis SK597]
 gi|307620968|gb|EFO00051.1| modification methylase DpnIIB [Streptococcus mitis SK597]
          Length = 253

 Score =  224 bits (571), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 112/252 (44%), Positives = 157/252 (62%), Gaps = 8/252 (3%)

Query: 20  KDKII--KGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSS 77
           KDK+I    ++  +L K+  +S+D+IFADPPY L  NG +      +V      WDK SS
Sbjct: 8   KDKMILVHADTFKLLSKMKPESMDMIFADPPYFLS-NGGISNSGGQVVSVDKGDWDKISS 66

Query: 78  FEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPM 137
           FE    F R W+   + VLKPNGT+W+ GS HNI+ +G  L+   F ILN+I W+K+NP 
Sbjct: 67  FEEKHEFNRKWIRLAKEVLKPNGTIWISGSLHNIYSVGMALEQEGFKILNNITWQKTNPA 126

Query: 138 PNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRN 197
           PN   R F ++ ET++WA  + K   + +NYD +K  N+  QM+  W   +   +E+   
Sbjct: 127 PNLSCRYFTHSTETILWARKNDKKARHYYNYDLMKELNDGKQMKDVWTGALTKKAEKWAG 186

Query: 198 KDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDY 257
           K     HPTQKPE LL RI+++STK GD ILDPF GSGT+G VAK+L R FIGI+ +++Y
Sbjct: 187 K-----HPTQKPEYLLERIILASTKEGDYILDPFVGSGTTGVVAKRLGRRFIGIDAEKEY 241

Query: 258 IDIATKRIASVQ 269
           + IA KR+   +
Sbjct: 242 LKIARKRLEYTE 253


>gi|14327902|ref|NP_116732.1| LlaDCHIB [Lactococcus lactis]
 gi|1709051|sp|P50178|MTL22_LACLC RecName: Full=Modification methylase LlaDCHIB; Short=M.LlaDCHI B;
           Short=M.LlaDCHIB; AltName: Full=Adenine-specific
           methyltransferase LlaDCHIB; AltName: Full=M.LlaII B
 gi|794257|gb|AAB06312.1| LlaDCHIB [Lactococcus lactis]
          Length = 269

 Score =  223 bits (568), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 113/255 (44%), Positives = 158/255 (61%), Gaps = 12/255 (4%)

Query: 11  ENQNSIFEWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTD 70
           E +N+I      ++  +S  +LEK+  +S+D+IFADPPY L  NG +      +V     
Sbjct: 19  EKENAI------LVHADSFKLLEKIKPESMDMIFADPPYFLS-NGGMSNSGGQIVSVDKG 71

Query: 71  SWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIV 130
            WDK SSFE    F R W+   R VLKPNGT+WV GS HNI+ +G  L+   F ILN+I 
Sbjct: 72  DWDKISSFEEKHDFNRRWIRLARLVLKPNGTIWVSGSLHNIYSVGMALEQEGFKILNNIT 131

Query: 131 WRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICS 190
           W+K+NP PN   R F ++ ET++WA  + K   + +NY+ +K  N+  QM+  W   +  
Sbjct: 132 WQKTNPAPNLSCRYFTHSTETILWARKNDKKSRHYYNYELMKEFNDGKQMKDVWTGSLTK 191

Query: 191 GSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIG 250
            SE+   K     HPTQKPE +L RI+++STK  D ILDPF GSGT+G VAK+L R FIG
Sbjct: 192 KSEKWAGK-----HPTQKPEYILERIILASTKENDYILDPFVGSGTTGVVAKRLGRKFIG 246

Query: 251 IEMKQDYIDIATKRI 265
           I+ +++Y+ IA KR+
Sbjct: 247 IDSEKEYLKIAKKRL 261


>gi|332199870|gb|EGJ13945.1| DNA methylase family protein [Streptococcus pneumoniae GA41317]
          Length = 256

 Score =  222 bits (565), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 108/245 (44%), Positives = 153/245 (62%), Gaps = 6/245 (2%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           ++  ++   L K+  +S+D+IFADPPY L  NG +      +V      WDK SSFE   
Sbjct: 13  LVHSDTFKFLSKMKPESMDMIFADPPYFLS-NGGISNSGGQVVSVDKGDWDKISSFEEKH 71

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            F R W+   + VLKPNGT+W+ GS HNI+ +G +L+   F ILN+I W+K+NP PN   
Sbjct: 72  EFNRKWIRLAKEVLKPNGTVWISGSLHNIYSVGMVLEQEGFKILNNITWQKTNPAPNLSC 131

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           R F ++ ET++WA  + K   + +NYD +K  N+  QM+  W   +    E+   K    
Sbjct: 132 RYFTHSTETILWARKNDKKARHYYNYDLMKELNDGKQMKDVWTGSLTKKVEKWAGK---- 187

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKPE LL RI+++STK GD ILDPF GSGT+G VAK+L R FIGI+ +++Y+ IA 
Sbjct: 188 -HPTQKPEYLLERIILASTKEGDYILDPFVGSGTTGVVAKRLGRRFIGIDAEKEYLKIAR 246

Query: 263 KRIAS 267
           KR+ +
Sbjct: 247 KRLEA 251


>gi|13542231|ref|NP_111919.1| adenine-specific DNA methylase [Thermoplasma volcanium GSS1]
          Length = 278

 Score =  221 bits (564), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 111/268 (41%), Positives = 164/268 (61%), Gaps = 2/268 (0%)

Query: 1   MSQKNSLAINENQNSIFEWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRP 60
           M  + S  IN  + +  E KD ++ G+S+ ++ ++     DLIF DPPY LQ+  +  + 
Sbjct: 1   MPIEKSSRINGGKMNREEVKDSVLLGDSLEIMRRIDDCIYDLIFLDPPYYLQMTPKRLKR 60

Query: 61  --DHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTML 118
             + S+   V + WD F SFEAYD+F  + L   +R++    T+W IG+YHNIFRIG ++
Sbjct: 61  WNNRSVPQTVREYWDAFPSFEAYDSFISSVLKEAKRLMSDTSTIWAIGTYHNIFRIGKIM 120

Query: 119 QNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDV 178
           Q++ FWILND+VW K+NPMPN+ G RF N+ ETLIWA+   + K YT+N +  K      
Sbjct: 121 QDMGFWILNDVVWIKTNPMPNWLGVRFTNSTETLIWATKGKEQKNYTYNRNLAKEFGLGK 180

Query: 179 QMRSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSG 238
              + W++    G+ER+R+++ + +HP QKP  L+ RI++SSTK GD+ILDPF G GT+G
Sbjct: 181 TANNVWVMKTSRGNERVRDENRKSVHPAQKPLELMKRIILSSTKEGDLILDPFAGVGTTG 240

Query: 239 AVAKKLRRSFIGIEMKQDYIDIATKRIA 266
             A  L R+F  IE    Y      R +
Sbjct: 241 VAASMLGRNFTLIEKDPVYYRAMLSRFS 268


>gi|127389|sp|P09358|MTD22_STRPN RecName: Full=Modification methylase DpnIIB; Short=M.DpnIIB;
           AltName: Full=Adenine-specific methyltransferase DpnIIB;
           AltName: Full=M.DpnII 2
 gi|6978344|gb|AAA88581.2| DNA adenine methyltransferase [Streptococcus pneumoniae]
          Length = 268

 Score =  221 bits (564), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 108/245 (44%), Positives = 152/245 (62%), Gaps = 6/245 (2%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           ++  ++   L K+  +S+D+IFADPPY L  NG +      +V      WDK SSFE   
Sbjct: 25  LVHSDTFKFLSKMKPESMDMIFADPPYFLS-NGGISNSGGQVVSVDKGDWDKISSFEEKH 83

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            F R W+   + VLKPNGT+W+ GS HNI+ +G  L+   F ILN+I W+K+NP PN   
Sbjct: 84  EFNRKWIRLAKEVLKPNGTVWISGSLHNIYSVGMALEQEGFKILNNITWQKTNPAPNLSC 143

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           R F ++ ET++WA  + K   + +NYD +K  N+  QM+  W   +    E+   K    
Sbjct: 144 RYFTHSTETILWARKNDKKARHYYNYDLMKELNDGKQMKDVWTGSLTKKVEKWAGK---- 199

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKPE LL RI+++STK GD ILDPF GSGT+G VAK+L R FIGI+ +++Y+ IA 
Sbjct: 200 -HPTQKPEYLLERIILASTKEGDYILDPFVGSGTTGVVAKRLGRRFIGIDAEKEYLKIAR 258

Query: 263 KRIAS 267
           KR+ +
Sbjct: 259 KRLEA 263


>gi|148998713|ref|ZP_01826151.1| putative adenine-specific DNA methylase [Streptococcus pneumoniae
           SP11-BS70]
 gi|149006496|ref|ZP_01830195.1| putative adenine-specific DNA methylase [Streptococcus pneumoniae
           SP18-BS74]
 gi|168491835|ref|ZP_02715978.1| DNA methylase [Streptococcus pneumoniae CDC0288-04]
 gi|168574962|ref|ZP_02720925.1| DNA methylase [Streptococcus pneumoniae MLV-016]
 gi|169832858|ref|YP_001695216.1| DNA methylase [Streptococcus pneumoniae Hungary19A-6]
 gi|194398425|ref|YP_002038438.1| DNA adenine methyltransferase DpnII [Streptococcus pneumoniae G54]
 gi|225857437|ref|YP_002738948.1| DNA methylase [Streptococcus pneumoniae P1031]
 gi|225859611|ref|YP_002741121.1| DNA methylase [Streptococcus pneumoniae 70585]
 gi|307068464|ref|YP_003877430.1| DNA modification methylase [Streptococcus pneumoniae AP200]
 gi|307128045|ref|YP_003880076.1| DNA methylase [Streptococcus pneumoniae 670-6B]
 gi|147755407|gb|EDK62456.1| putative adenine-specific DNA methylase [Streptococcus pneumoniae
           SP11-BS70]
 gi|147761794|gb|EDK68757.1| putative adenine-specific DNA methylase [Streptococcus pneumoniae
           SP18-BS74]
 gi|168995360|gb|ACA35972.1| DNA methylase [Streptococcus pneumoniae Hungary19A-6]
 gi|183573905|gb|EDT94433.1| DNA methylase [Streptococcus pneumoniae CDC0288-04]
 gi|183578786|gb|EDT99314.1| DNA methylase [Streptococcus pneumoniae MLV-016]
 gi|194358092|gb|ACF56540.1| DNA adenine methyltransferase DpnII [Streptococcus pneumoniae G54]
 gi|225720270|gb|ACO16124.1| DNA methylase [Streptococcus pneumoniae 70585]
 gi|225724476|gb|ACO20328.1| DNA methylase [Streptococcus pneumoniae P1031]
 gi|301794813|emb|CBW37269.1| DNA methylase [Streptococcus pneumoniae INV104]
 gi|306410001|gb|ADM85428.1| DNA modification methylase [Streptococcus pneumoniae AP200]
 gi|306485107|gb|ADM91976.1| DNA methylase [Streptococcus pneumoniae 670-6B]
 gi|332073000|gb|EGI83481.1| DNA methylase family protein [Streptococcus pneumoniae GA17545]
 gi|332201259|gb|EGJ15330.1| DNA methylase family protein [Streptococcus pneumoniae GA47901]
          Length = 256

 Score =  221 bits (563), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 108/245 (44%), Positives = 152/245 (62%), Gaps = 6/245 (2%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           ++  ++   L K+  +S+D+IFADPPY L  NG +      +V      WDK SSFE   
Sbjct: 13  LVHSDTFKFLSKMKPESMDMIFADPPYFLS-NGGISNSGGQVVSVDKGDWDKISSFEEKH 71

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            F R W+   + VLKPNGT+W+ GS HNI+ +G  L+   F ILN+I W+K+NP PN   
Sbjct: 72  EFNRKWIRLAKEVLKPNGTVWISGSLHNIYSVGMALEQEGFKILNNITWQKTNPAPNLSC 131

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           R F ++ ET++WA  + K   + +NYD +K  N+  QM+  W   +    E+   K    
Sbjct: 132 RYFTHSTETILWARKNDKKARHYYNYDLMKELNDGKQMKDVWTGSLTKKVEKWAGK---- 187

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKPE LL RI+++STK GD ILDPF GSGT+G VAK+L R FIGI+ +++Y+ IA 
Sbjct: 188 -HPTQKPEYLLERIILASTKEGDYILDPFVGSGTTGVVAKRLGRRFIGIDAEKEYLKIAR 246

Query: 263 KRIAS 267
           KR+ +
Sbjct: 247 KRLEA 251


>gi|24378989|ref|NP_720944.1| putative adenine-specific DNA methylase [Streptococcus mutans
           UA159]
 gi|24376880|gb|AAN58250.1|AE014896_6 putative adenine-specific DNA methylase [Streptococcus mutans
           UA159]
          Length = 269

 Score =  221 bits (562), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 110/254 (43%), Positives = 158/254 (62%), Gaps = 8/254 (3%)

Query: 17  FEWKDK--IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDK 74
           + +K+K  ++  ++   LEK+ ++S+D+IFADPPY L  NG        +V      WDK
Sbjct: 17  YYYKNKTILVHADTFQFLEKMKSESIDMIFADPPYFLS-NGGFSNSGGQVVSVDKGDWDK 75

Query: 75  FSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKS 134
            +S E    F R W+   ++VLK NGT+W+ GS HNI+ +G  L+   F ILN+I W+K+
Sbjct: 76  AASLEEKHEFNRRWIRLAKKVLKSNGTIWISGSLHNIYSVGMALEQEGFKILNNITWQKT 135

Query: 135 NPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSER 194
           NP+PN   R F ++ ET++WA  + K   + +NYD +K  N+  QM+  W   +   SE+
Sbjct: 136 NPVPNLSCRYFTHSTETILWARKNDKKSKHYYNYDLMKKINDGKQMKDVWTGSLTKKSEK 195

Query: 195 LRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMK 254
              K     HPTQKPE LL RI+++STK GD ILDPF GSGT+G VAKKL R FIGI+ +
Sbjct: 196 WAGK-----HPTQKPEYLLERIILASTKKGDYILDPFVGSGTTGVVAKKLGRRFIGIDSE 250

Query: 255 QDYIDIATKRIASV 268
           ++Y+ IA  R+  V
Sbjct: 251 REYLRIARTRLERV 264


>gi|14325665|dbj|BAB60568.1| DNA adenine modification methylase [Thermoplasma volcanium GSS1]
          Length = 265

 Score =  220 bits (561), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 107/251 (42%), Positives = 157/251 (62%), Gaps = 2/251 (0%)

Query: 18  EWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRP--DHSLVDAVTDSWDKF 75
           E KD ++ G+S+ ++ ++     DLIF DPPY LQ+  +  +   + S+   V + WD F
Sbjct: 5   EVKDSVLLGDSLEIMRRIDDCIYDLIFLDPPYYLQMTPKRLKRWNNRSVPQTVREYWDAF 64

Query: 76  SSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSN 135
            SFEAYD+F  + L   +R++    T+W IG+YHNIFRIG ++Q++ FWILND+VW K+N
Sbjct: 65  PSFEAYDSFISSVLKEAKRLMSDTSTIWAIGTYHNIFRIGKIMQDMGFWILNDVVWIKTN 124

Query: 136 PMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERL 195
           PMPN+ G RF N+ ETLIWA+   + K YT+N +  K         + W++    G+ER+
Sbjct: 125 PMPNWLGVRFTNSTETLIWATKGKEQKNYTYNRNLAKEFGLGKTANNVWVMKTSRGNERV 184

Query: 196 RNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQ 255
           R+++ + +HP QKP  L+ RI++SSTK GD+ILDPF G GT+G  A  L R+F  IE   
Sbjct: 185 RDENRKSVHPAQKPLELMKRIILSSTKEGDLILDPFAGVGTTGVAASMLGRNFTLIEKDP 244

Query: 256 DYIDIATKRIA 266
            Y      R +
Sbjct: 245 VYYRAMLSRFS 255


>gi|325696288|gb|EGD38179.1| modification methylase BabI [Streptococcus sanguinis SK160]
          Length = 265

 Score =  220 bits (561), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 108/243 (44%), Positives = 150/243 (61%), Gaps = 6/243 (2%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           ++  ++   L K+  +S+D+IFADPPY L  NG       ++V      WDK S  E   
Sbjct: 25  LVHADTFDFLSKMKPESMDMIFADPPYFLS-NGGFSNSGGNIVSVDKGDWDKVSGLEEKH 83

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            F R WL   R +LKPNGT+W+ GS HNI+ +G  L+   F ILN+I W+KSNP PN   
Sbjct: 84  DFNRRWLRLVRPILKPNGTIWISGSLHNIYSVGMALEQEGFKILNNITWQKSNPAPNLSC 143

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           R F ++ ET++WA    K   + +NYD +K  N   QM+  W+ P+   +E+   K    
Sbjct: 144 RYFTHSTETILWARKDDKKAKHYYNYDLMKDINGGKQMKDVWIGPLTKKAEKWAGK---- 199

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKPE LL RI+++STK  D ILDPF GSGT+G VAK+L R FIGI+ ++DY++IA 
Sbjct: 200 -HPTQKPEYLLERIILASTKENDYILDPFVGSGTTGVVAKRLGRKFIGIDAEKDYLEIAK 258

Query: 263 KRI 265
           +R+
Sbjct: 259 RRL 261


>gi|160940911|ref|ZP_02088251.1| hypothetical protein CLOBOL_05803 [Clostridium bolteae ATCC
           BAA-613]
 gi|158436155|gb|EDP13922.1| hypothetical protein CLOBOL_05803 [Clostridium bolteae ATCC
           BAA-613]
          Length = 265

 Score =  220 bits (561), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 108/248 (43%), Positives = 154/248 (62%), Gaps = 6/248 (2%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           K+  G+ + +L K+  +SVD+IFADPPY L  NG +      +V     SWD+   F+  
Sbjct: 19  KLYLGDCLELLRKMKPESVDMIFADPPYFLSNNG-ITCQGGRMVSVNKASWDEGGDFKEN 77

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFR 141
            AF R W+  CRRVLKP GT+W+ G+ HNI+ IG  LQ   + I+N+I W+K+NP PN  
Sbjct: 78  HAFNRRWIRMCRRVLKPGGTIWISGTLHNIYSIGMALQQERYKIINNITWKKTNPPPNLA 137

Query: 142 GRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGE 201
            R F ++ ET++WA    K   + FNY+ +K  N   QM+  W   +   SE+   +   
Sbjct: 138 CRCFTHSTETILWARKDEKKARHLFNYEQMKQMNGGKQMKDVWEGNLTRPSEKWAGR--- 194

Query: 202 KLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIA 261
             HPTQKPE LL RI+++STK GD++LDPF GSGT+G V+ K  R FIGI+  ++Y+DIA
Sbjct: 195 --HPTQKPEYLLERIILASTKKGDVVLDPFCGSGTTGVVSGKYGRQFIGIDNNEEYLDIA 252

Query: 262 TKRIASVQ 269
            +R+  +Q
Sbjct: 253 KRRLDQIQ 260


>gi|290580993|ref|YP_003485385.1| putative adenine-specific DNA methylase [Streptococcus mutans
           NN2025]
 gi|254997892|dbj|BAH88493.1| putative adenine-specific DNA methylase [Streptococcus mutans
           NN2025]
          Length = 257

 Score =  220 bits (560), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 107/246 (43%), Positives = 153/246 (62%), Gaps = 6/246 (2%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           ++  ++   LEK+ ++S+D+IFADPPY L  NG        ++      WDK +S E   
Sbjct: 13  LVHADTFQFLEKMKSESIDMIFADPPYFLS-NGGFSNSGGQVISVDKGDWDKAASLEEKH 71

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            F R W+   ++VLK NGT+W+ GS HNI+ +G  L+   F ILN+I W+K+NP+PN   
Sbjct: 72  EFNRRWIRLAKKVLKSNGTIWISGSLHNIYSVGMALEQEGFKILNNITWQKTNPVPNLSC 131

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           R F ++ ET++WA  + K   + +NYD +K  N+  QM+  W   +   SE+   K    
Sbjct: 132 RYFTHSTETILWARKNDKKSKHYYNYDLMKKINDGKQMKDVWTGSLTKKSEKWAGK---- 187

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKPE LL RI+++STK GD ILDPF GSGT+G VAKKL R FIGI+ +++Y+ IA 
Sbjct: 188 -HPTQKPEYLLERIILASTKKGDYILDPFVGSGTTGVVAKKLGRRFIGIDSEREYLRIAR 246

Query: 263 KRIASV 268
            R+  V
Sbjct: 247 TRLERV 252


>gi|332362311|gb|EGJ40111.1| modification methylase BabI [Streptococcus sanguinis SK1056]
          Length = 265

 Score =  219 bits (558), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 107/243 (44%), Positives = 150/243 (61%), Gaps = 6/243 (2%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           ++  ++   L ++  +S+D+IFADPPY L  NG       ++V      WDK S  E   
Sbjct: 25  LVHADTFDFLSQMKPESMDMIFADPPYFLS-NGGFSNSGGNIVSVDKGDWDKVSGLEEKH 83

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            F R WL   R +LKPNGT+W+ GS HNI+ +G  L+   F ILN+I W+KSNP PN   
Sbjct: 84  DFNRQWLRLVRPILKPNGTIWISGSLHNIYSVGMALEQEGFKILNNITWQKSNPAPNLSC 143

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           R F ++ ET++WA    K   + +NYD +K  N   QM+  W+ P+   +E+   K    
Sbjct: 144 RYFTHSTETILWARKDDKKAKHYYNYDLMKDINGGKQMKDVWIGPLTKKAEKWAGK---- 199

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKPE LL RI+++STK  D ILDPF GSGT+G VAK+L R FIGI+ ++DY++IA 
Sbjct: 200 -HPTQKPEYLLERIILASTKENDYILDPFVGSGTTGVVAKRLGRKFIGIDAEKDYLEIAK 258

Query: 263 KRI 265
           +R+
Sbjct: 259 RRL 261


>gi|125718516|ref|YP_001035649.1| modification methylase DpnIIB [Streptococcus sanguinis SK36]
 gi|125498433|gb|ABN45099.1| Modification methylase DpnIIB, putative [Streptococcus sanguinis
           SK36]
          Length = 267

 Score =  219 bits (558), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 107/243 (44%), Positives = 150/243 (61%), Gaps = 6/243 (2%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           ++  ++   L ++  +S+D+IFADPPY L  NG       ++V      WDK S  E   
Sbjct: 25  LVHADTFDFLSQMKPESMDMIFADPPYFLS-NGGFSNSGGNIVSVDKGDWDKVSGLEEKH 83

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            F R WL   R +LKPNGT+W+ GS HNI+ +G  L+   F ILN+I W+KSNP PN   
Sbjct: 84  DFNRRWLRLVRPILKPNGTIWISGSLHNIYSVGMALEQEGFKILNNITWQKSNPAPNLSC 143

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           R F ++ ET++WA    K   + +NYD +K  N   QM+  W+ P+   +E+   K    
Sbjct: 144 RYFTHSTETILWARKDDKKAKHYYNYDLMKDINGGKQMKDVWIGPLTKKAEKWAGK---- 199

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKPE LL RI+++STK  D ILDPF GSGT+G VAK+L R FIGI+ ++DY++IA 
Sbjct: 200 -HPTQKPEYLLERIILASTKENDYILDPFVGSGTTGVVAKRLGRKFIGIDAEKDYLEIAK 258

Query: 263 KRI 265
           +R+
Sbjct: 259 RRL 261


>gi|324991367|gb|EGC23300.1| modification methylase BabI [Streptococcus sanguinis SK353]
 gi|325687054|gb|EGD29077.1| modification methylase BabI [Streptococcus sanguinis SK72]
          Length = 267

 Score =  219 bits (558), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 107/243 (44%), Positives = 150/243 (61%), Gaps = 6/243 (2%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           ++  ++   L ++  +S+D+IFADPPY L  NG       ++V      WDK S  E   
Sbjct: 25  LVHADTFDFLSQMKPESMDMIFADPPYFLS-NGGFSNSGGNIVSVDKGDWDKVSGLEEKH 83

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            F R WL   R +LKPNGT+W+ GS HNI+ +G  L+   F ILN+I W+KSNP PN   
Sbjct: 84  DFNRRWLRLVRPILKPNGTIWISGSLHNIYSVGMALEQEGFKILNNITWQKSNPAPNLSC 143

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           R F ++ ET++WA    K   + +NYD +K  N   QM+  W+ P+   +E+   K    
Sbjct: 144 RYFTHSTETILWARKDDKKAKHYYNYDLMKDINGGKQMKDVWIGPLTKKAEKWAGK---- 199

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKPE LL RI+++STK  D ILDPF GSGT+G VAK+L R FIGI+ ++DY++IA 
Sbjct: 200 -HPTQKPEYLLERIILASTKENDYILDPFVGSGTTGVVAKRLGRKFIGIDAEKDYLEIAK 258

Query: 263 KRI 265
           +R+
Sbjct: 259 RRL 261


>gi|327470495|gb|EGF15951.1| modification methylase BabI [Streptococcus sanguinis SK330]
          Length = 265

 Score =  219 bits (557), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 107/243 (44%), Positives = 150/243 (61%), Gaps = 6/243 (2%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           ++  ++   L ++  +S+D+IFADPPY L  NG       ++V      WDK S  E   
Sbjct: 25  LVHADTFDFLSQMKPESMDMIFADPPYFLS-NGGFSNSGGNIVSVDKGDWDKVSGLEEKH 83

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            F R WL   R +LKPNGT+W+ GS HNI+ +G  L+   F ILN+I W+KSNP PN   
Sbjct: 84  DFNRRWLRLVRPILKPNGTIWISGSLHNIYSVGMALEQEGFKILNNITWQKSNPAPNLSC 143

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           R F ++ ET++WA    K   + +NYD +K  N   QM+  W+ P+   +E+   K    
Sbjct: 144 RYFTHSTETILWARKDDKKAKHYYNYDLMKDINGGKQMKDVWIGPLTKKAEKWAGK---- 199

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKPE LL RI+++STK  D ILDPF GSGT+G VAK+L R FIGI+ ++DY++IA 
Sbjct: 200 -HPTQKPEYLLERIILASTKENDYILDPFVGSGTTGVVAKRLGRKFIGIDAEKDYLEIAK 258

Query: 263 KRI 265
           +R+
Sbjct: 259 RRL 261


>gi|48290858|dbj|BAB63435.2| DNA adenine methylase M.Ssu4109IB [Streptococcus suis]
          Length = 271

 Score =  219 bits (557), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 105/243 (43%), Positives = 152/243 (62%), Gaps = 6/243 (2%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           ++  ++   L+K+  +S+D+IFADPPY L  NG +      +V      WDK +S E   
Sbjct: 25  LVHADTFEFLDKMKPESMDMIFADPPYFLS-NGGISNSGGQVVSVDKGDWDKVNSLEEKH 83

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            F R W+   + VLKPNGT+W+ GS+HNI+ +G  L+   F ILN+I W+K+NP PN   
Sbjct: 84  EFNRKWIRLAKNVLKPNGTIWISGSFHNIYSVGMALEQEGFKILNNITWQKTNPAPNLSC 143

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           R F ++ ET++WA    K   + +NY+ +K  N+  QM+  W+  +   SE+   K    
Sbjct: 144 RYFTHSTETILWARKDDKKARHYYNYELMKELNDGKQMKDVWVGGLTKKSEKWAGK---- 199

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKPE LL RI+++ST+ GD ILDPF GSGT+G VAK+L R FIGI+ ++DY+ IA 
Sbjct: 200 -HPTQKPEYLLERIILASTREGDYILDPFVGSGTTGVVAKRLGRKFIGIDAERDYLKIAR 258

Query: 263 KRI 265
            R+
Sbjct: 259 TRL 261


>gi|322372954|ref|ZP_08047490.1| DNA (cytosine-5-)-methyltransferase [Streptococcus sp. C150]
 gi|321277996|gb|EFX55065.1| DNA (cytosine-5-)-methyltransferase [Streptococcus sp. C150]
          Length = 270

 Score =  218 bits (555), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 108/251 (43%), Positives = 155/251 (61%), Gaps = 8/251 (3%)

Query: 17  FEWKDK--IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDK 74
           + +KDK  ++  ++   L+K+  +S+D+IFADPPY L  NG        +V      WDK
Sbjct: 5   YYYKDKAILVHADTFEFLKKIKPESMDMIFADPPYFLS-NGGFSNSGGKVVSVNKGDWDK 63

Query: 75  FSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKS 134
             + E    F R W+   ++VLKPNGT+WV GS+HNI+ +G  L+   F ILN+I W+K+
Sbjct: 64  IDTLEEKHDFNRNWIRLAKKVLKPNGTIWVSGSFHNIYSVGMALEQEGFKILNNITWQKT 123

Query: 135 NPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSER 194
           NP PN   R F ++ ET++WA  + K   + +NY+ +K  N   QM+  W   +   +E+
Sbjct: 124 NPAPNLSCRYFTHSTETVLWARKNDKKAKHYYNYELMKELNGGKQMKDVWTGALTKKAEK 183

Query: 195 LRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMK 254
              K     HPTQKPE LL RI+++STKP D ILDPF GSGT+G VAK+L R FIGI+ +
Sbjct: 184 WAGK-----HPTQKPEYLLERIILASTKPNDYILDPFVGSGTTGVVAKRLGRYFIGIDSE 238

Query: 255 QDYIDIATKRI 265
           +DY+ IA  R+
Sbjct: 239 KDYLKIAQARL 249


>gi|12082202|dbj|BAB20829.1| DNA adenine methylase M.SsuMB [Streptococcus suis]
 gi|15281320|dbj|BAB63414.1| DNA adenine methylase M.Ssu11318IB [Streptococcus suis]
 gi|15281326|dbj|BAB63419.1| DNA adenine methylase M.Ssu4961IB [Streptococcus suis]
 gi|15281332|dbj|BAB63424.1| DNA adenine methylase M.Ssu8074IB [Streptococcus suis]
 gi|15281338|dbj|BAB63429.1| DNA adenine methylase M.Ssu2479IB [Streptococcus suis]
          Length = 271

 Score =  217 bits (553), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 105/243 (43%), Positives = 150/243 (61%), Gaps = 6/243 (2%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           ++  ++   L K+  +S+D+IFADPPY L  NG +      +V      WDK  S E   
Sbjct: 25  LVHADTFEFLNKMKPESMDMIFADPPYFLS-NGGISNSGGQVVSVDKGDWDKVDSLEEKH 83

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            F R W+   + VLKPNGT+W+ GS+HNI+ +G  L+   F ILN+I W+K+NP PN   
Sbjct: 84  EFNRKWIRLAKNVLKPNGTIWISGSFHNIYSVGMALEQEGFKILNNITWQKTNPAPNLSC 143

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           R F ++ ET++WA    K   + +NY+ +K  N+  QM+  W+  +   SE+   K    
Sbjct: 144 RYFTHSTETILWARKDDKKARHYYNYELMKELNDGKQMKDVWVGGLTKKSEKWAGK---- 199

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKPE LL RI+++ST+ GD ILDPF GSGT+G VAK+L R FIGI+ ++DY+ IA 
Sbjct: 200 -HPTQKPEYLLERIILASTQEGDYILDPFVGSGTTGVVAKRLGRKFIGIDAERDYLKIAR 258

Query: 263 KRI 265
            R+
Sbjct: 259 TRL 261


>gi|295399896|ref|ZP_06809877.1| DNA methylase N-4/N-6 domain protein [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|312111585|ref|YP_003989901.1| DNA methylase N-4/N-6 domain protein [Geobacillus sp. Y4.1MC1]
 gi|294978299|gb|EFG53896.1| DNA methylase N-4/N-6 domain protein [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|311216686|gb|ADP75290.1| DNA methylase N-4/N-6 domain protein [Geobacillus sp. Y4.1MC1]
          Length = 267

 Score =  217 bits (553), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 112/256 (43%), Positives = 155/256 (60%), Gaps = 9/256 (3%)

Query: 16  IFEWKDKI--IKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWD 73
           IF ++D +  I GN I  L +L   SVD+IFADPPY L  +G +      +V      WD
Sbjct: 13  IFYYQDNLLLINGNCIDWLNRLEKNSVDMIFADPPYFLS-SGGITCHSGKMVSVDKGEWD 71

Query: 74  KFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRK 133
           K S+     +F + WL AC+RVLK  GT+W+ G+ HNI+ IG  L  L + ILN+I W K
Sbjct: 72  KPSTLNEIHSFNKEWLYACKRVLKDGGTIWISGTLHNIYSIGFALNELEYKILNNITWYK 131

Query: 134 SNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSE 193
            N  PN   R F ++ ET++WA    K   Y FNY+ +K  N   QMR  W IP    SE
Sbjct: 132 KNASPNLSCRYFTHSTETILWARKGKKTSHY-FNYNLMKEMNGGKQMRDVWEIPTTKKSE 190

Query: 194 RLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEM 253
           +   +     HPTQKP  LL RI+++STK  DI+LDPF GSGT+G VAKKL R +IGI++
Sbjct: 191 KAHGR-----HPTQKPIELLERIILASTKINDIVLDPFNGSGTTGVVAKKLNRRYIGIDI 245

Query: 254 KQDYIDIATKRIASVQ 269
           +++Y+++  KR+ + +
Sbjct: 246 EKEYLELTIKRLEATE 261


>gi|223932377|ref|ZP_03624380.1| DNA methylase N-4/N-6 domain protein [Streptococcus suis 89/1591]
 gi|330831883|ref|YP_004400708.1| DNA adenine methylase M.SsuMB [Streptococcus suis ST3]
 gi|223899058|gb|EEF65416.1| DNA methylase N-4/N-6 domain protein [Streptococcus suis 89/1591]
 gi|329306106|gb|AEB80522.1| DNA adenine methylase M.SsuMB [Streptococcus suis ST3]
          Length = 259

 Score =  217 bits (552), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 105/243 (43%), Positives = 150/243 (61%), Gaps = 6/243 (2%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           ++  ++   L K+  +S+D+IFADPPY L  NG +      +V      WDK  S E   
Sbjct: 13  LVHADTFEFLNKMKPESMDMIFADPPYFLS-NGGISNSGGQVVSVDKGDWDKVDSLEEKH 71

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            F R W+   + VLKPNGT+W+ GS+HNI+ +G  L+   F ILN+I W+K+NP PN   
Sbjct: 72  EFNRKWIRLAKNVLKPNGTIWISGSFHNIYSVGMALEQEGFKILNNITWQKTNPAPNLSC 131

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           R F ++ ET++WA    K   + +NY+ +K  N+  QM+  W+  +   SE+   K    
Sbjct: 132 RYFTHSTETILWARKDDKKARHYYNYELMKELNDGKQMKDVWVGGLTKKSEKWAGK---- 187

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKPE LL RI+++ST+ GD ILDPF GSGT+G VAK+L R FIGI+ ++DY+ IA 
Sbjct: 188 -HPTQKPEYLLERIILASTQEGDYILDPFVGSGTTGVVAKRLGRKFIGIDAERDYLKIAR 246

Query: 263 KRI 265
            R+
Sbjct: 247 TRL 249


>gi|296126987|ref|YP_003634239.1| DNA methylase N-4/N-6 domain protein [Brachyspira murdochii DSM
           12563]
 gi|296018803|gb|ADG72040.1| DNA methylase N-4/N-6 domain protein [Brachyspira murdochii DSM
           12563]
          Length = 259

 Score =  215 bits (548), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 114/256 (44%), Positives = 158/256 (61%), Gaps = 16/256 (6%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           IIKG+ + VL+ +   S+D+IFADPPYNL  NG        +V      WD+   FE   
Sbjct: 5   IIKGDCLEVLDTIEENSIDMIFADPPYNLSNNGITCHAG-KMVSVNKGEWDRSLGFEEDT 63

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
           AF  AW+  CRRVLK  GT+W+ G+ H+I++ G +L+ L F+ILNDIVW K N  PN   
Sbjct: 64  AFHEAWISKCRRVLKDEGTIWISGTNHSIYKCGYILEKLGFYILNDIVWYKPNAAPNLSC 123

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAAN-ED-------VQMRSDWLIPICSGSER 194
           + F ++HET++WA  +  AK Y +NYD +K  + ED        QMRS W I   S SE+
Sbjct: 124 KVFTHSHETILWAKKNKNAKHY-YNYDLMKNMDFEDDKLKSKGKQMRSVWSISAPSKSEK 182

Query: 195 LRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKL-RRSFIGIEM 253
           +  K     HPTQKP  LL+RI+++STK  D ILDPF GSGT+ A  K +  R++IGIE+
Sbjct: 183 IHGK-----HPTQKPLKLLTRIILASTKENDTILDPFNGSGTTAAACKIIGNRNYIGIEI 237

Query: 254 KQDYIDIATKRIASVQ 269
            ++YI++  KR+  + 
Sbjct: 238 DENYIELTNKRLNDID 253


>gi|210620631|ref|ZP_03292155.1| hypothetical protein CLOHIR_00098 [Clostridium hiranonis DSM 13275]
 gi|210155240|gb|EEA86246.1| hypothetical protein CLOHIR_00098 [Clostridium hiranonis DSM 13275]
          Length = 267

 Score =  215 bits (548), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 108/249 (43%), Positives = 155/249 (62%), Gaps = 9/249 (3%)

Query: 20  KDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFS--- 76
           K K+I G++ S+L K+  +S+D+IFADPPY L  NG +      +V     SWD  +   
Sbjct: 18  KSKLILGDTFSILSKIKKESIDMIFADPPYFLSNNG-ITCSGGKMVSVNKGSWDTLNLGN 76

Query: 77  SFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNP 136
           S      F R W+  C+RVLKPNGT+W+ G+ HNI+ IG  L+   F I+N+I W+K+NP
Sbjct: 77  SVSEKHKFNRKWIKMCKRVLKPNGTIWISGTMHNIYSIGMALEQEGFKIINNITWQKTNP 136

Query: 137 MPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLR 196
            PN   R F ++ ET++WA  + K   + FNY+ +K  N   QM+  W     +GS   +
Sbjct: 137 PPNLACRCFTHSTETVLWAKKNDKKSKHLFNYNDMKEMNGGKQMKDVW-----TGSLTKK 191

Query: 197 NKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQD 256
           ++  E  HPTQKPE LL RI++SST+   IILDPF GSGT+G +AK+  R FIGI+ + +
Sbjct: 192 SEKSEGKHPTQKPEYLLERIVISSTEENQIILDPFCGSGTTGVIAKRYGRKFIGIDNEIE 251

Query: 257 YIDIATKRI 265
           Y++I  KR+
Sbjct: 252 YLNITKKRL 260


>gi|309801799|ref|ZP_07695917.1| DNA (cytosine-5-)-methyltransferase [Bifidobacterium dentium
           JCVIHMP022]
 gi|308221553|gb|EFO77847.1| DNA (cytosine-5-)-methyltransferase [Bifidobacterium dentium
           JCVIHMP022]
          Length = 261

 Score =  211 bits (538), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 102/245 (41%), Positives = 154/245 (62%), Gaps = 6/245 (2%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           +++  G++ S+L K+  +SVD+IFADPPY L  NG +      +V      WDK +SFEA
Sbjct: 18  EELFLGDTFSLLPKMQPESVDMIFADPPYFLS-NGGISCHSGRMVSVDKGDWDKGASFEA 76

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
              F R W+  C+ VL PNGT+W+ G+ HNI+ +G  L+   F I+N+I W+K+NP PN 
Sbjct: 77  KHEFNRNWIRLCKTVLAPNGTIWISGTLHNIYSVGVALEQEGFKIINNITWQKTNPPPNL 136

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
             R F ++ ET++WA  + +   + FNY  +K  N   QM+  W   +    E++  K  
Sbjct: 137 ACRCFTHSTETVLWAQRNDRCSKHFFNYALMKEMNGGKQMKDVWTGSLTPKREKIEGK-- 194

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
              HPTQKP  LL RI++SST+PGD++LDPF GS T+G  A+KL R +IGI+ + +YI++
Sbjct: 195 ---HPTQKPLYLLERIILSSTEPGDLVLDPFCGSSTTGVAAQKLGRKYIGIDNEPEYIEL 251

Query: 261 ATKRI 265
           + +R+
Sbjct: 252 SKRRL 256


>gi|296274511|ref|YP_003657142.1| DNA methylase N-4/N-6 domain-containing protein [Arcobacter
           nitrofigilis DSM 7299]
 gi|296098685|gb|ADG94635.1| DNA methylase N-4/N-6 domain protein [Arcobacter nitrofigilis DSM
           7299]
          Length = 263

 Score =  211 bits (537), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 112/252 (44%), Positives = 150/252 (59%), Gaps = 16/252 (6%)

Query: 26  GNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFT 85
           GN I +L+K+   S+D+IFADPPY L  NG +   +  +V      WDK    E    F 
Sbjct: 19  GNCIEILKKIKKDSIDMIFADPPYGLSNNG-ITCKNGKMVSVNKGEWDKSKGIEEDFKFH 77

Query: 86  RAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRF 145
             W+ AC+RVLKPNGT+W+ G+YH+I+  G  LQ   F +LN+I W K N  PN   + F
Sbjct: 78  NQWIKACQRVLKPNGTIWISGTYHSIYACGYALQKNKFKVLNEISWFKPNAAPNLSCKYF 137

Query: 146 QNAHETLIWASPSPKAKGYTFNYDALKAA---------NEDVQMRSDWLIPICSGSERLR 196
             +HET+IWA      K +T+NY  +K           NED QMRS W I   S  E+L 
Sbjct: 138 TASHETIIWAIKESTQK-HTYNYKTMKHGDWHKKDIIKNEDKQMRSVWSIATPSKKEKLF 196

Query: 197 NKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQD 256
            K     HPTQKP  LL RI++SST   DIILDPF GS T+G VA +  R FIGI+M+++
Sbjct: 197 GK-----HPTQKPIKLLERIILSSTNENDIILDPFTGSSTTGVVALQNNRQFIGIDMEKE 251

Query: 257 YIDIATKRIASV 268
           Y++++ KRI ++
Sbjct: 252 YLNLSIKRIHNI 263


>gi|238917688|ref|YP_002931205.1| site-specific DNA-methyltransferase (adenine-specific) [Eubacterium
           eligens ATCC 27750]
 gi|238873048|gb|ACR72758.1| site-specific DNA-methyltransferase (adenine-specific) [Eubacterium
           eligens ATCC 27750]
          Length = 267

 Score =  209 bits (533), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 103/253 (40%), Positives = 154/253 (60%), Gaps = 10/253 (3%)

Query: 20  KDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSS-- 77
           + +++ G+S  +L K+  +SVD+IFADPPY L  +G +      +V     SWDK S   
Sbjct: 17  QSQLVLGDSFKILTKMKPESVDMIFADPPYFLSNDG-ITCQGGKMVSVNKGSWDKLSESG 75

Query: 78  --FEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSN 135
              E    F R W+  CR+VLKPNGT+W+ G+ HNI+ IG  L+   F I+N+I W+K+N
Sbjct: 76  TGVEEKHKFNRKWIKLCRKVLKPNGTIWISGTLHNIYSIGMALEQEGFKIINNITWQKTN 135

Query: 136 PMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERL 195
           P PN   R F ++ ET++WA  + K   + F+Y  +K  N   QM+  W   +   SE+ 
Sbjct: 136 PPPNLACRCFTHSTETILWAQKNDKKSRHFFDYQKMKEMNGGKQMKDVWTGALTKPSEKT 195

Query: 196 RNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQ 255
             K     HPTQKPE LL +I+++ST+ G +ILDPF GSGT+G  A +  R FIGI++ +
Sbjct: 196 EGK-----HPTQKPEYLLEKIVLASTEEGQVILDPFCGSGTTGVEAVRFGRKFIGIDVSE 250

Query: 256 DYIDIATKRIASV 268
           +Y++I+ +R+  V
Sbjct: 251 EYLEISKRRLEKV 263


>gi|291523889|emb|CBK89476.1| DNA modification methylase [Eubacterium rectale DSM 17629]
          Length = 270

 Score =  209 bits (532), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 102/252 (40%), Positives = 155/252 (61%), Gaps = 10/252 (3%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFS----S 77
           +++ G+S  +L K+  +SVD+IFADPPY L  +G +      +V     SWDK S    S
Sbjct: 19  QLVLGDSFKILTKMKPESVDMIFADPPYFLSNDG-ITCQGGKMVSVNKGSWDKLSESGTS 77

Query: 78  FEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPM 137
            E    F R W+  C++VLKPNGT+W+ G+ HNI+ IG  L+   F I+N+I W+K+NP 
Sbjct: 78  VEEKHKFNRKWIRLCKKVLKPNGTIWISGTLHNIYSIGMALEQEGFKIINNITWQKTNPP 137

Query: 138 PNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRN 197
           PN   R F ++ ET++WA  + K   + F+Y  +K  N   QM+  W   +   SE+   
Sbjct: 138 PNLACRCFTHSTETILWAKKNDKKSRHFFDYQKMKKMNGGKQMKDVWTGALTKPSEKTEG 197

Query: 198 KDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDY 257
           K     HPTQKPE LL +I+++ST+ G +ILDPF GSGT+G  A +  R F+GI++ ++Y
Sbjct: 198 K-----HPTQKPEYLLEKIVLASTEKGQVILDPFCGSGTTGVEAVRFGRKFVGIDVSEEY 252

Query: 258 IDIATKRIASVQ 269
           ++I+ +R+  V+
Sbjct: 253 LEISKRRLEKVK 264


>gi|166032271|ref|ZP_02235100.1| hypothetical protein DORFOR_01974 [Dorea formicigenerans ATCC
           27755]
 gi|166027994|gb|EDR46751.1| hypothetical protein DORFOR_01974 [Dorea formicigenerans ATCC
           27755]
          Length = 270

 Score =  209 bits (531), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 103/251 (41%), Positives = 154/251 (61%), Gaps = 10/251 (3%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFS----S 77
           ++I G+S  +L K+  +SVD+IFADPPY L  +G +      +V     SWDK S    S
Sbjct: 19  QLIVGDSFKILTKMEPESVDMIFADPPYFLSNDG-ITCQGGKMVSVNKGSWDKLSESGTS 77

Query: 78  FEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPM 137
            E    F R W+  C++VLKPNGT+W+ G+ HNI+ IG  L+   F I+N+I W+K+NP 
Sbjct: 78  VEEKHKFNRKWIKLCKKVLKPNGTIWISGTLHNIYSIGMALEQEGFKIINNITWQKTNPP 137

Query: 138 PNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRN 197
           PN   R F ++ ET++WA  + K   + F+Y  +K  N   QM+  W   +   SE+   
Sbjct: 138 PNLACRCFTHSTETILWAKKNDKKSRHFFDYQKMKEMNGGKQMKDVWTGALTKPSEKTEG 197

Query: 198 KDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDY 257
           K     HPTQKP+ LL +I+++ST+ G +ILDPF GSGT+G  A +  R FIGI++ ++Y
Sbjct: 198 K-----HPTQKPKYLLEKIVLASTEEGQVILDPFCGSGTTGVEAVRFGRKFIGIDVSEEY 252

Query: 258 IDIATKRIASV 268
           ++I+ +R+  V
Sbjct: 253 LEISKRRLEKV 263


>gi|19347659|gb|AAL86021.1| BsmIMA [Geobacillus stearothermophilus]
          Length = 275

 Score =  208 bits (529), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 116/272 (42%), Positives = 163/272 (59%), Gaps = 30/272 (11%)

Query: 18  EWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHS--LV------DAVT 69
           EW + I     I  ++KLP  S+DL+ ADPPYNL   G+ ++ D+S  LV      + V 
Sbjct: 4   EWINTIQNTECIQSMKKLPDNSIDLVIADPPYNLSKGGK-WKWDNSKKLVGMGGNWNKVM 62

Query: 70  DSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDI 129
           ++WD  + FE Y  FT +WLL  +R+LKP G+LW+ G+YHN+  I  + Q L   I+N+I
Sbjct: 63  ENWDDMT-FEEYWEFTESWLLEVKRILKPTGSLWIFGTYHNMGIINVVCQKLGIEIINEI 121

Query: 130 VWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAAN--EDV------QMR 181
           +W K N  PN  GRRF  +HET++W     K + Y FNY+ +K A+  ED+      QMR
Sbjct: 122 IWYKRNAFPNLSGRRFTASHETILWCHVGQKKREYYFNYEYVKNASFPEDMLKSPGKQMR 181

Query: 182 SDWLIPICSGSERLRNKDGEKL----HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTS 237
           + W IP         NK  ++L    HPTQKP  LL RI+++++K GDI L PF G G+ 
Sbjct: 182 TVWDIP--------NNKQKDELKFGKHPTQKPLRLLHRIILATSKEGDICLAPFSGVGSE 233

Query: 238 GAVAKKLRRSFIGIEMKQDYIDIATKRIASVQ 269
              AK+L R+FIG E+ ++Y DI+ KRI S Q
Sbjct: 234 CVAAKELGRNFIGFEINKEYYDISLKRIESTQ 265


>gi|187251096|ref|YP_001875578.1| DNA methylase N-4/N-6 domain-containing protein [Elusimicrobium
           minutum Pei191]
 gi|186971256|gb|ACC98241.1| DNA methylase N-4/N-6 domain protein [Elusimicrobium minutum
           Pei191]
          Length = 266

 Score =  207 bits (528), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 113/258 (43%), Positives = 156/258 (60%), Gaps = 15/258 (5%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           K+I GNSI V++  P +S D+IFADPPY L  NG               SWDK + F++ 
Sbjct: 14  KLILGNSIDVIKSFPDESCDMIFADPPYMLS-NGGFTVQSGKRASVNKGSWDKSNGFDSD 72

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFR 141
             F   W+  C+R+LK NGT+W+ G+YH+I++ G  LQ  N+ ILNDI W K N  PN  
Sbjct: 73  FEFHNNWIKECKRILKKNGTIWISGTYHSIYQCGFALQKNNYHILNDIAWFKPNAAPNLS 132

Query: 142 GRRFQNAHETLIWASPSPKAKGYTFNYDALKAA--NED------VQMRSDWLIPICSGSE 193
            R F  +HETLIWA  +   K +TFNYD +K    +ED      +QMRS W I     SE
Sbjct: 133 CRFFTASHETLIWARKNKIGK-HTFNYDKVKNGIWSEDFLKKPNLQMRSVWAINTPKKSE 191

Query: 194 RLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEM 253
           ++  K     HPTQKP  L+ RI++SSTK  D+ILDPF GS T+G  A   +R+FIGI++
Sbjct: 192 KVFGK-----HPTQKPFDLMRRIILSSTKENDLILDPFTGSSTTGLAATYYKRNFIGIDI 246

Query: 254 KQDYIDIATKRIASVQPL 271
           +Q Y++++ KR   ++ +
Sbjct: 247 EQKYLELSKKRYEQLRSM 264


>gi|212639032|ref|YP_002315552.1| DNA modification methylase [Anoxybacillus flavithermus WK1]
 gi|212560512|gb|ACJ33567.1| DNA modification methylase [Anoxybacillus flavithermus WK1]
          Length = 263

 Score =  207 bits (528), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 107/246 (43%), Positives = 146/246 (59%), Gaps = 7/246 (2%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           +I+ + +  L+ +   S+ +IFADPPY L  NG +      +V      WDK    E  D
Sbjct: 21  LIQDDCLRALQYIQPSSIHMIFADPPYFLS-NGGISCKSGKIVRVDKGEWDKERDREKID 79

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            F   W+ AC+RVLK +GT+W+ G++HNI  +G  L  L F ILN IVW+K++P PN   
Sbjct: 80  EFNYRWIQACKRVLKEDGTIWITGTFHNIHSVGQALHQLGFKILNSIVWQKTDPPPNMSK 139

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           R F ++HE +IWA  SPK++ Y FNY+A+   N   QM   W IP     E+        
Sbjct: 140 RMFTHSHEYIIWAKKSPKSRHY-FNYEAMVKENNGKQMTDVWTIPHVPPHEKTFGN---- 194

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKP  LL+RI+++STK  DIILDPF GSGT+G  A  L R FIG+E +  +I +  
Sbjct: 195 -HPTQKPLQLLNRIIIASTKQNDIILDPFCGSGTTGVSALCLNRKFIGMERELSFIQLTK 253

Query: 263 KRIASV 268
           +RI SV
Sbjct: 254 RRIQSV 259


>gi|325294305|ref|YP_004280819.1| DNA methylase N-4/N-6 domain protein [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325064753|gb|ADY72760.1| DNA methylase N-4/N-6 domain protein [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 291

 Score =  206 bits (523), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 111/248 (44%), Positives = 152/248 (61%), Gaps = 16/248 (6%)

Query: 27  NSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTR 86
           ++++VL+K+P +SVD++FADPPYNL  +G         V      WD+   FE    F  
Sbjct: 17  DALNVLDKIPDESVDMVFADPPYNLSNDGFTCHAGKR-VSVNKGEWDRSQGFEKDFNFHY 75

Query: 87  AWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQ 146
            W+  C+R+LKPNGT+W+ G+YH+I+  G  LQ   + I+N+I W K N  PN   R F 
Sbjct: 76  QWIEKCKRILKPNGTIWISGTYHSIYLCGFSLQKQGWHIINEICWYKPNASPNLSCRMFT 135

Query: 147 NAHETLIWASPSPKAKGYTFNYDALKAAN--EDV------QMRSDWLIPICSGSERLRNK 198
            +HETL+WA    +AK +TFNYD  K  +  ED+      QMRS W IP     E+   K
Sbjct: 136 ASHETLLWAKKKKEAK-HTFNYDLAKNGSWEEDLLKKPNKQMRSVWAIPTPKKWEKRYGK 194

Query: 199 DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYI 258
                HPTQKPE LL RI++ +TKPGDI+LDPF GSGT+G VA +  R F+GI+  ++Y+
Sbjct: 195 -----HPTQKPELLLKRIILLTTKPGDIVLDPFCGSGTTGVVAIRYGRRFVGIDFNEEYL 249

Query: 259 -DIATKRI 265
            D+A  RI
Sbjct: 250 KDLAIPRI 257


>gi|257456835|ref|ZP_05622019.1| DNA methylase [Treponema vincentii ATCC 35580]
 gi|257445841|gb|EEV20900.1| DNA methylase [Treponema vincentii ATCC 35580]
          Length = 304

 Score =  204 bits (520), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 112/255 (43%), Positives = 153/255 (60%), Gaps = 16/255 (6%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           I   + + VLE+LP +S+D+IFADPPY L  +G   + +  +V      WDK    E   
Sbjct: 45  IFNIDCLEVLERLPDESIDMIFADPPYMLSNDGFTCQ-NGRMVSVNKGKWDKSCGLETDM 103

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            F  AW+ ACRRVLKP GT+W+ G+YH+I++ G +LQ  NF ILNDI W K N  PN   
Sbjct: 104 QFHNAWIAACRRVLKPEGTIWISGTYHSIYQCGYLLQKNNFHILNDIAWFKPNAAPNLSC 163

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAA--NED------VQMRSDWLIPICSGSER 194
           R F  +HETLIWA    K+K +TFNYDA+K     ED       QMRS W IP     E+
Sbjct: 164 RFFTASHETLIWARKDKKSK-HTFNYDAMKNGFFPEDKLKKAHSQMRSVWSIPTPPAGEK 222

Query: 195 LRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKL-RRSFIGIEM 253
              K     HPTQKP +LL RI+++ST    IILDPF G GT+G  +  + +R +IGIE+
Sbjct: 223 ELGK-----HPTQKPLSLLKRIILASTNDNAIILDPFNGGGTTGIASTIIGKRYYIGIEI 277

Query: 254 KQDYIDIATKRIASV 268
            ++Y ++  +++  +
Sbjct: 278 DKEYCELTKRKLMQI 292


>gi|269976527|ref|ZP_06183512.1| DNA methylase [Mobiluncus mulieris 28-1]
 gi|269935328|gb|EEZ91877.1| DNA methylase [Mobiluncus mulieris 28-1]
          Length = 277

 Score =  202 bits (514), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 102/247 (41%), Positives = 150/247 (60%), Gaps = 6/247 (2%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           +I  G++  +L ++   SVD+IFADPPY L  NG +       V     +WD+    E  
Sbjct: 23  RIFLGDAFEILARIAQSSVDMIFADPPYFLS-NGGISCSGGRQVSVNKGAWDRGMGTEEK 81

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFR 141
             F R W+  C+RVLK +G++WV G++HNI+ +G  L+   F ILN+I W+K NP PN  
Sbjct: 82  HGFNRRWVRQCKRVLKRDGSIWVSGTFHNIYSLGFALEQEGFKILNNITWQKLNPPPNLA 141

Query: 142 GRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGE 201
            R F ++ ET+IWA  + +   + F+Y  +K  N   QM+  W   +   SE++  K   
Sbjct: 142 CRCFTHSTETVIWARKNERKARHFFDYPLMKTLNGGKQMKDVWAGTLTPKSEKICGK--- 198

Query: 202 KLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIA 261
             HPTQKPE LL RI+++ST+ GD++LDPF GSGT+  VAK+L R  IGI+  ++Y++IA
Sbjct: 199 --HPTQKPEYLLERIILASTREGDLVLDPFVGSGTTAVVAKRLGRYSIGIDSVEEYLEIA 256

Query: 262 TKRIASV 268
            KR+A  
Sbjct: 257 GKRLAQT 263


>gi|307701788|ref|ZP_07638802.1| DNA (cytosine-5-)-methyltransferase [Mobiluncus mulieris FB024-16]
 gi|307613046|gb|EFN92301.1| DNA (cytosine-5-)-methyltransferase [Mobiluncus mulieris FB024-16]
          Length = 252

 Score =  202 bits (514), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 102/241 (42%), Positives = 148/241 (61%), Gaps = 6/241 (2%)

Query: 26  GNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFT 85
           G++  +L ++   SVD+IFADPPY L  NG +       V     +WDK    E    F 
Sbjct: 2   GDAFEILARIAQSSVDMIFADPPYFLS-NGGISCSGGRQVSVNKGAWDKGMGTEEKHGFN 60

Query: 86  RAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRF 145
           R W+  C+RVLK +G++WV G++HNI+ +G  L+   F ILN+I W+K NP PN   R F
Sbjct: 61  RRWVRQCKRVLKRDGSIWVSGTFHNIYSLGFALEQEGFKILNNITWQKLNPPPNLACRCF 120

Query: 146 QNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHP 205
            ++ ET+IWA  + +   + F+Y  +K  N   QM+  W   +   SE++  K     HP
Sbjct: 121 THSTETVIWARKNERKARHFFDYPLMKTLNGGKQMKDVWAGTLTPKSEKICGK-----HP 175

Query: 206 TQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRI 265
           TQKPE LL RI+++ST+ GD++LDPF GSGT+  VAK+L R  IGI+  ++Y++IA KR+
Sbjct: 176 TQKPEYLLERIILASTREGDLVLDPFVGSGTTAVVAKRLGRYSIGIDSVEEYLEIAGKRL 235

Query: 266 A 266
           A
Sbjct: 236 A 236


>gi|300870838|ref|YP_003785709.1| DNA methylase N-4/N-6 domain-containing protein [Brachyspira
           pilosicoli 95/1000]
 gi|300688537|gb|ADK31208.1| DNA methylase N-4/N-6 domain protein [Brachyspira pilosicoli
           95/1000]
          Length = 260

 Score =  202 bits (514), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 110/258 (42%), Positives = 152/258 (58%), Gaps = 16/258 (6%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           D +I GN + +L+ L   S+D+IFADPPYNL  NG         V      WD    F+ 
Sbjct: 2   DTLINGNCLEILDTLEENSIDMIFADPPYNLSNNGTTCHSGKR-VSVNKGEWDISLGFDQ 60

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
             AF   W+  CRRVLK NGT+W+ G+ H+I++ G +L+ L F+ILNDI W K N  PN 
Sbjct: 61  DVAFHETWISKCRRVLKDNGTIWISGTNHSIYKCGFILEKLGFYILNDIAWYKPNAAPNL 120

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAAN--------EDVQMRSDWLIPICSGS 192
               F ++HETLIWA  + KAK + +NYD +K  +        +  QMRS W I   + +
Sbjct: 121 SCNVFAHSHETLIWAKKNKKAKHF-YNYDLMKNLDFEKDKLKSKGKQMRSVWSISTPAKN 179

Query: 193 ERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSG-AVAKKLRRSFIGI 251
           E++  K     HPTQKP  LL RI+++STK  D ILDPF GSGT+  A A    R++IGI
Sbjct: 180 EKIYGK-----HPTQKPIDLLIRIILASTKDNDTILDPFNGSGTTAVACAMIGNRNYIGI 234

Query: 252 EMKQDYIDIATKRIASVQ 269
           ++  +YI++  KRI  ++
Sbjct: 235 DIDNNYIELTKKRIKDIE 252


>gi|238022785|ref|ZP_04603211.1| hypothetical protein GCWU000324_02696 [Kingella oralis ATCC 51147]
 gi|237865988|gb|EEP67124.1| hypothetical protein GCWU000324_02696 [Kingella oralis ATCC 51147]
          Length = 262

 Score =  202 bits (513), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 103/237 (43%), Positives = 140/237 (59%), Gaps = 7/237 (2%)

Query: 31  VLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLL 90
           +L+K P    D+IFADPPY L  NG     +  +V      WDK     A  AF   WL 
Sbjct: 33  ILDKYPNGCFDMIFADPPYFLS-NGGFTCQNGQMVSVNKGDWDKSQGMAADMAFYEEWLG 91

Query: 91  ACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHE 150
            C  +LKPNG++WV G++HNI+ IG ++Q L + ILN+I W K NP PN   R F ++ E
Sbjct: 92  LCYALLKPNGSIWVCGTHHNIYLIGYLMQTLGYHILNNITWEKPNPPPNLSCRFFTHSTE 151

Query: 151 TLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPE 210
           TL+WA    +AK +TF YD +KA N   QM+S W I   + SE+   K     HPTQKP 
Sbjct: 152 TLLWAKKGKRAK-HTFQYDVMKAQNGGKQMKSVWQIAPPAASEKTLGK-----HPTQKPL 205

Query: 211 ALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIAS 267
           ALL R + +++ P D I DPF GSGT+G  A K  R+F G E+  ++ ++A KR+ +
Sbjct: 206 ALLERCIQAASNPNDWIFDPFMGSGTTGVAALKHGRNFCGCEINDEFFELAKKRLQT 262


>gi|218961616|ref|YP_001741391.1| Modification methylase DpnIIB (Adenine-specific methyltransferase
           DpnIIB) (M.DpnIIB) (M.DpnII 2) [Candidatus Cloacamonas
           acidaminovorans]
 gi|167730273|emb|CAO81185.1| Modification methylase DpnIIB (Adenine-specific methyltransferase
           DpnIIB) (M.DpnIIB) (M.DpnII 2) [Candidatus Cloacamonas
           acidaminovorans]
          Length = 263

 Score =  202 bits (513), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 102/248 (41%), Positives = 146/248 (58%), Gaps = 15/248 (6%)

Query: 26  GNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFT 85
           GN + +L++L   S+D+IFADPPY L  +G +      +V      WD    F     F 
Sbjct: 19  GNCMEILKELEPNSIDMIFADPPYFLS-DGTITCKSGKMVSVKKGDWDLLDEFNNKSEFH 77

Query: 86  RAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRF 145
             W+  CR++LKP+GT+W+ G+YH+I++ G  LQ   F I+NDI W K N  PN   + F
Sbjct: 78  HKWISVCRQILKPSGTIWISGTYHSIYQCGYELQKQGFRIINDICWFKPNAAPNLTRKCF 137

Query: 146 QNAHETLIWASPSPKAKGYTFNYDALKAAN--------EDVQMRSDWLIPICSGSERLRN 197
             +HET++WA   P  K   ++Y+ +K  +        +  QMRS W IP     E++  
Sbjct: 138 TASHETILWAIKDPLQKQ-KYHYELMKNTDWMGDIINKKGKQMRSVWCIPTTPAREKIHG 196

Query: 198 KDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDY 257
           K     HPTQKP ALL RI++SST  GD++LDPF GSGT+G VAKK  R++IGI++  DY
Sbjct: 197 K-----HPTQKPIALLERIILSSTDEGDLVLDPFNGSGTTGVVAKKYHRNYIGIDINIDY 251

Query: 258 IDIATKRI 265
           + +  +RI
Sbjct: 252 LKLTIERI 259


>gi|225076901|ref|ZP_03720100.1| hypothetical protein NEIFLAOT_01952 [Neisseria flavescens
           NRL30031/H210]
 gi|224951787|gb|EEG32996.1| hypothetical protein NEIFLAOT_01952 [Neisseria flavescens
           NRL30031/H210]
          Length = 271

 Score =  201 bits (511), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 100/235 (42%), Positives = 143/235 (60%), Gaps = 7/235 (2%)

Query: 31  VLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLL 90
           +LEK P    D+IFADPPY L  +G     +  +V     +WDK     A   F   WL 
Sbjct: 40  ILEKHPNGCFDMIFADPPYFLSNDG-FSCQNGQMVSVNKGNWDKSKGMAADLEFYEEWLR 98

Query: 91  ACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHE 150
            C  +LKPNGT+WV G++HNI+ IG ++Q + + ILN+I W K NP PN   R F ++ E
Sbjct: 99  LCYALLKPNGTIWVCGTFHNIYLIGYLMQTIGYHILNNITWEKPNPPPNLSCRFFTHSTE 158

Query: 151 TLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPE 210
           T++WA  + KAK +TF+Y+ +KA N+  QM+  W  P  + +E+   K     HPTQKP 
Sbjct: 159 TILWAKKNKKAK-HTFHYEMMKAQNDGKQMKCVWTFPPPNKTEKTFGK-----HPTQKPL 212

Query: 211 ALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRI 265
            LL R ++S++  GD+I DPF GSGT+G  A K  R F G E+++D+ ++A KR+
Sbjct: 213 PLLERCILSASNIGDLIFDPFMGSGTTGVAALKHDRKFCGCELEEDFFELAKKRL 267


>gi|218960496|ref|YP_001740271.1| Modification methylase DpnIIB (Adenine-specific methyltransferase
           DpnIIB) (M.DpnIIB) (M.DpnII 2) [Candidatus Cloacamonas
           acidaminovorans]
 gi|167729153|emb|CAO80064.1| Modification methylase DpnIIB (Adenine-specific methyltransferase
           DpnIIB) (M.DpnIIB) (M.DpnII 2) [Candidatus Cloacamonas
           acidaminovorans]
          Length = 269

 Score =  201 bits (511), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 117/279 (41%), Positives = 164/279 (58%), Gaps = 20/279 (7%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           K+  G+++ ++++L +KS+DLIFADPPYNL     L      +      SWD        
Sbjct: 5   KLFNGDALEIIKQLQSKSIDLIFADPPYNLSGENHLTCKSGKIAKCDKGSWDHIDDI--- 61

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFR 141
           D F + W+  C RVLK NGT+W+ G+ HN   IG +L+ LN WI+NDI+W K N  P  +
Sbjct: 62  DEFNKKWIEECIRVLKDNGTIWISGTLHNHPSIGVILKQLNLWIINDIIWFKPNAAPLIQ 121

Query: 142 GRRFQNAHETLIWASPSPKAKGYTFNYD-ALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
             RF  + E LIW +   K+K Y FNY+ A++ AN   QMR+ W          L  +  
Sbjct: 122 KNRFVPSTE-LIWLAA--KSKQYYFNYEMAVRLANGK-QMRNLW---------ELSAEKH 168

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
           + +HPT+KPE LL RI++  +K  DIILDPF GSGT+GAVAK+L R+F+GIE+ Q Y +I
Sbjct: 169 KTMHPTEKPEKLLERIVLIGSKQEDIILDPFMGSGTTGAVAKRLNRNFVGIEIDQTYYNI 228

Query: 261 ATKRIASVQPLGNIE--LTVLTGKRTEPRVAFNLLVERG 297
           A KRI +     N+   L  LT K T  ++ F   +E+ 
Sbjct: 229 AQKRIENTNVETNLVQFLEKLTHK-TSSQLDFYSTIEKS 266


>gi|325204847|gb|ADZ00301.1| Modification methylase LlaDCHIB [Neisseria meningitidis M01-240355]
          Length = 269

 Score =  201 bits (511), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 100/235 (42%), Positives = 143/235 (60%), Gaps = 7/235 (2%)

Query: 31  VLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLL 90
           +LEK P    D+IFADPPY L  +G     +  +V     +WDK     A   F   WL 
Sbjct: 40  ILEKYPNGCFDMIFADPPYFLSNDG-FSCQNGQMVSVNKGNWDKSKGMAADLEFYEEWLR 98

Query: 91  ACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHE 150
            C  +LKPNGT+WV G++HNI+ IG ++Q + + ILN+I W K NP PN   R F ++ E
Sbjct: 99  LCYALLKPNGTIWVCGTFHNIYLIGYLMQTIGYHILNNITWEKPNPPPNLSCRFFTHSTE 158

Query: 151 TLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPE 210
           T++WA  + KAK +TF+Y+ +KA N+  QM+  W  P  + +E+   K     HPTQKP 
Sbjct: 159 TILWAKKNKKAK-HTFHYEMMKAQNDGKQMKCVWTFPPPNKAEKTFGK-----HPTQKPL 212

Query: 211 ALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRI 265
            LL R ++S++  GD+I DPF GSGT+G  A K  R F G E+++D+ ++A KR+
Sbjct: 213 PLLERCILSASNIGDLIFDPFMGSGTTGVAALKHGRKFCGCELEEDFFELAKKRL 267


>gi|325131534|gb|EGC54241.1| DNA methylase [Neisseria meningitidis M6190]
          Length = 269

 Score =  201 bits (510), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 99/235 (42%), Positives = 144/235 (61%), Gaps = 7/235 (2%)

Query: 31  VLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLL 90
           +LEK P    D+IF+DPPY L  +G     +  +V     +WDK     A   F   WL 
Sbjct: 40  ILEKYPNGCFDMIFSDPPYFLSNDG-FSCQNGQMVSVNKGNWDKSKGMAADLEFYEEWLR 98

Query: 91  ACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHE 150
            C  +LKPNGT+WV G++HNI+ IG ++Q + + ILN+I W K NP PN   R F ++ E
Sbjct: 99  LCYALLKPNGTIWVCGTFHNIYLIGYLMQTIGYHILNNITWEKPNPPPNLSCRFFTHSTE 158

Query: 151 TLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPE 210
           T++WA  + KAK +TF+Y+ +KA N+  QM+  W  P  + +E+   K     HPTQKP 
Sbjct: 159 TILWAKKNKKAK-HTFHYEMMKAQNDGKQMKCVWTFPPPNKAEKTFGK-----HPTQKPL 212

Query: 211 ALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRI 265
           +LL R ++S++  GD+I DPF GSGT+G  A K  R F G E+++D+ ++A KR+
Sbjct: 213 SLLERCILSASNIGDLIFDPFMGSGTTGVAALKHGRKFCGCELEEDFFELAKKRL 267


>gi|326560996|gb|EGE11361.1| DNA methylase N-4/N-6 domain protein [Moraxella catarrhalis 7169]
          Length = 273

 Score =  200 bits (509), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 106/267 (39%), Positives = 157/267 (58%), Gaps = 12/267 (4%)

Query: 14  NSIFEWKDK---IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTD 70
           N  FE  D+   I +GN I ++    + S+D+IFADPPY L  +G  ++  + ++ +V  
Sbjct: 4   NPYFEASDQTFNIYQGNCIDIMSHFQSNSIDMIFADPPYFLSNDGLTFK--NGIIQSVNK 61

Query: 71  -SWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDI 129
             WD   +  +   F+  W+   +R+LK NGT+W+ G++HNIF +G +L+  NF ILN I
Sbjct: 62  GEWDTNDNENSIYNFSHEWIAQSKRLLKDNGTIWISGTHHNIFTVGQLLKENNFKILNII 121

Query: 130 VWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPIC 189
            W K NP PNF  R F  + E +IWA    K   Y F+YD +K  N D Q +  W +P  
Sbjct: 122 TWEKPNPPPNFSCRYFTYSSEWIIWARKHSKIPHY-FDYDLMKKLNGDKQAKDVWRLPAV 180

Query: 190 SGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFI 249
              E+ + K     HPTQKP  LLSRI++SST+ GD+ILDPF GSGT+G  A  L R FI
Sbjct: 181 GSWEKTQGK-----HPTQKPLGLLSRIILSSTQKGDLILDPFSGSGTTGIAATILGRQFI 235

Query: 250 GIEMKQDYIDIATKRIASVQPLGNIEL 276
           GI+ + ++++++ +R  ++ P    E 
Sbjct: 236 GIDKELEFLELSKRRYQAITPKSKYEF 262


>gi|121634196|ref|YP_974441.1| putative modification methylase DpnIIB [Neisseria meningitidis
           FAM18]
 gi|120865902|emb|CAM09638.1| putative Modification methylase DpnIIB [Neisseria meningitidis
           FAM18]
 gi|325139212|gb|EGC61758.1| Modification methylase LlaDCHIB [Neisseria meningitidis ES14902]
 gi|325141587|gb|EGC64053.1| Modification methylase LlaDCHIB [Neisseria meningitidis 961-5945]
 gi|325197609|gb|ADY93065.1| Modification methylase LlaDCHIB [Neisseria meningitidis G2136]
          Length = 269

 Score =  199 bits (507), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 99/235 (42%), Positives = 143/235 (60%), Gaps = 7/235 (2%)

Query: 31  VLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLL 90
           +LEK P    D+IF+DPPY L  +G     +  +V     +WDK     A   F   WL 
Sbjct: 40  ILEKYPNGCFDMIFSDPPYFLSNDG-FSCQNGQMVSVNKGNWDKSKGMAADLEFYEEWLR 98

Query: 91  ACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHE 150
            C  +LKPNGT+WV G++HNI+ IG ++Q + + ILN+I W K NP PN   R F ++ E
Sbjct: 99  LCYALLKPNGTIWVCGTFHNIYLIGYLMQTIGYHILNNITWEKPNPPPNLSCRFFTHSTE 158

Query: 151 TLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPE 210
           T++WA  + KAK +TF+Y+ +KA N+  QM+  W  P  + +E+   K     HPTQKP 
Sbjct: 159 TILWAKKNKKAK-HTFHYEMMKAQNDGKQMKCVWTFPPPNKAEKTFGK-----HPTQKPL 212

Query: 211 ALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRI 265
            LL R ++S++  GD+I DPF GSGT+G  A K  R F G E+++D+ ++A KR+
Sbjct: 213 PLLERCILSASNIGDLIFDPFMGSGTTGVAALKHGRKFCGCELEEDFFELAKKRL 267


>gi|323140475|ref|ZP_08075403.1| DNA (cytosine-5-)-methyltransferase [Phascolarctobacterium sp. YIT
           12067]
 gi|322415043|gb|EFY05834.1| DNA (cytosine-5-)-methyltransferase [Phascolarctobacterium sp. YIT
           12067]
          Length = 269

 Score =  198 bits (504), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 107/252 (42%), Positives = 149/252 (59%), Gaps = 10/252 (3%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           +++ G++  +L+KL  +SVD+IFADPPY L  NG   R    +V     +WD     E  
Sbjct: 19  QLLLGDTFELLQKLRPESVDVIFADPPYFLSNNGITCRSG-KMVSVNKAAWDMVDDKEHM 77

Query: 82  DA----FTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPM 137
            A    F R W+  C++VLKPNGT+W+ G++HNIF IG  L+   F I+N+I W+K+NP 
Sbjct: 78  LANKHQFNRRWINLCKKVLKPNGTIWISGTFHNIFSIGMALEEEGFRIINNITWQKTNPP 137

Query: 138 PNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRN 197
           PN   R F ++ ET+IWA    K   Y FNY  +K  N   QM+  W   +   SE+   
Sbjct: 138 PNLACRCFTHSTETIIWACKDDKKAKYFFNYALMKEINGGKQMKDVWTGSLTKPSEKKFG 197

Query: 198 KDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDY 257
           K     HPTQKPE LL RIL +ST+ G I+LDPF GSGT+G  A +   +FIGI+  ++Y
Sbjct: 198 K-----HPTQKPEYLLERILRASTQAGYIVLDPFCGSGTTGVEALRNGCNFIGIDNVEEY 252

Query: 258 IDIATKRIASVQ 269
           + +  KR+   Q
Sbjct: 253 LKLTQKRLDKEQ 264


>gi|296314163|ref|ZP_06864104.1| DNA (cytosine-5-)-methyltransferase [Neisseria polysaccharea ATCC
           43768]
 gi|296839202|gb|EFH23140.1| DNA (cytosine-5-)-methyltransferase [Neisseria polysaccharea ATCC
           43768]
          Length = 269

 Score =  198 bits (503), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 99/235 (42%), Positives = 141/235 (60%), Gaps = 7/235 (2%)

Query: 31  VLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLL 90
           +LEK P    D+IFADPPY L  +G     +  +V     +WDK     A   F   WL 
Sbjct: 40  ILEKHPNGCFDMIFADPPYFLSNDG-FSCQNGQMVSVNKGNWDKSKGMAADLEFYEEWLR 98

Query: 91  ACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHE 150
            C  +LKPNGT+WV G++HNI+ IG ++Q + + ILN+I W K NP PN   R F ++ E
Sbjct: 99  LCYALLKPNGTIWVCGTFHNIYLIGYLMQTVGYHILNNITWEKPNPPPNLSCRFFTHSTE 158

Query: 151 TLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPE 210
           T++WA  + KAK +TF+Y+ +KA N   QM+  W  P  + +E+   K     HPTQKP 
Sbjct: 159 TILWAKKNKKAK-HTFHYEMMKAQNNGKQMKCVWTFPPPNKTEKTFGK-----HPTQKPL 212

Query: 211 ALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRI 265
            LL R ++S++  G +I DPF GSGT+G  A K  R F G E+++D+ ++A KR+
Sbjct: 213 PLLERCILSASNIGHLIFDPFMGSGTTGVAALKHGRKFCGCELEEDFFELAKKRL 267


>gi|153005643|ref|YP_001379968.1| DNA methylase N-4/N-6 domain-containing protein [Anaeromyxobacter
           sp. Fw109-5]
 gi|152029216|gb|ABS26984.1| DNA methylase N-4/N-6 domain protein [Anaeromyxobacter sp. Fw109-5]
          Length = 282

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 111/256 (43%), Positives = 141/256 (55%), Gaps = 11/256 (4%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           +++G+ I  LE LP  SVD+ FADPPY L  NG                WD         
Sbjct: 25  LVQGDCIEALEALPPHSVDVAFADPPYMLS-NGGTTCQSGRRTSVNKGQWDASRGVVEDH 83

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
           AF   WL A RRVLKP+GTLWV G+ H IF IG  +Q L + +LN I W K N  PN   
Sbjct: 84  AFQTRWLTAVRRVLKPSGTLWVSGTQHVIFSIGFAMQELGYHLLNTITWYKPNASPNLAC 143

Query: 143 RRFQNAHETLIWASP-SPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERL------ 195
           R F ++ E L+WASP   +  G+ FNY A+KA N   QMR  W IP   G + +      
Sbjct: 144 RFFTHSTEILLWASPMRTRPLGHRFNYKAMKAENGGKQMRDLWQIPAPEGDQVVWSVPTP 203

Query: 196 --RNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEM 253
             R K   + HPTQKP ALL R+L SS   GD++LDPF GSGT+G  A K    F+G+E 
Sbjct: 204 GPREKVHGR-HPTQKPLALLERVLASSAAAGDLVLDPFSGSGTTGVAAVKAGCRFLGLER 262

Query: 254 KQDYIDIATKRIASVQ 269
              Y+D+A +R+ + Q
Sbjct: 263 DPAYVDLAARRMRAAQ 278


>gi|315453579|ref|YP_004073849.1| DNA methylase N-4/N-6 domain-containing protein [Helicobacter felis
           ATCC 49179]
 gi|315132631|emb|CBY83259.1| DNA methylase N-4/N-6 domain [Helicobacter felis ATCC 49179]
          Length = 266

 Score =  197 bits (501), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 106/245 (43%), Positives = 147/245 (60%), Gaps = 8/245 (3%)

Query: 20  KDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFE 79
           K K+   +   VL  L  + VDLIFADPPY L  NG L      +V     +WDK    E
Sbjct: 12  KFKLYHADCKEVLPHLQGQ-VDLIFADPPYFLS-NGGLSIQSGQIVSVDKGAWDKSQGLE 69

Query: 80  AYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPN 139
              AF   WL   +  LKP G+L++  +YHN+F +G  LQ+L F ++N I W KSNP PN
Sbjct: 70  HMHAFNMEWLGLAKDALKPTGSLFISATYHNLFSLGLALQSLGFKLINLITWHKSNPPPN 129

Query: 140 FRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKD 199
           F  R   +A E ++WA  SPK   + FNY+ +KA NE+ QMR  W +P  +  E+   K 
Sbjct: 130 FSCRTLVHASEQILWARKSPK-HAHIFNYEHMKALNENKQMRDVWTLPAIAPWEKKLGK- 187

Query: 200 GEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYID 259
               HPTQKP +LL+R++V +++   +I DPF GSG++G  A  L RSF+GIE +Q++I+
Sbjct: 188 ----HPTQKPLSLLTRLIVMASQQESLICDPFSGSGSTGIAANLLGRSFVGIEREQEFIE 243

Query: 260 IATKR 264
           +ATKR
Sbjct: 244 LATKR 248


>gi|315655312|ref|ZP_07908212.1| modification methylase BabI [Mobiluncus curtisii ATCC 51333]
 gi|315490252|gb|EFU79877.1| modification methylase BabI [Mobiluncus curtisii ATCC 51333]
          Length = 266

 Score =  197 bits (501), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 103/246 (41%), Positives = 145/246 (58%), Gaps = 6/246 (2%)

Query: 20  KDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFE 79
           K K+I  +    LE L  +S+D+IFADPPY L  +G +       V      WDK     
Sbjct: 15  KAKLILADVFDALENLEEQSIDMIFADPPYFLSNDG-ISCSGGKQVSVNKGDWDKGLPLS 73

Query: 80  AYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPN 139
               F R W+  C+RVLK +G++W+ G++HNI+ IG+ L+   F ILN+I W+K NP PN
Sbjct: 74  EKHEFNRHWIRECKRVLKRDGSIWISGTFHNIYSIGSALEQERFKILNNITWQKLNPPPN 133

Query: 140 FRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKD 199
              R F ++ ET+IWA    K   + FNY  +K  N+  QM+  W      G+   +N+ 
Sbjct: 134 LGCRCFTHSTETVIWARKDEKKAKHKFNYGLMKELNDGKQMKDVW-----QGTLTPKNEK 188

Query: 200 GEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYID 259
               HPTQKPE LL RI+++ST  GD++LDPF GSGT+  VA +L RS IGI+   +Y++
Sbjct: 189 AFGKHPTQKPEYLLERIILASTNEGDLVLDPFVGSGTTVVVANRLGRSGIGIDNNPEYLE 248

Query: 260 IATKRI 265
           IA KR+
Sbjct: 249 IAKKRL 254


>gi|462633|sp|P34721|MT1B_MORBO RecName: Full=Modification methylase MboIB; Short=M.MboIB; AltName:
           Full=Adenine-specific methyltransferase MboIB; AltName:
           Full=M.MboI C
 gi|303630|dbj|BAA03073.1| MboI methyltransferase C [Moraxella bovis]
          Length = 273

 Score =  197 bits (501), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 106/259 (40%), Positives = 153/259 (59%), Gaps = 12/259 (4%)

Query: 17  FEWKDK---IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTD-SW 72
           FE  DK   I +GN I  +      S+D+IFADPPY L  +G  ++  +S++ +V    W
Sbjct: 7   FESDDKNFNIYQGNCIDFMSHFQDNSIDMIFADPPYFLSNDGLTFK--NSIIQSVNKGEW 64

Query: 73  DKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWR 132
           DK  +  +   F   W+   R++LK NGT+W+ G++HNIF +G +L+  NF ILN I W 
Sbjct: 65  DKNDNEASIYNFNHEWIAQARQLLKDNGTIWISGTHHNIFTVGQVLKENNFKILNIITWE 124

Query: 133 KSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGS 192
           K NP PNF  R F  + E +IWA    K   Y FNYD +K  N D Q +  W +P     
Sbjct: 125 KPNPPPNFSCRYFTYSSEWIIWARKHSKIPHY-FNYDLMKKLNGDKQQKDIWRLPAVGSW 183

Query: 193 ERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIE 252
           E+ + K     HPTQKP  LLSRI++SST+  D+ILDPF GSGT+G     L R++IGIE
Sbjct: 184 EKTQGK-----HPTQKPLGLLSRIILSSTQKDDLILDPFSGSGTTGIAGVLLDRNYIGIE 238

Query: 253 MKQDYIDIATKRIASVQPL 271
            + ++++++ +R   + P+
Sbjct: 239 QELEFLELSKRRYHEITPV 257


>gi|254457477|ref|ZP_05070905.1| DNA methylase [Campylobacterales bacterium GD 1]
 gi|207086269|gb|EDZ63553.1| DNA methylase [Campylobacterales bacterium GD 1]
          Length = 258

 Score =  196 bits (498), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 111/262 (42%), Positives = 154/262 (58%), Gaps = 23/262 (8%)

Query: 21  DKIIKGNSISVL---EKLPAKSVDLIFADPPYNLQLN-----GQLYRPDHSLVDAVTDSW 72
           D++   + I  L   +K+  +SV LIFADPPYNL  N     G     D ++V+   + W
Sbjct: 4   DQVYNADCIKTLNDTKKIAKESVQLIFADPPYNLSGNALKSTGSKTGGDFTMVN---EDW 60

Query: 73  DKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWR 132
           DK    E +  FT  W+ +C+ +LKPNG++++  SYHN+      L+   F I N I W 
Sbjct: 61  DKMEEQE-FITFTNEWVKSCKDILKPNGSIFIACSYHNMGESIMSLKLNGFDIKNIITWN 119

Query: 133 KSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAAN-------EDVQMRSDWL 185
           KSN MPN   R   +  E +IWA    K KG+ FNYD LK  N        D QMR  W 
Sbjct: 120 KSNAMPNLTRRVLTHTTEFVIWAV---KGKGWIFNYDILKELNPEKRQDGTDKQMRDIWT 176

Query: 186 IPICSGSERLRNKDGEK-LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKL 244
           +P+C G ERLR+ DG+K LHPTQKPE LL RI++  +  GD++LDPF GSGT+  +AKK 
Sbjct: 177 LPLCQGKERLRDADGKKALHPTQKPEELLKRIILGFSNEGDLVLDPFGGSGTTPFIAKKY 236

Query: 245 RRSFIGIEMKQDYIDIATKRIA 266
           +R++I IE ++ Y D   +R++
Sbjct: 237 KRNYIAIEREKKYADAIRQRVS 258


>gi|325127469|gb|EGC50398.1| adenine-specific methyltransferase LlaDCHIB [Neisseria meningitidis
           N1568]
          Length = 266

 Score =  196 bits (498), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 98/233 (42%), Positives = 140/233 (60%), Gaps = 7/233 (3%)

Query: 31  VLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLL 90
           +LEK P    D+IFADPPY L  +G     +  +V     +WDK     A   F   WL 
Sbjct: 40  ILEKYPNGCFDMIFADPPYFLSNDG-FSCQNGQMVSVNKGNWDKSKGMAADLEFYEEWLR 98

Query: 91  ACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHE 150
            C  +LKPNGT+WV G++HNI+ IG ++Q + + ILN+I W K NP PN   R F ++ E
Sbjct: 99  LCYALLKPNGTIWVCGTFHNIYLIGYLMQTIGYHILNNITWEKPNPPPNLSCRFFTHSTE 158

Query: 151 TLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPE 210
           T++WA  + KAK +TF+Y+ +KA  +  QM+  W  P  + +E+   K     HPTQKP 
Sbjct: 159 TILWAKKNKKAK-HTFHYEMMKAQTDGKQMKCVWTFPPPNKAEKTFGK-----HPTQKPL 212

Query: 211 ALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATK 263
            LL R ++S++  GD+I DPF GSGT+G  A K  R F G E+++D+ ++A K
Sbjct: 213 PLLERCILSASNIGDLIFDPFMGSGTTGVAALKHGRKFCGCELEEDFFELAKK 265


>gi|86159277|ref|YP_466062.1| DNA methylase N-4/N-6 [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85775788|gb|ABC82625.1| DNA methylase N-4/N-6 [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 285

 Score =  196 bits (497), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 110/273 (40%), Positives = 147/273 (53%), Gaps = 25/273 (9%)

Query: 16  IFEWKD-----------KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSL 64
           + EW D            +++G+ +  LE+LP  SVD+ FADPPY L   G   +     
Sbjct: 7   LHEWNDLPGAAERGRGWALVQGDCVEALERLPPHSVDVAFADPPYMLSNGGSTCQGGRR- 65

Query: 65  VDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFW 124
                 SWD    F A  AF   WL A R+VLKP+GTLWV G+ H IF IG  +Q + F 
Sbjct: 66  TSVNKGSWDASGGFAADHAFQARWLQAVRKVLKPSGTLWVSGTQHVIFSIGYAMQEMGFH 125

Query: 125 ILNDIVWRKSNPMPNFRGRRFQNAHETLIWASP-SPKAKGYTFNYDALKAANEDVQMRSD 183
           +LN + W K N  PN   R F ++ E L+WASP   +   + FNY A+K AN   QMR  
Sbjct: 126 LLNTVTWYKPNASPNLACRFFTHSTEILLWASPMKTRPLAHRFNYRAMKTANGGKQMRDL 185

Query: 184 WLI---PICSGSERL--------RNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFF 232
           W I   P   G + +        R K   + HPTQKP ALL R+L +S  PGD++LDPF 
Sbjct: 186 WEIADRPAPGGDQVVWSVPTPGPREKVHGR-HPTQKPLALLERVLAASAAPGDLVLDPFS 244

Query: 233 GSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRI 265
           GSGT+G  A +    F+G+E    Y+D+A +R+
Sbjct: 245 GSGTTGVAALRAGCRFLGLERDPSYVDLAARRL 277


>gi|115375188|ref|ZP_01462455.1| DNA methylase [Stigmatella aurantiaca DW4/3-1]
 gi|310823140|ref|YP_003955498.1| adenine-specific DNA methyltransferase [Stigmatella aurantiaca
           DW4/3-1]
 gi|115367839|gb|EAU66807.1| DNA methylase [Stigmatella aurantiaca DW4/3-1]
 gi|309396212|gb|ADO73671.1| adenine-specific DNA methyltransferase [Stigmatella aurantiaca
           DW4/3-1]
          Length = 289

 Score =  195 bits (496), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 108/264 (40%), Positives = 142/264 (53%), Gaps = 18/264 (6%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           K+ +G+S+ +L + P +  DL+FADPPY L  NG               +WD     E  
Sbjct: 27  KLYQGDSVELLNQFPEQQFDLVFADPPYFLS-NGGFTCKSGKRASVAKGAWDVSRGVEED 85

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFR 141
             FT  WL AC+RVLKP GTLWV G+ H IF +G  +Q L F +LN + W K N  PN  
Sbjct: 86  HRFTTEWLKACQRVLKPTGTLWVSGTQHVIFNVGFAMQKLGFKLLNTVTWYKPNASPNLS 145

Query: 142 GRRFQNAHETLIWASPSP-KAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERL----- 195
            R F ++ E LIWASP P K   +TFNY  +K  N   QMR  W +P  +G E L     
Sbjct: 146 CRYFTHSTELLIWASPKPAKTLQHTFNYARMKTENGGKQMRDVWNLPR-TGEEELSADGA 204

Query: 196 ----------RNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLR 245
                     R +     HPTQKP ALL RI+ +ST     +LDPF GSGT+G  A KL 
Sbjct: 205 GRMWTQIAPRREEKAFGSHPTQKPVALLERIIEASTPEDATVLDPFNGSGTTGVAALKLG 264

Query: 246 RSFIGIEMKQDYIDIATKRIASVQ 269
           R + GI++   Y+ +  KR+ +V+
Sbjct: 265 RRYTGIDLDPTYLSLTKKRLDAVK 288


>gi|329119746|ref|ZP_08248425.1| modification methylase DpnIIB [Neisseria bacilliformis ATCC
           BAA-1200]
 gi|327464141|gb|EGF10447.1| modification methylase DpnIIB [Neisseria bacilliformis ATCC
           BAA-1200]
          Length = 269

 Score =  195 bits (495), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 98/235 (41%), Positives = 142/235 (60%), Gaps = 7/235 (2%)

Query: 31  VLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLL 90
           +L+K P    D+IFADPPY L  NG   + +  +V      WDK     A   F   WL 
Sbjct: 39  ILDKHPEGCFDMIFADPPYFLSNNGFTCQ-NGQMVSVNKGGWDKSQGMAADMEFYEEWLR 97

Query: 91  ACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHE 150
            C  +LKPNGT+WV G+ HNI+ +G ++Q++ + ILN+I W K NP PN   R F ++ E
Sbjct: 98  LCYALLKPNGTIWVCGTQHNIYLVGYLMQSVGYHILNNITWEKPNPPPNLSCRFFTHSTE 157

Query: 151 TLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPE 210
           TL+WA  +  AK +TF+Y  +KA N   QM+S W +   + +E+   K     HPTQKP 
Sbjct: 158 TLLWAKKNKTAK-HTFHYKVMKAQNGGKQMKSVWQLTPPNKTEKTHGK-----HPTQKPL 211

Query: 211 ALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRI 265
           ALL R +++++  GD++ DPF GSGT+GA A K  R F G E ++++ ++A KR+
Sbjct: 212 ALLERCILAASNIGDLVFDPFAGSGTTGAAALKHGRRFCGCEKEEEFFELAKKRL 266


>gi|162447937|ref|YP_001621069.1| DNA methylase [Acholeplasma laidlawii PG-8A]
 gi|161986044|gb|ABX81693.1| DNA methylase [Acholeplasma laidlawii PG-8A]
          Length = 256

 Score =  195 bits (495), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 101/248 (40%), Positives = 153/248 (61%), Gaps = 9/248 (3%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFS-SFEA 80
           K+  G+S  +L++L  KSVD+IFADPPY L  NG +      +V     +WDK   + E 
Sbjct: 12  KLYLGDSFEILDELDEKSVDMIFADPPYFLSNNG-ITCQGGKMVSVNKATWDKTEMTIEE 70

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
              +   WL  C+R+LK  GT+W+ G+ HNI+ IG  L+   F I+N+I W K+NP P+ 
Sbjct: 71  KIKYNTTWLNKCKRILKDTGTIWISGTLHNIYIIGVCLELEGFQIINNITWEKTNPPPHL 130

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
             + F ++ ET++WA     +K Y F+Y  +K+ N + QM+  W   +   SE+   K  
Sbjct: 131 ARKAFTHSTETVLWARKK-GSKNY-FDYSLMKSLNNNKQMKDVWRFSLTKPSEKRLGK-- 186

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
              HPTQKP ALL RI+++STK GD++LDPF GSGT+G  +  L R +IGI+ ++DY+++
Sbjct: 187 ---HPTQKPLALLERIILASTKEGDVVLDPFSGSGTTGVASIMLNRKYIGIDFEKDYLNL 243

Query: 261 ATKRIASV 268
           + KR+ S+
Sbjct: 244 SIKRLESI 251


>gi|254492921|ref|ZP_05106092.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Neisseria
           gonorrhoeae 1291]
 gi|268598172|ref|ZP_06132339.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Neisseria
           gonorrhoeae MS11]
 gi|268600516|ref|ZP_06134683.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Neisseria
           gonorrhoeae PID18]
 gi|268602749|ref|ZP_06136916.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Neisseria
           gonorrhoeae PID1]
 gi|268681298|ref|ZP_06148160.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Neisseria
           gonorrhoeae PID332]
 gi|291044684|ref|ZP_06570393.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Neisseria
           gonorrhoeae DGI2]
 gi|226511961|gb|EEH61306.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Neisseria
           gonorrhoeae 1291]
 gi|268582303|gb|EEZ46979.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Neisseria
           gonorrhoeae MS11]
 gi|268584647|gb|EEZ49323.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Neisseria
           gonorrhoeae PID18]
 gi|268586880|gb|EEZ51556.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Neisseria
           gonorrhoeae PID1]
 gi|268621582|gb|EEZ53982.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Neisseria
           gonorrhoeae PID332]
 gi|291011578|gb|EFE03574.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Neisseria
           gonorrhoeae DGI2]
          Length = 252

 Score =  194 bits (494), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 97/229 (42%), Positives = 139/229 (60%), Gaps = 7/229 (3%)

Query: 31  VLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLL 90
           +LEK P    D+IFADPPY L  +G     +  +V     +WDK     A   F   WL 
Sbjct: 31  ILEKHPNGCFDMIFADPPYFLSNDG-FSCQNGQMVSVNKGNWDKSKGMAADLEFYEEWLR 89

Query: 91  ACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHE 150
            C  +LKPNGT+WV G++HNI+ IG ++Q + + ILN+I W K NP PN   R F ++ E
Sbjct: 90  LCYALLKPNGTIWVCGTFHNIYLIGYLMQTVGYHILNNITWEKPNPPPNLSCRFFTHSTE 149

Query: 151 TLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPE 210
           T++WA  + KAK +TF+Y+ +KA N   QM+  W  P  + +E+   K     HPTQKP 
Sbjct: 150 TILWAKKNKKAK-HTFHYEMMKAQNNGKQMKCVWTFPPPNKTEKTFGK-----HPTQKPL 203

Query: 211 ALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYID 259
           +LL R ++S++  GD+I DPF GSGT+G  A K  R F G E+++D+++
Sbjct: 204 SLLERCILSASNIGDLIFDPFMGSGTTGVAALKHGRRFCGCELEEDFLN 252


>gi|220918133|ref|YP_002493437.1| DNA methylase N-4/N-6 domain protein [Anaeromyxobacter dehalogenans
           2CP-1]
 gi|219955987|gb|ACL66371.1| DNA methylase N-4/N-6 domain protein [Anaeromyxobacter dehalogenans
           2CP-1]
          Length = 286

 Score =  194 bits (493), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 110/273 (40%), Positives = 146/273 (53%), Gaps = 25/273 (9%)

Query: 16  IFEWKD-----------KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSL 64
           + EW D            +++G+ +  LE+LP  SVD+ FADPPY L   G   +     
Sbjct: 8   LHEWNDLPGVAERGRGWALVQGDCVEALERLPPHSVDVAFADPPYMLSNGGSTCQGGRR- 66

Query: 65  VDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFW 124
                 SWD    F A  AF   WL A R+VLKP+GTLWV G+ H IF IG  +Q L F 
Sbjct: 67  TSVNKGSWDASGGFAADHAFQARWLQAVRKVLKPSGTLWVSGTQHVIFSIGYAMQELGFH 126

Query: 125 ILNDIVWRKSNPMPNFRGRRFQNAHETLIWASP-SPKAKGYTFNYDALKAANEDVQMRSD 183
           +LN + W K N  PN   R F ++ E L+WASP   +   + FNY A+K AN   QMR  
Sbjct: 127 LLNTVTWYKPNASPNLACRFFTHSTEILLWASPMKARPLAHRFNYRAMKTANGGKQMRDL 186

Query: 184 WLI---PICSGSERL--------RNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFF 232
           W I   P   G + +        R K   + HPTQKP ALL R+L +S  PGD++LDPF 
Sbjct: 187 WEIADRPAPGGDQVVWSVPTPGPREKVHGR-HPTQKPLALLERVLAASAAPGDLVLDPFS 245

Query: 233 GSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRI 265
           GS T+G  A +    F+G+E    Y+D+A +R+
Sbjct: 246 GSATTGVAALRAGCRFLGLERDPGYVDLAARRL 278


>gi|197123344|ref|YP_002135295.1| DNA methylase N-4/N-6 domain protein [Anaeromyxobacter sp. K]
 gi|196173193|gb|ACG74166.1| DNA methylase N-4/N-6 domain protein [Anaeromyxobacter sp. K]
          Length = 286

 Score =  194 bits (493), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 110/273 (40%), Positives = 146/273 (53%), Gaps = 25/273 (9%)

Query: 16  IFEWKD-----------KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSL 64
           + EW D            +++G+ +  LE+LP  SVD+ FADPPY L   G   +     
Sbjct: 8   LHEWNDLPGVAERGRGWALVQGDCVEALERLPPHSVDVAFADPPYMLSNGGSTCQGGRR- 66

Query: 65  VDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFW 124
                 SWD    F A  AF   WL A R+VLKP+GTLWV G+ H IF IG  +Q L F 
Sbjct: 67  TSVNKGSWDASGGFAADHAFQARWLQAVRKVLKPSGTLWVSGTQHVIFSIGYAMQELGFH 126

Query: 125 ILNDIVWRKSNPMPNFRGRRFQNAHETLIWASP-SPKAKGYTFNYDALKAANEDVQMRSD 183
           +LN + W K N  PN   R F ++ E L+WASP   +   + FNY A+K AN   QMR  
Sbjct: 127 LLNTVTWYKPNASPNLACRFFTHSTEILLWASPMKARPLAHRFNYRAMKTANGGKQMRDL 186

Query: 184 WLI---PICSGSERL--------RNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFF 232
           W I   P   G + +        R K   + HPTQKP ALL R+L +S  PGD++LDPF 
Sbjct: 187 WEIADRPAPGGDQVVWSVPTPGPREKVHGR-HPTQKPLALLERVLAASAAPGDLVLDPFS 245

Query: 233 GSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRI 265
           GS T+G  A +    F+G+E    Y+D+A +R+
Sbjct: 246 GSATTGVAALRAGCRFLGLERDPGYVDLAARRL 278


>gi|239998143|ref|ZP_04718067.1| putative modification methylase [Neisseria gonorrhoeae 35/02]
 gi|240015769|ref|ZP_04722309.1| putative modification methylase [Neisseria gonorrhoeae FA6140]
 gi|240079906|ref|ZP_04724449.1| putative modification methylase [Neisseria gonorrhoeae FA19]
 gi|240112113|ref|ZP_04726603.1| putative modification methylase [Neisseria gonorrhoeae MS11]
 gi|240114859|ref|ZP_04728921.1| putative modification methylase [Neisseria gonorrhoeae PID18]
 gi|240117062|ref|ZP_04731124.1| putative modification methylase [Neisseria gonorrhoeae PID1]
 gi|240122700|ref|ZP_04735656.1| putative modification methylase [Neisseria gonorrhoeae PID332]
 gi|260441326|ref|ZP_05795142.1| putative modification methylase [Neisseria gonorrhoeae DGI2]
 gi|268593992|ref|ZP_06128159.1| conserved hypothetical protein [Neisseria gonorrhoeae 35/02]
 gi|268596046|ref|ZP_06130213.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|268547381|gb|EEZ42799.1| conserved hypothetical protein [Neisseria gonorrhoeae 35/02]
 gi|268549834|gb|EEZ44853.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|317165585|gb|ADV09126.1| putative modification methylase [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 225

 Score =  194 bits (492), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 97/229 (42%), Positives = 139/229 (60%), Gaps = 7/229 (3%)

Query: 31  VLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLL 90
           +LEK P    D+IFADPPY L  +G     +  +V     +WDK     A   F   WL 
Sbjct: 4   ILEKHPNGCFDMIFADPPYFLSNDG-FSCQNGQMVSVNKGNWDKSKGMAADLEFYEEWLR 62

Query: 91  ACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHE 150
            C  +LKPNGT+WV G++HNI+ IG ++Q + + ILN+I W K NP PN   R F ++ E
Sbjct: 63  LCYALLKPNGTIWVCGTFHNIYLIGYLMQTVGYHILNNITWEKPNPPPNLSCRFFTHSTE 122

Query: 151 TLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPE 210
           T++WA  + KAK +TF+Y+ +KA N   QM+  W  P  + +E+   K     HPTQKP 
Sbjct: 123 TILWAKKNKKAK-HTFHYEMMKAQNNGKQMKCVWTFPPPNKTEKTFGK-----HPTQKPL 176

Query: 211 ALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYID 259
           +LL R ++S++  GD+I DPF GSGT+G  A K  R F G E+++D+++
Sbjct: 177 SLLERCILSASNIGDLIFDPFMGSGTTGVAALKHGRRFCGCELEEDFLN 225


>gi|189485748|ref|YP_001956689.1| DNA modification methylase [uncultured Termite group 1 bacterium
           phylotype Rs-D17]
 gi|170287707|dbj|BAG14228.1| DNA modification methylase [uncultured Termite group 1 bacterium
           phylotype Rs-D17]
          Length = 310

 Score =  193 bits (491), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 109/251 (43%), Positives = 147/251 (58%), Gaps = 15/251 (5%)

Query: 26  GNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFT 85
           G+ I +L+ LP  SV++IFADPPY L  NG         V      WD     E    F 
Sbjct: 18  GDCIEILKLLPIDSVNMIFADPPYFLS-NGSFTCHAGKRVSVKKGDWDLGGGTEKNLEFH 76

Query: 86  RAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRF 145
            AWL AC+RVLKPNGT+WV G+YH+I++ G  L+   +  LNDI+W K N  PN   R F
Sbjct: 77  IAWLKACKRVLKPNGTIWVSGTYHSIYQCGVALEINGYHFLNDIIWFKPNAAPNLSCRFF 136

Query: 146 QNAHETLIWASPSPKAKGYTFNYDALKAAN--EDV------QMRSDWLIPICSGSERLRN 197
             +HET+IW+    K++ + FNYD +K     ED+      QMRS W I     SE++  
Sbjct: 137 TASHETIIWSKKEKKSR-HIFNYDLMKKGQWKEDLLKKDGSQMRSVWSIGTPKPSEKIFG 195

Query: 198 KDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDY 257
           K     HPTQKP  LL RI+++ST+ GDIILDPF GS T+G  A    R FIGI+ ++ Y
Sbjct: 196 K-----HPTQKPLDLLKRIVLASTEAGDIILDPFTGSSTTGIAAVTNGRMFIGIDKEKRY 250

Query: 258 IDIATKRIASV 268
           ++++ KR  ++
Sbjct: 251 LELSVKRFENL 261


>gi|293397789|ref|ZP_06641995.1| DNA methylase [Neisseria gonorrhoeae F62]
 gi|291611735|gb|EFF40804.1| DNA methylase [Neisseria gonorrhoeae F62]
          Length = 225

 Score =  193 bits (490), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 97/229 (42%), Positives = 138/229 (60%), Gaps = 7/229 (3%)

Query: 31  VLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLL 90
           +LEK P    D+IFADPPY L  +G     +  +V     +WDK     A   F   WL 
Sbjct: 4   ILEKHPNGCFDMIFADPPYFLSNDG-FSCQNGQMVSVNKGNWDKSKGMAADLEFYEEWLR 62

Query: 91  ACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHE 150
            C  +LKPNGT+WV G++HNI+ IG ++Q + + ILN+I W K NP PN   R F ++ E
Sbjct: 63  LCYALLKPNGTIWVCGTFHNIYLIGYLMQTVGYHILNNITWEKPNPPPNLSCRFFTHSTE 122

Query: 151 TLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPE 210
           T++WA  + KAK +TF+Y+ +KA N   QM+  W  P  + +E+   K     HPTQKP 
Sbjct: 123 TILWAKKNKKAK-HTFHYEMMKAQNNGKQMKCVWTFPPPNKTEKTFGK-----HPTQKPL 176

Query: 211 ALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYID 259
            LL R ++S++  GD+I DPF GSGT+G  A K  R F G E+++D+++
Sbjct: 177 PLLERCILSASNIGDLIFDPFMGSGTTGVAALKHGRRFCGCELEEDFLN 225


>gi|108763695|ref|YP_633292.1| putative adenine-specific DNA methyltransferase [Myxococcus xanthus
           DK 1622]
 gi|108467575|gb|ABF92760.1| putative adenine-specific DNA methyltransferase [Myxococcus xanthus
           DK 1622]
          Length = 294

 Score =  193 bits (490), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 105/259 (40%), Positives = 141/259 (54%), Gaps = 17/259 (6%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           ++ G+S+ ++ +   ++ D+IFADPPY L  NG         V      WD     E   
Sbjct: 31  LLHGDSLELMSQFEPQTFDMIFADPPYFLS-NGGTTCKGGKRVSVAKGGWDVSRGVEEDH 89

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            FT  WL AC+R+LKP GTLWV G+ H IF  G  +Q L + +LN + W K N  PN   
Sbjct: 90  KFTTEWLAACQRLLKPTGTLWVSGTQHVIFNAGFAMQKLGYKLLNTVTWFKPNASPNLAC 149

Query: 143 RRFQNAHETLIWASPSPKAK-GYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG- 200
           R F ++ E LIWASP    K  +TFNY  +KA N   QMR  W +P    +E   + +G 
Sbjct: 150 RYFTHSTELLIWASPKSGGKLQHTFNYARMKAENGGKQMRDAWALPPSGDAELTADGEGR 209

Query: 201 -----------EKL---HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRR 246
                      EK    HPTQKP ALL RIL +S  P  ++LDPF GSGTSG  A KL  
Sbjct: 210 MWTLTVPRGGEEKAFGSHPTQKPVALLERILEASCPPDALVLDPFNGSGTSGVAALKLGH 269

Query: 247 SFIGIEMKQDYIDIATKRI 265
            ++GI+M + Y+ ++ KR+
Sbjct: 270 RYVGIDMDEKYLALSEKRL 288


>gi|257455789|ref|ZP_05621015.1| DNA methylase [Enhydrobacter aerosaccus SK60]
 gi|257446803|gb|EEV21820.1| DNA methylase [Enhydrobacter aerosaccus SK60]
          Length = 269

 Score =  192 bits (489), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 101/243 (41%), Positives = 147/243 (60%), Gaps = 9/243 (3%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTD-SWDKFSSFEAY 81
           +++G+ + +L  +  KS+++IFADPPY L  +G   +  + +V +V    WDKFS     
Sbjct: 13  LLQGDCLHILPTIDDKSINMIFADPPYFLSNDGLTVK--NGMVQSVNKGEWDKFSDDNEV 70

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFR 141
             FT  WL   +R+L  NGT+W+ G++HNIF +G +L  LNF ILN I W K NP PNF 
Sbjct: 71  YIFTYDWLSQAKRMLADNGTIWMSGTHHNIFTLGRVLSQLNFKILNMITWEKPNPPPNFS 130

Query: 142 GRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGE 201
            R F  + E +IWA  +PK   Y F+Y+ +K+ N D QM+  W +P  S  E+   K   
Sbjct: 131 CRYFTYSTEWIIWARKNPKIPHY-FDYELMKSLNGDKQMKDVWRLPAVSSWEKQFGK--- 186

Query: 202 KLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIA 261
             HPTQKP  LLSRI+++STK  D++LDPF GS T+G  A    R FIG++   +++ ++
Sbjct: 187 --HPTQKPLGLLSRIVLASTKANDLVLDPFTGSSTTGIAANLFGRKFIGVDQDSNFLTLS 244

Query: 262 TKR 264
             R
Sbjct: 245 KNR 247


>gi|298346767|ref|YP_003719454.1| adenine-specific DNA-methyltransferase [Mobiluncus curtisii ATCC
           43063]
 gi|298236828|gb|ADI67960.1| site-specific DNA-methyltransferase (adenine-specific) [Mobiluncus
           curtisii ATCC 43063]
          Length = 274

 Score =  192 bits (487), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 100/244 (40%), Positives = 142/244 (58%), Gaps = 6/244 (2%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           K+I  +    L+ +  +SVD+IFADPPY L  +G +       V      WDK       
Sbjct: 17  KLILADVFDALKNIEEQSVDMIFADPPYFLSNDG-ISCSGGKQVSVNKGDWDKGLPLSEK 75

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFR 141
             F R W+  C+RVLK +G++W+ G++HNI+ IG  L+   F ILN+I W+K NP PN  
Sbjct: 76  HEFNRHWIRECKRVLKLDGSIWISGTFHNIYSIGFALEQERFKILNNITWQKLNPPPNLG 135

Query: 142 GRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGE 201
            R F ++ ET+IWA        + FNY  +K  N+  QM+  W      G+   +N+   
Sbjct: 136 CRCFTHSTETVIWARKDENKAKHKFNYGLMKELNDGKQMKDVW-----QGTLTPKNEKAF 190

Query: 202 KLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIA 261
             HPTQKPE LL RI+++ST  GD++LDPF GSGT+  VA +L RS IGI+   +Y++IA
Sbjct: 191 GKHPTQKPEYLLERIILASTNEGDLVLDPFVGSGTTVVVANRLGRSGIGIDNNTEYLEIA 250

Query: 262 TKRI 265
            KR+
Sbjct: 251 KKRL 254


>gi|294673721|ref|YP_003574337.1| DNA (cytosine-5-)-methyltransferase [Prevotella ruminicola 23]
 gi|294472635|gb|ADE82024.1| DNA (cytosine-5-)-methyltransferase [Prevotella ruminicola 23]
          Length = 414

 Score =  192 bits (487), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 100/242 (41%), Positives = 149/242 (61%), Gaps = 8/242 (3%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           +++G+ +SVL     K  D+IFADPPY L  NG +   +  +V     +WDK  S E  D
Sbjct: 17  LVEGDCVSVLNAFDFK-FDMIFADPPYFLS-NGGISVSNGKVVCVDKGAWDKAPSSEYID 74

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            F   WL AC+  LK NGT+W+ G++HNIF +   L  L F ILN + W K++P  N   
Sbjct: 75  EFNHKWLSACKDKLKDNGTIWISGTHHNIFSVAEQLSELGFKILNVVTWNKTDPPDNVSH 134

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           R F+++ E +IWA  S KA+ + +NY+ ++  N+  QM   W +P  S  E+   K    
Sbjct: 135 RVFKHSAEYIIWAKKSKKAQ-HRYNYELMRQLNDGKQMTDVWRMPAVSKWEKSCGK---- 189

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKP +LL+RI+++STK GD +LDPF GSGT+G  A  L R ++GI++++ ++++A 
Sbjct: 190 -HPTQKPLSLLARIIMASTKEGDWVLDPFNGSGTTGVAASLLGRKYLGIDIEKSFLELAA 248

Query: 263 KR 264
           KR
Sbjct: 249 KR 250


>gi|149917692|ref|ZP_01906188.1| DNA methylase N-4/N-6 [Plesiocystis pacifica SIR-1]
 gi|149821474|gb|EDM80874.1| DNA methylase N-4/N-6 [Plesiocystis pacifica SIR-1]
          Length = 348

 Score =  192 bits (487), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 102/246 (41%), Positives = 145/246 (58%), Gaps = 7/246 (2%)

Query: 20  KDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFE 79
           + ++I+G+S+ +LE+LP  SVD+IFADPPY L  NG         V      WD     +
Sbjct: 86  RARLIQGDSLDILEQLPEGSVDVIFADPPYFLS-NGGTTCQGGKRVSVNKGKWDASLGAQ 144

Query: 80  AYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPN 139
              AF + WL AC+RVL  NGT+WV G+ H IF +G  +Q L F +LNDIVW K NP PN
Sbjct: 145 DNHAFNKRWLSACQRVLADNGTIWVSGTAHVIFSVGYAMQELGFKMLNDIVWEKPNPPPN 204

Query: 140 FRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKD 199
              R F ++ E ++WA+ + K+K Y ++Y  +K  N   QM++ W       SE+   K 
Sbjct: 205 LSCRYFTHSTELVLWAAKTRKSKHY-YDYQEMKLRNGGKQMKNVWRFTAPGKSEKTHGK- 262

Query: 200 GEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYID 259
               HPTQKP ALL R+L++S  P   +LDPF GSGT+G  A KL   + G+E + +Y+ 
Sbjct: 263 ----HPTQKPLALLDRLLMASCHPDARVLDPFNGSGTTGVAAAKLGLQYTGLEREPEYLA 318

Query: 260 IATKRI 265
           ++  R+
Sbjct: 319 LSKARL 324


>gi|306818165|ref|ZP_07451896.1| modification methylase BabI [Mobiluncus mulieris ATCC 35239]
 gi|304649129|gb|EFM46423.1| modification methylase BabI [Mobiluncus mulieris ATCC 35239]
          Length = 323

 Score =  190 bits (483), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 97/231 (41%), Positives = 139/231 (60%), Gaps = 6/231 (2%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           +I  G++  +L ++   SVD+IFADPPY L  NG +       V     +WD+    E  
Sbjct: 23  RIFLGDAFEILARIAQSSVDMIFADPPYFLS-NGGISCSGGRQVSVNKGAWDRGMGTEEK 81

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFR 141
             F R W+  C+RVLK +G++WV G++HNI+ +G  L+   F ILN+I W+K NP PN  
Sbjct: 82  HGFNRRWVRQCKRVLKRDGSIWVSGTFHNIYSLGFALEQEGFKILNNITWQKLNPPPNLA 141

Query: 142 GRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGE 201
            R F ++ ET+IWA  + +   + F+Y  +K  N   QM+  W   +   SE++  K   
Sbjct: 142 CRCFTHSTETVIWARKNERKARHFFDYPLMKTLNGGKQMKDVWAGTLTPKSEKICGK--- 198

Query: 202 KLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIE 252
             HPTQKPE LL RI+++ST+ GD++LDPF GSGT+  VAK+L R  IGIE
Sbjct: 199 --HPTQKPEYLLERIILASTREGDLVLDPFVGSGTTAVVAKRLGRYSIGIE 247


>gi|146297740|ref|YP_001181511.1| DNA methylase N-4/N-6 domain-containing protein
           [Caldicellulosiruptor saccharolyticus DSM 8903]
 gi|145411316|gb|ABP68320.1| DNA methylase N-4/N-6 domain protein [Caldicellulosiruptor
           saccharolyticus DSM 8903]
          Length = 247

 Score =  190 bits (482), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 111/261 (42%), Positives = 148/261 (56%), Gaps = 17/261 (6%)

Query: 20  KDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSS-F 78
           K  +   + ++VL+K+   S+DLIFADPPYNL     L       V      WDK    F
Sbjct: 3   KVHLFNDDCLNVLKKIEDNSIDLIFADPPYNLSSENALTTRAGKPVKCYKGEWDKIDDIF 62

Query: 79  EAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
           E    F   W+  C RVLK  GT+W+ G+ HN   IGT+L+ L  WI+NDI+W K N  P
Sbjct: 63  E----FNLRWIEQCVRVLKETGTIWISGTLHNHPIIGTILKQLGLWIINDIIWFKPNATP 118

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
                RF  + E LIW +   K K Y F+Y+  +  N   QMR+ W IP    ++R +  
Sbjct: 119 LLSRNRFVPSTE-LIWVAS--KNKRYYFDYEMARKLNGGKQMRNLWEIP----AQRHKTP 171

Query: 199 DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYI 258
                HPT+KPEALL RI++  +K GD++LDPF GSGT+G VAK L+R+FIGIE+   Y 
Sbjct: 172 -----HPTEKPEALLERIILIGSKEGDVVLDPFMGSGTTGVVAKLLKRNFIGIEIDPVYF 226

Query: 259 DIATKRIASVQPLGNIELTVL 279
           +IA KRI   +P+    L  L
Sbjct: 227 EIAKKRIEEEKPIQQTFLNFL 247


>gi|59800480|ref|YP_207192.1| putative modification methylase [Neisseria gonorrhoeae FA 1090]
 gi|59717375|gb|AAW88780.1| putative modification methylase [Neisseria gonorrhoeae FA 1090]
          Length = 225

 Score =  190 bits (482), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 96/229 (41%), Positives = 137/229 (59%), Gaps = 7/229 (3%)

Query: 31  VLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLL 90
           +LEK P    D+IFADPPY L  +G     +  +V     +WDK     A   F   WL 
Sbjct: 4   ILEKHPNGCFDMIFADPPYFLSNDG-FSCQNGQMVSVNKGNWDKSKGMAADLEFYEEWLR 62

Query: 91  ACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHE 150
            C  +LKPNGT+WV G++HNI+ IG ++Q + + ILN+I W K NP PN   R F ++ E
Sbjct: 63  LCYALLKPNGTIWVCGTFHNIYLIGYLMQTVGYHILNNITWEKPNPPPNLSCRFFTHSTE 122

Query: 151 TLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPE 210
           T++WA  + KAK +TF+Y+ +KA N   QM+  W     + +E+   K     HPTQKP 
Sbjct: 123 TILWAKKNKKAK-HTFHYEMMKAQNNGKQMKCVWTFAPPNKTEKTFGK-----HPTQKPL 176

Query: 211 ALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYID 259
            LL R ++S++  GD+I DPF GSGT+G  A K  R F G E+++D+++
Sbjct: 177 PLLERCILSASNIGDLIFDPFMGSGTTGVAALKHGRRFCGCELEEDFLN 225


>gi|218514040|ref|ZP_03510880.1| site-specific DNA-methyltransferase (adenine-specific) protein
           [Rhizobium etli 8C-3]
          Length = 131

 Score =  189 bits (479), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 94/109 (86%)

Query: 19  WKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSF 78
           W D IIKG+ +S LE LP  SVD+IFADPPYNLQL G L+RPD SLVDAV D WD+F+SF
Sbjct: 23  WIDTIIKGDCVSALEALPTHSVDVIFADPPYNLQLGGTLHRPDQSLVDAVDDEWDQFASF 82

Query: 79  EAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILN 127
           EAYDAFTRAWLLACRRVLKP G++WVIGSYHNIFR+G  LQ+LNFWILN
Sbjct: 83  EAYDAFTRAWLLACRRVLKPTGSIWVIGSYHNIFRVGATLQDLNFWILN 131


>gi|239616524|ref|YP_002939846.1| DNA methylase N-4/N-6 domain protein [Kosmotoga olearia TBF 19.5.1]
 gi|239505355|gb|ACR78842.1| DNA methylase N-4/N-6 domain protein [Kosmotoga olearia TBF 19.5.1]
          Length = 250

 Score =  188 bits (478), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 111/261 (42%), Positives = 147/261 (56%), Gaps = 19/261 (7%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           K+I G+ I  L+KL A+SVDLIFADPPYNL     L       V      WDK  +    
Sbjct: 5   KLILGDCIEELKKLEAESVDLIFADPPYNLSGENHLTVHAGKPVKLDKGEWDKIDNIHE- 63

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFR 141
             F   W+  C RVLKP+GT+W+ G+ HN   IG  L+ L  WI+ND+VW K N  P   
Sbjct: 64  --FNLNWIKECIRVLKPHGTIWISGTLHNHPSIGMALKQLGLWIINDVVWYKPNATPLLS 121

Query: 142 GRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGE 201
             RF  + E +IW +   K+K Y FNY+  K  N+  QMR+ W I         + K   
Sbjct: 122 KNRFVPSTE-IIWVAG--KSKKYYFNYELAKEMNKGKQMRNLWTI---------KAKRHI 169

Query: 202 KLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIA 261
             HP +KPE LL RI++  +   D ILDPF GSGT+G VAK+  R+FIGIE+ Q+Y + A
Sbjct: 170 TPHPAEKPEELLERIILIGSNEADTILDPFMGSGTTGVVAKRYNRNFIGIEINQEYFEWA 229

Query: 262 TKRIAS--VQP--LGNIELTV 278
            +RI    V+P   G+I+ +V
Sbjct: 230 KERIEKTIVKPSLFGSIKKSV 250


>gi|108805939|ref|YP_645876.1| DNA methylase N-4/N-6 [Rubrobacter xylanophilus DSM 9941]
 gi|108767182|gb|ABG06064.1| DNA methylase N-4/N-6 [Rubrobacter xylanophilus DSM 9941]
          Length = 266

 Score =  188 bits (478), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 97/239 (40%), Positives = 139/239 (58%), Gaps = 9/239 (3%)

Query: 27  NSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTR 86
           + + ++  +P   VD IFADPPY L   G   R    L       WD+         F  
Sbjct: 20  DCVELMRLMPPGGVDAIFADPPYRLSGGGVTVR-GGRLAPVDKGEWDRPLGHRGNHEFNL 78

Query: 87  AWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQ 146
            WL   RRVL+P G++WV G++H IF +G  LQ+L F ++N +VW K +P PN     F 
Sbjct: 79  RWLREARRVLRPGGSIWVSGTHHIIFSLGFALQSLGFRLINSVVWEKPDPPPNALRTAFT 138

Query: 147 NAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPT 206
           +AHETLIWAS   K +G+TFN+D L   +   Q+ S W +P    +ERL        HPT
Sbjct: 139 HAHETLIWAS---KGRGHTFNHDLLNGPDPTSQLSSVWRMPPPPSAERLHG-----YHPT 190

Query: 207 QKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRI 265
           QKP  L+ R L++ST+ G+++ DPF GSGT+   AK+L R F+G E++++Y ++A +RI
Sbjct: 191 QKPLRLVRRALLASTREGELVFDPFTGSGTTAVAAKELGRFFVGAELEREYAELAGRRI 249


>gi|328948545|ref|YP_004365882.1| DNA methylase N-4/N-6 domain protein [Treponema succinifaciens DSM
           2489]
 gi|328448869|gb|AEB14585.1| DNA methylase N-4/N-6 domain protein [Treponema succinifaciens DSM
           2489]
          Length = 292

 Score =  187 bits (475), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 100/247 (40%), Positives = 144/247 (58%), Gaps = 8/247 (3%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           +++G+ + +L +   K  D+IFADPPY L  NG +       V      WDK   FE  +
Sbjct: 15  LLQGDCVELLNQFDFK-FDMIFADPPYFLS-NGGISVQSGKQVSVNKGGWDKSHGFEKDN 72

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            F R WL ACR  LK +GT+W+ G+YHNIF +  ML  L+F ILN + W K+NP PN   
Sbjct: 73  EFNRKWLSACRSHLKDDGTIWISGTYHNIFSVALMLNELDFRILNCVTWAKTNPPPNLSC 132

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           R F ++ E ++WA  S K   Y FNY+ +K  N   QMR  W++P  +  E+   K    
Sbjct: 133 RFFTHSTEFILWARKSKKVPHY-FNYELMKEINGGTQMRDLWILPAIAKWEKSCGK---- 187

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKP  LL+RI+++STK    ILDPF GS T+G  A  L R F+GI+ + ++++++ 
Sbjct: 188 -HPTQKPLPLLARIILASTKENVWILDPFTGSSTTGIAASLLNRRFLGIDRETEFLELSK 246

Query: 263 KRIASVQ 269
            R   ++
Sbjct: 247 ARREEIE 253


>gi|160888276|ref|ZP_02069279.1| hypothetical protein BACUNI_00686 [Bacteroides uniformis ATCC 8492]
 gi|317480155|ref|ZP_07939265.1| DNA methylase [Bacteroides sp. 4_1_36]
 gi|156862222|gb|EDO55653.1| hypothetical protein BACUNI_00686 [Bacteroides uniformis ATCC 8492]
 gi|316903702|gb|EFV25546.1| DNA methylase [Bacteroides sp. 4_1_36]
          Length = 290

 Score =  187 bits (475), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 101/254 (39%), Positives = 147/254 (57%), Gaps = 8/254 (3%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           ++ G+ I +L++   K  D+IFADPPY L  NG +      +V      WDK  + E  D
Sbjct: 14  LLHGDCIELLKQFSFK-FDMIFADPPYFLS-NGGISVQSGKMVCVDKGEWDKGGTPEYID 71

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
           +F RAW+  C+  LK NGT+W+ G+YHNIF I  +L  L F ILN + W K+NP PN   
Sbjct: 72  SFNRAWISECQNKLKENGTIWISGTYHNIFSIANILTELGFKILNVVTWAKTNPPPNISC 131

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           R F ++ E +IWA  S K   Y +NY  +K  N + QM   W +P  +  E+   K    
Sbjct: 132 RYFTHSTEFIIWARKSAKITHY-YNYSIMKQINSNKQMTDVWQLPAIARWEKSCGK---- 186

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKP ++LSRI+++ST+ G  ILDPF GS T+G  A  L R F+GI+ +++Y+ ++ 
Sbjct: 187 -HPTQKPLSVLSRIILASTRGGAWILDPFTGSSTTGIAANLLGRRFLGIDREEEYLILSK 245

Query: 263 KRIASVQPLGNIEL 276
            R   ++ +    L
Sbjct: 246 NRKKEIEQIAKFSL 259


>gi|291460930|ref|ZP_06025961.2| DNA (cytosine-5-)-methyltransferase [Fusobacterium periodonticum
           ATCC 33693]
 gi|291379913|gb|EFE87431.1| DNA (cytosine-5-)-methyltransferase [Fusobacterium periodonticum
           ATCC 33693]
          Length = 302

 Score =  186 bits (473), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 104/269 (38%), Positives = 150/269 (55%), Gaps = 30/269 (11%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLV--------DAVTDSW 72
           + II G  IS ++KLP   +DLI ADPPYNL   G  ++ D+S          + V   W
Sbjct: 19  NTIINGECISEMKKLPDSCIDLIIADPPYNLS-KGNKWKWDNSTKLKGMGGNWNKVIQEW 77

Query: 73  DKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWR 132
           D F+  ++Y  FT+ WL   +R+LKP G++W+ G+YHNI  I  + Q L   I+N+++W 
Sbjct: 78  DNFT-LQSYILFTKEWLSESKRILKPTGSIWIFGTYHNIGIINVVCQLLEIEIINEVIWY 136

Query: 133 KSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDV--------QMRSDW 184
           K N  PN  GRR   +HET++W + + K + Y FNY+  K A+           QMR+ W
Sbjct: 137 KRNAFPNLSGRRLTASHETILWCNKNGKKREYFFNYEFSKNADFSYDSLKSIGKQMRTVW 196

Query: 185 LIPICSGSERLRNKDGEKL----HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAV 240
            I          NK+  +L    HPTQKP  +L RI+  ++K  DIIL PF G+G+    
Sbjct: 197 DIS--------NNKEKSELLYGKHPTQKPIRILKRIIELTSKENDIILAPFSGAGSECVA 248

Query: 241 AKKLRRSFIGIEMKQDYIDIATKRIASVQ 269
           AK   R +IGIE+   Y DIA  R+A+++
Sbjct: 249 AKITGRKYIGIEINDFYCDIANNRLANIK 277


>gi|288929718|ref|ZP_06423561.1| DNA (cytosine-5-)-methyltransferase [Prevotella sp. oral taxon 317
           str. F0108]
 gi|288328819|gb|EFC67407.1| DNA (cytosine-5-)-methyltransferase [Prevotella sp. oral taxon 317
           str. F0108]
          Length = 301

 Score =  183 bits (465), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 108/283 (38%), Positives = 151/283 (53%), Gaps = 18/283 (6%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           +++GN I +L +   K  + IFADPPY L  NG +      +V      WDK    +  +
Sbjct: 15  LLQGNCIELLGQFDFK-FNTIFADPPYFLS-NGGISCQSGEVVSVNKGDWDKSHGADEDN 72

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            F R WL  CR  L  NGT+WV G+YHNIF +   L  L + ILN I W K+NP PN   
Sbjct: 73  LFNRRWLEVCRDKLADNGTIWVSGTYHNIFSVANCLAELGYKILNVITWAKTNPPPNISC 132

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           R F ++ E +IWA  SPK   Y FNY  +K  N++ QM   W +P  +  E+   K    
Sbjct: 133 RYFTHSSEFVIWARKSPKVPHY-FNYQLMKEMNDNKQMTDVWHLPAIAPWEKTCTK---- 187

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKP  LL+RI+++ST+P D +LDPF GS T+G  A    R + GIE +  +++I+ 
Sbjct: 188 -HPTQKPLGLLTRIILASTRPNDWVLDPFAGSSTTGIAANLFGRRYFGIEQEHHFLEISK 246

Query: 263 KRIASV-QP-LGNIELTVL--------TGKRTEPRVAFNLLVE 295
            R   + QP +  I +  +         G +TEP     L+ E
Sbjct: 247 ARHMEIEQPDVATIYIDKILKQLRKLNNGYKTEPLTETMLMCE 289


>gi|256820978|ref|YP_003142257.1| DNA methylase N-4/N-6 domain-containing protein [Capnocytophaga
           ochracea DSM 7271]
 gi|256582561|gb|ACU93696.1| DNA methylase N-4/N-6 domain protein [Capnocytophaga ochracea DSM
           7271]
          Length = 265

 Score =  183 bits (464), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 101/259 (38%), Positives = 148/259 (57%), Gaps = 11/259 (4%)

Query: 14  NSIFEWKDK---IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTD 70
           N  F+ +DK   ++ G+++ +L +   K  D++FADPPY L  NG L   +  +V     
Sbjct: 3   NLYFKSQDKSFYLLHGDTMELLPQFHHK-FDMVFADPPYFLS-NGGLTVNNGEIVSVNKG 60

Query: 71  SWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIV 130
            WDK       + F R WL   R V+K + T+W+ G+ HNIF IG +L  L F ILN I 
Sbjct: 61  DWDKSKGIVFVNDFNRQWLTLVREVMKEDATIWISGTMHNIFSIGQILTELGFKILNIIT 120

Query: 131 WRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICS 190
           W K+NP PNF  R F ++ E +IWA    K   Y FNY  +K  N + QM+  W  P  +
Sbjct: 121 WEKTNPPPNFSCRYFTHSTEQIIWARKEEKTPHY-FNYKLMKELNGNKQMKDVWRFPAIA 179

Query: 191 GSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIG 250
             E+   K     HPTQKP ++L+R++++STKP   ILDPF GS T+G  A  L R F+G
Sbjct: 180 PWEKTCGK-----HPTQKPLSVLTRLILASTKPNAWILDPFTGSSTTGIAANLLGRKFVG 234

Query: 251 IEMKQDYIDIATKRIASVQ 269
           I+ +QD+++++  R   ++
Sbjct: 235 IDKEQDFLELSKLRKLEIE 253


>gi|146297739|ref|YP_001181510.1| DNA methylase N-4/N-6 domain-containing protein
           [Caldicellulosiruptor saccharolyticus DSM 8903]
 gi|145411315|gb|ABP68319.1| DNA methylase N-4/N-6 domain protein [Caldicellulosiruptor
           saccharolyticus DSM 8903]
          Length = 270

 Score =  183 bits (464), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 98/264 (37%), Positives = 153/264 (57%), Gaps = 33/264 (12%)

Query: 23  IIKGNSISVL-EKLPAKSVDLIFADPPYNL----------QLNGQLYRPDHSLVDAVTDS 71
           I+ G+ ++++ E +P++S+DLI+ADPPYNL          +  G  Y+ +        DS
Sbjct: 6   ILHGDCVTIMKEHIPSESIDLIYADPPYNLSGRDLILKNNKTGGPFYKMNEEW-----DS 60

Query: 72  WDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVW 131
           WD    ++ Y  FT  WLLA   VLK NG+L++  +YHNI  +  + + + F + N + W
Sbjct: 61  WD----YDKYCEFTYNWLLASYSVLKSNGSLYISCTYHNIGEVIFLAKKIGFKLNNILTW 116

Query: 132 RKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANE------DVQMRSDWL 185
            K+N MPN   R F++  E + W    P   G+ F+Y+ +K  N        ++   D+ 
Sbjct: 117 VKTNAMPNITKRTFKHTTEFVCWFVKGP---GWKFHYNEIKMLNPRKTKDGSIKQMDDFF 173

Query: 186 ----IPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVA 241
               +P+  G ER+++ +G   HP QKPE LL  I+ +S+  GDI+LDPFFG+GT+G VA
Sbjct: 174 DFFEMPLVQGKERIKSDNGRAAHPNQKPEKLLEIIITASSDEGDIVLDPFFGTGTTGVVA 233

Query: 242 KKLRRSFIGIEMKQDYIDIATKRI 265
           +++ R +IGIE+ + YI IA KRI
Sbjct: 234 ERMNRKWIGIEINETYIKIAKKRI 257


>gi|325299176|ref|YP_004259093.1| DNA methylase N-4/N-6 domain-containing protein [Bacteroides
           salanitronis DSM 18170]
 gi|324318729|gb|ADY36620.1| DNA methylase N-4/N-6 domain protein [Bacteroides salanitronis DSM
           18170]
          Length = 293

 Score =  182 bits (463), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 98/242 (40%), Positives = 136/242 (56%), Gaps = 8/242 (3%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           ++KG+ I +L     K  D+IFADPPY+L  NG +      +V      WD+   +E   
Sbjct: 15  LLKGDCIELLHSFDFK-FDMIFADPPYHLS-NGGISVQSGKMVSVNKGDWDRSKGYEEDY 72

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            F R+W+ ACR  LK NGT+W+ G+YHNIF +   L  L F ILN I W K+NP PN   
Sbjct: 73  LFDRSWIEACRNKLKSNGTIWISGTYHNIFSVARCLTELGFKILNCITWEKTNPPPNLSC 132

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           + F ++ E ++WA    K   Y FNY+ +K  N   QMR  W +P     E+   K    
Sbjct: 133 KYFTHSAEYILWARKEQKVPHY-FNYELMKKINGGTQMRDVWRLPAIVRWEKSCGK---- 187

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKP  +LSRI+ +ST P   ILDPF GS T+G  A  L R F+GI+  ++++ ++ 
Sbjct: 188 -HPTQKPLCVLSRIIQASTLPSAWILDPFTGSSTTGIAANLLGRRFLGIDQNEEFLKMSK 246

Query: 263 KR 264
            R
Sbjct: 247 AR 248


>gi|81427756|ref|YP_394755.1| putative adenine-specifique DNA methyltransferase [Lactobacillus
           sakei subsp. sakei 23K]
 gi|78609397|emb|CAI54443.1| Putative adenine-specifique DNA methyltransferase [Lactobacillus
           sakei subsp. sakei 23K]
          Length = 261

 Score =  181 bits (459), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 100/262 (38%), Positives = 149/262 (56%), Gaps = 14/262 (5%)

Query: 19  WKDKIIK---GNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKF 75
           +KD+++K    ++   +++ P+ SVD+I ADPPY L  NG        +V      WDK 
Sbjct: 9   YKDELVKLICSDTFECMQRFPSNSVDVIIADPPYFLS-NGGFSNSGGKMVSVNKGEWDKI 67

Query: 76  SSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSN 135
           +  +    +TR  + +  R+LK +GT+WV GS HNI+ +G +L    F ILN+I W+KSN
Sbjct: 68  NDVKPEVFYTRL-IRSADRILKKDGTIWVFGSMHNIYILGYLLPKYGFKILNNITWQKSN 126

Query: 136 PMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERL 195
           P PN   R F ++ ET+IWA      +   FNYD +K  N   QM+  W  P  +  ER 
Sbjct: 127 PAPNLSKRMFTHSTETIIWAKKESGKQ--FFNYDLMKELNHSSQMKDVWTTPTINNYERR 184

Query: 196 RNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQ 255
             +     HPTQKP +++ R++ +ST  G I+LDPF GSGT+     +     IGI+  Q
Sbjct: 185 FGR-----HPTQKPLSVIDRMVKASTDSGMILLDPFVGSGTTAVAGARNGIRTIGIDNSQ 239

Query: 256 DYIDIATKRIASVQ--PLGNIE 275
           DY++IA KR+++ Q   LG I+
Sbjct: 240 DYLNIAIKRVSNFQEEKLGKIK 261


>gi|228473121|ref|ZP_04057878.1| DNA-methyltransferase [Capnocytophaga gingivalis ATCC 33624]
 gi|228275703|gb|EEK14480.1| DNA-methyltransferase [Capnocytophaga gingivalis ATCC 33624]
          Length = 270

 Score =  179 bits (455), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 98/256 (38%), Positives = 147/256 (57%), Gaps = 11/256 (4%)

Query: 17  FEWKDK---IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWD 73
           F+ +DK   ++ G+++ +L +   K  D++FADPPY L  NG L   +  +V      WD
Sbjct: 6   FKSQDKSFYLLHGDTMELLPQFHRK-FDMVFADPPYFLS-NGGLTVNNGEIVSVDKGDWD 63

Query: 74  KFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRK 133
           K       + F R WL   R V+K   T+W+ G+ HNIF +G +L  L F ILN I W K
Sbjct: 64  KSKGIAFVNDFNRQWLTLVREVMKEEATIWISGTMHNIFSVGQILTELGFKILNIITWEK 123

Query: 134 SNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSE 193
           +NP PNF  R F ++ E +IWA    K   Y FNY+ +K  N + QM+  W  P  +  E
Sbjct: 124 TNPPPNFSCRYFTHSTEQIIWARKEEKTPHY-FNYELMKQLNGNKQMKDVWRFPAIAPWE 182

Query: 194 RLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEM 253
           +   K     HPTQKP ++L+R++++ST+    ILDPF GS T+G  A  L R F+GI+ 
Sbjct: 183 KSCGK-----HPTQKPLSVLTRLILASTQTNAWILDPFTGSSTTGIAANLLVRKFVGIDK 237

Query: 254 KQDYIDIATKRIASVQ 269
           +QD+++++ KR   ++
Sbjct: 238 EQDFLELSKKRKFEIE 253


>gi|160884890|ref|ZP_02065893.1| hypothetical protein BACOVA_02880 [Bacteroides ovatus ATCC 8483]
 gi|237716944|ref|ZP_04547425.1| type II restriction enzyme M protein [Bacteroides sp. D1]
 gi|262405713|ref|ZP_06082263.1| DNA methylase [Bacteroides sp. 2_1_22]
 gi|294643396|ref|ZP_06721215.1| DNA (cytosine-5-)-methyltransferase [Bacteroides ovatus SD CC 2a]
 gi|294810621|ref|ZP_06769271.1| DNA (cytosine-5-)-methyltransferase [Bacteroides xylanisolvens SD
           CC 1b]
 gi|156109925|gb|EDO11670.1| hypothetical protein BACOVA_02880 [Bacteroides ovatus ATCC 8483]
 gi|229442927|gb|EEO48718.1| type II restriction enzyme M protein [Bacteroides sp. D1]
 gi|262356588|gb|EEZ05678.1| DNA methylase [Bacteroides sp. 2_1_22]
 gi|292641274|gb|EFF59473.1| DNA (cytosine-5-)-methyltransferase [Bacteroides ovatus SD CC 2a]
 gi|294442163|gb|EFG10980.1| DNA (cytosine-5-)-methyltransferase [Bacteroides xylanisolvens SD
           CC 1b]
 gi|295085863|emb|CBK67386.1| DNA modification methylase [Bacteroides xylanisolvens XB1A]
          Length = 279

 Score =  179 bits (454), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 94/224 (41%), Positives = 130/224 (58%), Gaps = 7/224 (3%)

Query: 41  DLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNG 100
           D+IFADPPY L  NG +      +V      WD+    E+ D F   W+  CR  LK NG
Sbjct: 33  DMIFADPPYFLS-NGGISVQSGKIVCVDKGDWDRSFGKESIDNFNYKWIADCRDKLKDNG 91

Query: 101 TLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPK 160
           T+W+ G+YHNIF +   L  L F ILN I W K+NP PN   R F  + E +IWA  +  
Sbjct: 92  TIWISGTYHNIFSVANQLTELGFKILNCITWVKTNPPPNISCRYFTYSAEYIIWARKNNN 151

Query: 161 AKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSS 220
              Y +NYD +K +N + QM   W +    G E++  K     HPTQKP  LL+R++ +S
Sbjct: 152 VSHY-YNYDFMKMSNANHQMTDVWNLSAIEGWEKIHGK-----HPTQKPINLLARVIAAS 205

Query: 221 TKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKR 264
           T+PG  ILDPF GS T+G  A  L+R F+GI+++Q Y++++  R
Sbjct: 206 TRPGAWILDPFAGSSTTGVTANLLKRRFLGIDIEQKYLELSILR 249


>gi|257461260|ref|ZP_05626357.1| DNA methylase [Campylobacter gracilis RM3268]
 gi|257441288|gb|EEV16434.1| DNA methylase [Campylobacter gracilis RM3268]
          Length = 271

 Score =  179 bits (453), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 99/243 (40%), Positives = 137/243 (56%), Gaps = 8/243 (3%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           K+ KG+  ++L K   +  DLIFADPPY L  +G L   +  +V      WDK    +  
Sbjct: 9   KLFKGDCFNILPKFKGE-FDLIFADPPYFLSNDG-LSIQNGQIVSVNKGEWDKSYGIDEI 66

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFR 141
           D F   WL   +  L  NG++ + G+YHNIF IG  LQ L++ ILN I W K+NP PNF 
Sbjct: 67  DKFNLEWLALAKDALANNGSVMISGTYHNIFSIGRALQKLDYKILNVITWAKTNPPPNFS 126

Query: 142 GRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGE 201
            R   +  E +IWA  S K K + FNY+ +K  N + QMR  W +P  +  E+   K   
Sbjct: 127 CRYLTHGSEQIIWARKSEKFK-HIFNYELMKKLNGNKQMRDVWSLPAIAPWEKACGK--- 182

Query: 202 KLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIA 261
             HPTQKP  LL R+++ ++    ++ DPF GS T+G  A  L R F+GIE + ++IDIA
Sbjct: 183 --HPTQKPLPLLVRLILMASTQNSVVCDPFAGSATTGVAANLLGRKFVGIEKEDEFIDIA 240

Query: 262 TKR 264
            KR
Sbjct: 241 VKR 243


>gi|213963061|ref|ZP_03391320.1| DNA methylase [Capnocytophaga sputigena Capno]
 gi|213954402|gb|EEB65725.1| DNA methylase [Capnocytophaga sputigena Capno]
          Length = 265

 Score =  178 bits (451), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 96/256 (37%), Positives = 146/256 (57%), Gaps = 11/256 (4%)

Query: 17  FEWKDK---IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWD 73
           F+ +DK   ++ G+++ +L +   K  D++FADPPY L  NG L   +  +V      WD
Sbjct: 6   FKSQDKSFYLLHGDTMELLPQFHRK-FDMVFADPPYFLS-NGGLTVNNGEIVSVNKGDWD 63

Query: 74  KFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRK 133
           K       + F R WL   R V+K   T+W+ G+ HNIF +G +L  L F ILN I W K
Sbjct: 64  KSKGIAFVNDFNRQWLTLVREVMKEEATIWISGTMHNIFSVGQILTELGFKILNIITWEK 123

Query: 134 SNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSE 193
           +NP PNF  R F ++ E ++WA    K   Y FNY+ +K  N + QM+  W  P  +  E
Sbjct: 124 TNPPPNFSCRYFTHSTEHIVWARKEEKTPHY-FNYELMKELNGNKQMKDVWRFPAIAPWE 182

Query: 194 RLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEM 253
           +   K     HPTQKP ++L+R++++ST+P   ILDPF GS T+G  A    R F+GI+ 
Sbjct: 183 KSCGK-----HPTQKPLSVLTRLILASTQPNTWILDPFTGSSTTGIAANLQGRKFVGIDK 237

Query: 254 KQDYIDIATKRIASVQ 269
           +Q++++++  R   +Q
Sbjct: 238 EQEFLELSKNRKLEIQ 253


>gi|313207303|ref|YP_004046480.1| DNA methylase n-4/n-6 domain protein [Riemerella anatipestifer DSM
           15868]
 gi|312446619|gb|ADQ82974.1| DNA methylase N-4/N-6 domain protein [Riemerella anatipestifer DSM
           15868]
 gi|315022082|gb|EFT35112.1| DNA methylase N-4/N-6 domain protein [Riemerella anatipestifer
           RA-YM]
 gi|325335248|gb|ADZ11522.1| DNA modification methylase [Riemerella anatipestifer RA-GD]
          Length = 299

 Score =  177 bits (448), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 94/247 (38%), Positives = 141/247 (57%), Gaps = 8/247 (3%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           ++ G+++ +L K   K  D++FADPPY L  NG L   +  +V      WDK   FE  +
Sbjct: 15  LLHGDTMELLPKFEHK-FDMVFADPPYFLSNNG-LSIQNGKIVSVNKGKWDKSEGFEFIN 72

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            F R WL   R  +K + T+W+ G+ HNIF +G +L  L F ILN + W K+NP PNF  
Sbjct: 73  DFNRKWLSLVREKMKGDATIWISGTMHNIFSVGQILTELGFKILNIVTWEKTNPPPNFSC 132

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           R F  + E +IWA  + K   Y FNY  +K  N + QM+  W +P  +  E+   K    
Sbjct: 133 RYFTYSTEQIIWARKTEKVPHY-FNYKLMKQLNGNRQMKDVWKLPAIAPWEKSCGK---- 187

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKP ++L+R++++STKP   ILDP  GS T+G  A    R F+GI+ +++++ I+ 
Sbjct: 188 -HPTQKPLSVLTRLILASTKPNAWILDPLAGSSTTGIAANLANRRFLGIDQEEEFLTISK 246

Query: 263 KRIASVQ 269
            R   ++
Sbjct: 247 NRKLEIE 253


>gi|210135511|ref|YP_002301950.1| hypothetical protein HPP12_1318 [Helicobacter pylori P12]
 gi|210133479|gb|ACJ08470.1| hypothetical protein HPP12_1318 [Helicobacter pylori P12]
          Length = 159

 Score =  177 bits (448), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 98/140 (70%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II+G+ +  L+  P +SVD IFADPPY +Q  G+L R + +    V D WDKF SFE YD
Sbjct: 11  IIEGDCLEKLKDFPNRSVDFIFADPPYFMQTEGELKRFEGTKFQGVEDHWDKFGSFEEYD 70

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            F   WL  C+R+LK NG++ VIGS+ NIFRIG  LQNL FWILNDI+W KSNP+PNF G
Sbjct: 71  TFCLGWLKECQRILKDNGSICVIGSFQNIFRIGFHLQNLGFWILNDIIWHKSNPVPNFAG 130

Query: 143 RRFQNAHETLIWASPSPKAK 162
           +R  NAHETLIW +   K K
Sbjct: 131 KRLCNAHETLIWCAKKIKEK 150


>gi|282878857|ref|ZP_06287624.1| DNA (cytosine-5-)-methyltransferase [Prevotella buccalis ATCC
           35310]
 gi|281299065|gb|EFA91467.1| DNA (cytosine-5-)-methyltransferase [Prevotella buccalis ATCC
           35310]
          Length = 295

 Score =  176 bits (445), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 99/242 (40%), Positives = 136/242 (56%), Gaps = 8/242 (3%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           +I+G+ +  L K      D++FADPPY L   G  Y+    +V      WDK  + E  D
Sbjct: 18  LIQGDCVETLSKFKF-GFDMVFADPPYFLSGGGISYQ-SGKVVCVDKGDWDKPVTSEELD 75

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
           AF   WL A R  +K N T+W+ G++HNIF +   L  L F ILN I W K+NP PN   
Sbjct: 76  AFNLRWLTAVREHMKDNATIWISGTHHNIFSVQQQLLKLGFKILNIITWAKTNPPPNISC 135

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           R F  + E +IWA  SPK   Y FNY  +K  N D QM   W +P     E+   K    
Sbjct: 136 RYFTFSTEFIIWARKSPKVPHY-FNYALMKKLNGDKQMTDVWQLPSIGKWEKSCGK---- 190

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKP  +L+RI+ +S++P   ILDPF GSGT+G  A  L R+++G+E  +D++ ++ 
Sbjct: 191 -HPTQKPLGVLARIIQASSEPNSWILDPFSGSGTTGIAANLLGRNYLGLEKDKDFLLMSK 249

Query: 263 KR 264
           KR
Sbjct: 250 KR 251


>gi|315224178|ref|ZP_07866018.1| DNA (cytosine-5-)-methyltransferase [Capnocytophaga ochracea F0287]
 gi|314945911|gb|EFS97920.1| DNA (cytosine-5-)-methyltransferase [Capnocytophaga ochracea F0287]
          Length = 265

 Score =  176 bits (445), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 97/256 (37%), Positives = 145/256 (56%), Gaps = 11/256 (4%)

Query: 17  FEWKDK---IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWD 73
           F+ +DK   ++ G+++ +L +   K  D++FADPPY L  NG L   +  +V      WD
Sbjct: 6   FKSQDKSFYLLHGDTMELLPQFHRK-FDMVFADPPYFLS-NGGLTVNNGEIVSVNKGDWD 63

Query: 74  KFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRK 133
           K       + F R WL   R V+K   T+W+ G+ HNIF IG +L  L   ILN I W K
Sbjct: 64  KSKGIAFVNDFNRQWLTLVREVMKEEATIWISGTMHNIFSIGQILTELGLKILNIITWEK 123

Query: 134 SNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSE 193
           +NP PNF  R F ++ E +IWA    K   Y FNY+ +K  N + QM+  W  P  +  E
Sbjct: 124 TNPPPNFSCRYFTHSTEQIIWARKEEKTPHY-FNYELMKELNGNKQMKDVWRFPAIAPWE 182

Query: 194 RLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEM 253
           +   K     HPTQKP ++L+R++++STKP   ILDPF GS T+G  A    R F+GI+ 
Sbjct: 183 KSCGK-----HPTQKPLSVLTRLILASTKPDAWILDPFTGSSTTGIAANLQGRKFVGIDR 237

Query: 254 KQDYIDIATKRIASVQ 269
           ++D+++++  R   ++
Sbjct: 238 EKDFLELSKLRKLEIE 253


>gi|154148672|ref|YP_001406783.1| DNA methylase [Campylobacter hominis ATCC BAA-381]
 gi|153804681|gb|ABS51688.1| DNA methylase [Campylobacter hominis ATCC BAA-381]
          Length = 271

 Score =  174 bits (442), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 98/239 (41%), Positives = 137/239 (57%), Gaps = 8/239 (3%)

Query: 26  GNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFT 85
           G++  +L K  +K  DLIFADPPY L  +G L      +V     +WDK    +  D F 
Sbjct: 16  GDTFEILPKFKSK-FDLIFADPPYFLSNDG-LSIQSGRIVSVNKGNWDKSYGIDEIDKFN 73

Query: 86  RAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRF 145
             WL   +  L  NG++ + G+YHNIF IG  LQ L+F ILN I W+K+NP PNF  R  
Sbjct: 74  LEWLEMAKNALNDNGSVMISGTYHNIFSIGRALQKLDFKILNIITWQKTNPPPNFSCRYL 133

Query: 146 QNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHP 205
            ++ E +IWA  S K K + FNY+ +K  N++ QM+  W  P  +  E+   K     HP
Sbjct: 134 THSTEQIIWARKSEKHK-HIFNYELMKKINDNKQMKDVWAFPAIAPWEKSCGK-----HP 187

Query: 206 TQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKR 264
           TQKP  LL R+++ ++     I DPF GS T+G  A  L R+FIGIE ++++IDI+  R
Sbjct: 188 TQKPLRLLVRLILMASYENSTICDPFSGSSTTGIAANLLGRNFIGIEKEKEFIDISLAR 246


>gi|68480349|gb|AAY97905.1| Mva1269I methyltransferase [Kocuria varians]
          Length = 626

 Score =  173 bits (439), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 99/269 (36%), Positives = 144/269 (53%), Gaps = 27/269 (10%)

Query: 20  KDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSS-- 77
           K++I   + I  ++ L   S+D+I ADPPYNL   G     +   +      WDK     
Sbjct: 4   KNEIYNMDCIEGMKLLKENSIDIIIADPPYNLSKGGNWSWKNEDNLKGFGGKWDKVMQNW 63

Query: 78  ----FEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRK 133
                  Y  FT  WL   +R+LKP G+LWV G+YHNI  I   +Q L   ++N+++W K
Sbjct: 64  DNMPISDYFTFTLKWLSEAKRILKPTGSLWVFGTYHNIGIINFAMQILEIEMINEVIWFK 123

Query: 134 SNPMPNFRGRRFQNAHETLIWA-SPSPKAKGYTFNYDALKAANEDV--------QMRSDW 184
            N  PN  GRR   +HET+IWA S + K + Y FNY+  K  + D         QMR+ W
Sbjct: 124 RNSFPNLSGRRLTASHETIIWAHSGTAKDREYFFNYEMSKNHDYDSDLIKQPLKQMRTVW 183

Query: 185 LIPICSGSERLRNKDGEKL----HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAV 240
            IP         NK  E+L    HPTQK E ++ R++  S K GD++L PF G+GT   V
Sbjct: 184 DIP--------NNKKKEELLYGKHPTQKVEKVIDRMIRISAKEGDLLLSPFCGAGTECVV 235

Query: 241 AKKLRRSFIGIEMKQDYIDIATKRIASVQ 269
           AKKL   +I  E++++Y++++  R+ + Q
Sbjct: 236 AKKLGLDYIAFELEEEYVNLSKTRLLNTQ 264


>gi|237753354|ref|ZP_04583834.1| DNA methylase [Helicobacter winghamensis ATCC BAA-430]
 gi|229375621|gb|EEO25712.1| DNA methylase [Helicobacter winghamensis ATCC BAA-430]
          Length = 284

 Score =  172 bits (435), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 102/245 (41%), Positives = 141/245 (57%), Gaps = 8/245 (3%)

Query: 20  KDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFE 79
           K  + +G+  ++L ++  +S D+IFADPPY L  NG L      +V      WD+  + +
Sbjct: 18  KFSLYQGDCNALLPQM-KESFDVIFADPPYFLS-NGGLSIQSGKIVSVNKGEWDRGENID 75

Query: 80  AYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPN 139
             D F   W+   +  LKP G++ + G+YHNIF +G  LQ L+F ILN I W+K+NP PN
Sbjct: 76  EIDRFNTEWIANAKIALKPTGSIMISGTYHNIFSLGRALQKLDFKILNIITWQKTNPPPN 135

Query: 140 FRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKD 199
           F  R   ++ E +IWA  S K K + FNY+ LK  N D QMR  W  P  +  E+   K 
Sbjct: 136 FSCRYLTHSTEQIIWARKSHKHK-HIFNYEILKKLNNDKQMRDVWSFPAIAPWEKTFGK- 193

Query: 200 GEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYID 259
               HPTQKP ALL R+L+ ++    II DPF GS T+G  A  L R FIGIE +  +ID
Sbjct: 194 ----HPTQKPLALLVRLLLMASNEDSIICDPFSGSSTTGIAANLLHRQFIGIERESSFID 249

Query: 260 IATKR 264
           ++ KR
Sbjct: 250 LSIKR 254


>gi|322378612|ref|ZP_08053050.1| type I restriction enzyme M protein (hsdM) [Helicobacter suis HS1]
 gi|322380096|ref|ZP_08054350.1| type I restriction enzyme M [Helicobacter suis HS5]
 gi|321147466|gb|EFX42112.1| type I restriction enzyme M [Helicobacter suis HS5]
 gi|321148972|gb|EFX43434.1| type I restriction enzyme M protein (hsdM) [Helicobacter suis HS1]
          Length = 274

 Score =  171 bits (433), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 100/259 (38%), Positives = 143/259 (55%), Gaps = 11/259 (4%)

Query: 9   INENQNSIF---EWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLV 65
           +N     IF   ++K  +   +   +L  +P +  DLIFADPPY L  NG L      +V
Sbjct: 1   MNSKPKPIFVSEDFKFTLYHNDCKEILAHMP-ECFDLIFADPPYFLSNNG-LTIESGQIV 58

Query: 66  DAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWI 125
                SWD+    +   AF   WL   +  LKP+G++ +  + HN+F +G  LQ L F +
Sbjct: 59  SVNKGSWDRLEGIDQIHAFNLEWLRLAKEALKPSGSILISATQHNLFSLGLALQTLGFKL 118

Query: 126 LNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWL 185
           LN I W KSNP PNF  R   +A E ++WA  SPK   + FNY+ +KA N+  QMR  W 
Sbjct: 119 LNTITWHKSNPPPNFSCRTLVHASEQILWARKSPK-HAHIFNYERMKALNQGKQMRDVWT 177

Query: 186 IPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLR 245
           +P  +  E+   K     HPTQKP  LL R+L+ ++    +I DPF GS ++G  A  L 
Sbjct: 178 LPSIASFEKKCGK-----HPTQKPLNLLLRLLLMASNKESLIGDPFSGSSSTGIAANLLG 232

Query: 246 RSFIGIEMKQDYIDIATKR 264
           RSF+G+E +QD+I ++ KR
Sbjct: 233 RSFVGMEKEQDFIKLSIKR 251


>gi|317008767|gb|ADU79347.1| type II restriction enzyme M protein (hsdM) [Helicobacter pylori
           India7]
          Length = 277

 Score =  171 bits (433), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 105/258 (40%), Positives = 145/258 (56%), Gaps = 11/258 (4%)

Query: 10  NENQNSIFEWKDKII---KGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVD 66
           NE    IF+ +D++    +G+   VL +      DLIFADPPY L  +G L      +V 
Sbjct: 7   NETARPIFKSQDQLFTLYQGDCNEVLPQF-ENQFDLIFADPPYFLSNDG-LSIQSGKIVS 64

Query: 67  AVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWIL 126
                WDK       D F   W+   ++ LK  G+L + G+YHNIF +G +LQ L+F IL
Sbjct: 65  VNKGDWDKEDGINGIDEFNYQWINNAKKALKNTGSLLISGTYHNIFSLGCILQKLDFKIL 124

Query: 127 NDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLI 186
           N I W+K+NP PNF  R   ++ E +IWA  S K K + FNY+ LK  N+D QMR  W  
Sbjct: 125 NLITWQKTNPPPNFSCRYLTHSAEQIIWARKSRKHK-HVFNYEVLKKINKDKQMRDVWSF 183

Query: 187 PICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRR 246
           P  +  E++  K     HPTQKP ALL R+L+ ++    +I DPF GS T+G  A  L+R
Sbjct: 184 PAIAPWEKVNGK-----HPTQKPLALLVRLLLMASDKNSLIGDPFSGSSTTGIAANLLKR 238

Query: 247 SFIGIEMKQDYIDIATKR 264
            FIGIE + ++I I+  R
Sbjct: 239 QFIGIEKESEFIKISINR 256


>gi|153951969|ref|YP_001398881.1| DNA methylase [Campylobacter jejuni subsp. doylei 269.97]
 gi|152939415|gb|ABS44156.1| DNA methylase [Campylobacter jejuni subsp. doylei 269.97]
          Length = 282

 Score =  170 bits (431), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 100/251 (39%), Positives = 140/251 (55%), Gaps = 9/251 (3%)

Query: 16  IFEWKDK--IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWD 73
           IF  KD+  I+  N  + L     K  DLIFADPPY L  +G L   +  +V      WD
Sbjct: 8   IFTSKDENFILYQNDCNKLLPKFEKQFDLIFADPPYFLSNDG-LSIQNGKIVSVNKGDWD 66

Query: 74  KFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRK 133
           K +  E  D F   WL   +  L+  G++ + G+YHNIF +G +LQ L+F ILN I W+K
Sbjct: 67  KGNDIEKIDEFNLKWLSNAKIALQDTGSILICGTYHNIFSLGRILQKLDFKILNIITWQK 126

Query: 134 SNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSE 193
           +NP PNF  R   ++ E +IWA  S K K + FNY+ L+  N + QMR  W     +  E
Sbjct: 127 TNPPPNFSCRYLTHSTEQIIWARKSHKYK-HIFNYEILRFLNSNKQMRDVWTFNAIAPWE 185

Query: 194 RLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEM 253
           +   K     HPTQKP ALL+R+++ ++    +I DPF GS T+G  A  L R FIG E 
Sbjct: 186 KTNGK-----HPTQKPLALLTRLILMASNEDCLICDPFSGSSTTGIGANLLNRKFIGFEK 240

Query: 254 KQDYIDIATKR 264
           + ++I+I+  R
Sbjct: 241 ESEFIEISIAR 251


>gi|281422930|ref|ZP_06253929.1| modification methylase CcrMI [Prevotella copri DSM 18205]
 gi|281403022|gb|EFB33702.1| modification methylase CcrMI [Prevotella copri DSM 18205]
          Length = 394

 Score =  170 bits (430), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 99/247 (40%), Positives = 140/247 (56%), Gaps = 8/247 (3%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           +  G+S  +L++L  K VD+IFADPPY L  + +  +   + V    D WDK  S+E  +
Sbjct: 13  LYHGDSNIILDQLEEK-VDMIFADPPYFLSNSKKTIQFGKTKVCDKGD-WDKVRSWEEIN 70

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
           +F R W+  CR++LK NGT+WV G+YHNIF +   L    F ILN IVW+K +P P   G
Sbjct: 71  SFNRIWIEKCRKLLKENGTIWVCGTYHNIFSVEQCLIEFGFKILNIIVWQKLDPPPTPYG 130

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
            R   + E ++WA  +     + F+YD LK  N   +M   W        ER   K    
Sbjct: 131 GRLNFSAEYIVWARKNTNVP-HCFHYDLLKQMNGGKEMPDVWKFARPGFWERKCGK---- 185

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKP  LL RI+ + T+   IILDPF GS T+G  A  L R FIGI+M+++Y+D   
Sbjct: 186 -HPTQKPLRLLYRIVQTCTEKEGIILDPFCGSCTTGIAANLLSRKFIGIDMERNYLDYGI 244

Query: 263 KRIASVQ 269
           +R + ++
Sbjct: 245 RRKSEIK 251


>gi|109948003|ref|YP_665231.1| DNA methyltransferase [Helicobacter acinonychis str. Sheeba]
 gi|109715224|emb|CAK00232.1| DNA methyltransferase [Helicobacter acinonychis str. Sheeba]
          Length = 278

 Score =  170 bits (430), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 105/258 (40%), Positives = 146/258 (56%), Gaps = 11/258 (4%)

Query: 10  NENQNSIFEWKDKII---KGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVD 66
           N+  +S+FE  DK+    +G+   VL  L   + DLIFADPPY L  +G L      +V 
Sbjct: 5   NQTPHSVFESTDKLFTLYQGDCNEVLS-LFENTFDLIFADPPYFLSNDG-LSIQSGKIVS 62

Query: 67  AVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWIL 126
                WDK       D F   W+ + ++ LK  G+L + G+YHN+F +G +LQ L+F IL
Sbjct: 63  VNKGDWDKEERINDIDEFNYQWINSAKKALKNTGSLLISGTYHNLFSLGRILQKLDFKIL 122

Query: 127 NDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLI 186
           N I W+K+NP PNF  R   ++ E +IWA  S K K + FNY+ LK  N D QMR  W  
Sbjct: 123 NLITWQKTNPPPNFSCRYLTHSAEQIIWARKSHKHK-HVFNYEVLKKINSDKQMRDVWSF 181

Query: 187 PICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRR 246
           P  +  E+   K     HPTQKP ALL R+L+ ++    +I DPF GS T+G  A  L+R
Sbjct: 182 PAIAPWEKTNGK-----HPTQKPLALLVRLLLMASNENSLIGDPFSGSSTTGIAANLLKR 236

Query: 247 SFIGIEMKQDYIDIATKR 264
            FIGIE + ++I ++  R
Sbjct: 237 KFIGIEKESEFIKMSINR 254


>gi|317179900|dbj|BAJ57686.1| Type II restriction enzyme M protein [Helicobacter pylori F32]
          Length = 277

 Score =  170 bits (430), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 106/258 (41%), Positives = 145/258 (56%), Gaps = 11/258 (4%)

Query: 10  NENQNSIFEWKDKII---KGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVD 66
           NE    IF+ +D++    +G+   VL +      DLIFADPPY L  +G L      +V 
Sbjct: 7   NEIARPIFKSQDQLFTLYQGDCNEVLPQF-ENQFDLIFADPPYFLSNDG-LSIQSGKIVS 64

Query: 67  AVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWIL 126
                WDK  S    D F   W+   ++ LK  G+L + G+YHNIF +G +LQ L+F IL
Sbjct: 65  VNKGDWDKEESVNDIDEFNYQWINNAKKALKNTGSLLISGTYHNIFSLGRVLQKLDFKIL 124

Query: 127 NDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLI 186
           N I W+K+NP PNF  R   ++ E +IWA  S K K + FNY+ LK  N D QMR  W  
Sbjct: 125 NLITWQKTNPPPNFSCRYLTHSAEQIIWARKSHKHK-HVFNYEVLKKINNDKQMRDVWSF 183

Query: 187 PICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRR 246
           P  +  E++  K     HPTQKP ALL R+L+ ++    +I DPF GS T+G  A  L+R
Sbjct: 184 PAIAPWEKVNGK-----HPTQKPLALLVRLLLMASDENSLIGDPFSGSSTTGIAANLLKR 238

Query: 247 SFIGIEMKQDYIDIATKR 264
            FIGIE + ++I I+  R
Sbjct: 239 QFIGIEKESEFIQISMDR 256


>gi|330995399|ref|ZP_08319309.1| DNA (cytosine-5-)-methyltransferase [Paraprevotella xylaniphila YIT
           11841]
 gi|329575894|gb|EGG57418.1| DNA (cytosine-5-)-methyltransferase [Paraprevotella xylaniphila YIT
           11841]
          Length = 289

 Score =  169 bits (429), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 98/251 (39%), Positives = 133/251 (52%), Gaps = 8/251 (3%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           +  G+   +L+    K  D+IFADPPY L  NG +      +V      WDK  S E   
Sbjct: 15  LAHGDCFKLLKDFDFK-FDMIFADPPYFLS-NGGISLQRGKVVCVDKGDWDKGKSQEDML 72

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
           AF   WL  CR  LK NGT+W+ G+YHNIF +   L  L + ILN + W+K+NP  N   
Sbjct: 73  AFNMEWLRLCRDKLKDNGTIWISGTYHNIFSVANCLTELGYKILNVVTWQKTNPPANISC 132

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEK 202
           R F  + E +IWA    K   + FNYD +K  N+  QM   W +P     E+   K    
Sbjct: 133 RFFTYSTEFVIWARKMQKIP-HKFNYDLMKELNDGKQMTDVWRMPAIGRWEKTCGK---- 187

Query: 203 LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIAT 262
            HPTQKP  LL R++++ST  GD ILDPF GS T+G  A    R F G+E ++D+  ++ 
Sbjct: 188 -HPTQKPLRLLVRMILASTNQGDWILDPFSGSSTTGIAANLCGRRFAGLEQEEDFCKLSK 246

Query: 263 KRIASVQPLGN 273
            R   ++ L N
Sbjct: 247 ARREEIESLEN 257


>gi|260577363|ref|ZP_05845334.1| DNA methylase N-4/N-6 domain protein [Rhodobacter sp. SW2]
 gi|259020436|gb|EEW23761.1| DNA methylase N-4/N-6 domain protein [Rhodobacter sp. SW2]
          Length = 310

 Score =  169 bits (429), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 95/259 (36%), Positives = 140/259 (54%), Gaps = 20/259 (7%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFS----- 76
           ++  GN I ++ +LP +SVD+I ADPPYN     +L    +  +     SW K +     
Sbjct: 54  RVYHGNFIEMVSQLPDQSVDIIIADPPYNASKGNELTM-QYGTLPGFGGSWRKIAQVWDD 112

Query: 77  -SFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSN 135
            S   Y AFT +WL   RRVLKP G++WV G+YH+       +Q L   I+N+IVW K N
Sbjct: 113 MSLHDYLAFTLSWLTEARRVLKPTGSMWVHGTYHSAGVTNVAMQMLEVEIINEIVWYKRN 172

Query: 136 PMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALK---AANEDV-----QMRSDWLIP 187
             PN  GRR   +HET++WA    K + Y FNY+  K    +++D+     QMR+ W +P
Sbjct: 173 SFPNLAGRRLTASHETILWAHRGGK-RAYRFNYEHSKFGDFSDDDLKSPGKQMRTVWDLP 231

Query: 188 ICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRS 247
               + + R++     HP QKP  L  R +  S  PGD+ L PF GSG+    A++    
Sbjct: 232 ----NNKPRHEQAHGKHPAQKPVRLAKRFIELSAGPGDLCLVPFAGSGSECVAAQEAGLH 287

Query: 248 FIGIEMKQDYIDIATKRIA 266
           FIG +  + Y++IA  R++
Sbjct: 288 FIGFDTDESYVEIARARLS 306


>gi|254778814|ref|YP_003056919.1| M.HpyAIII, type II adenine methyltransferase [Helicobacter pylori
           B38]
 gi|254000725|emb|CAX28645.1| M.HpyAIII, type II adenine methyltransferase [Helicobacter pylori
           B38]
          Length = 277

 Score =  169 bits (429), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 105/258 (40%), Positives = 146/258 (56%), Gaps = 11/258 (4%)

Query: 10  NENQNSIFEWKDKII---KGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVD 66
           NE    IF+ +D++    +G+   VL +    + DLIFADPPY L  +G L      +V 
Sbjct: 7   NEIARPIFKSQDQLFTLYQGDCNEVLPQF-ENAFDLIFADPPYFLSNDG-LSIQSGKIVS 64

Query: 67  AVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWIL 126
                WDK +     D F   W+   ++ LK  G+L + G+YHNIF +G +LQ L+F IL
Sbjct: 65  VNKGDWDKENGINGIDEFNYQWINNAKKALKNTGSLLISGTYHNIFSLGRILQKLDFKIL 124

Query: 127 NDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLI 186
           N I W+K+NP PNF  R   ++ E +IWA  S K K + FNY+ LK  N D QMR  W  
Sbjct: 125 NLITWQKTNPPPNFSCRYLTHSAEQIIWARKSHKHK-HVFNYEVLKKINNDKQMRDVWSF 183

Query: 187 PICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRR 246
           P  +  E++  K     HPTQKP ALL R+L+ ++    +I DPF GS T+G  A  L+R
Sbjct: 184 PAITPWEKVNGK-----HPTQKPLALLVRLLLMASDGNSLIGDPFSGSSTTGIAANLLKR 238

Query: 247 SFIGIEMKQDYIDIATKR 264
            FIGIE + ++I I+  R
Sbjct: 239 EFIGIEKESEFIKISMNR 256


>gi|15644722|ref|NP_206892.1| type II restriction enzyme M protein (hsdM) [Helicobacter pylori
           26695]
 gi|2313175|gb|AAD07163.1| type II restriction enzyme M protein (hsdM) [Helicobacter pylori
           26695]
          Length = 277

 Score =  169 bits (429), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 105/258 (40%), Positives = 144/258 (55%), Gaps = 11/258 (4%)

Query: 10  NENQNSIFEWKDKII---KGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVD 66
           NE    IF+ +D++    +G+   VL +      DLIFADPPY L  +G L      +V 
Sbjct: 7   NEIARPIFKSQDQLFTLYQGDCNEVLPQF-ENQFDLIFADPPYFLSNDG-LSIQSGKIVS 64

Query: 67  AVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWIL 126
                WDK       D F   W+   ++ LK  G+L + G+YHNIF +G +LQ L+F IL
Sbjct: 65  VNKGDWDKEDGINGIDEFNYQWINNAKKALKDTGSLLISGTYHNIFSLGCVLQKLDFKIL 124

Query: 127 NDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLI 186
           N I W+K+NP PNF  R   ++ E +IWA  S K K + FNY+ LK  N D QMR  W  
Sbjct: 125 NLITWQKTNPPPNFSCRYLTHSAEQIIWARKSRKHK-HVFNYEVLKKINNDKQMRDVWSF 183

Query: 187 PICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRR 246
           P  +  E++  K     HPTQKP ALL R+L+ ++    +I DPF GS T+G  A  L+R
Sbjct: 184 PAIAPWEKVNGK-----HPTQKPLALLVRLLLMASDENSLIGDPFSGSSTTGIAANLLKR 238

Query: 247 SFIGIEMKQDYIDIATKR 264
            FIGIE + ++I I+  R
Sbjct: 239 EFIGIEKESEFIKISMDR 256


>gi|308061386|gb|ADO03274.1| type II restriction enzyme M protein (hsdM) [Helicobacter pylori
           Cuz20]
          Length = 276

 Score =  169 bits (427), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 105/258 (40%), Positives = 144/258 (55%), Gaps = 11/258 (4%)

Query: 10  NENQNSIFEWKDKII---KGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVD 66
           NE    IF+ +D++    +G+   VL +      DLIFADPPY L  +G L      +V 
Sbjct: 7   NEIARPIFKSQDQLFTLYQGDCNEVLPQF-ENQFDLIFADPPYFLSNDG-LSIQSGKIVS 64

Query: 67  AVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWIL 126
                WDK  S    D F   W+   ++ LK  G+L + G+YHNIF +G +LQ L+F IL
Sbjct: 65  VNKGDWDKEESVNDIDGFNYQWINNAKKALKNTGSLLISGTYHNIFSLGRILQKLDFKIL 124

Query: 127 NDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLI 186
           N I W+K+NP PNF  R   ++ E +IWA  S K K + FNY+ LK  N D QMR  W  
Sbjct: 125 NLITWQKTNPPPNFSCRYLTHSAEQIIWARKSHKHK-HVFNYEVLKKINNDKQMRDVWSF 183

Query: 187 PICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRR 246
           P  +  E++  K     HPTQKP ALL R+L+ ++    +I DPF GS T+G  A  L R
Sbjct: 184 PAIAPWEKVNGK-----HPTQKPLALLVRLLLMASDENSLIGDPFSGSSTTGIAANLLER 238

Query: 247 SFIGIEMKQDYIDIATKR 264
            FIGIE + +++ I+  R
Sbjct: 239 QFIGIEKESEFVKISMDR 256


>gi|317176913|dbj|BAJ54702.1| Type II restriction enzyme M protein [Helicobacter pylori F16]
          Length = 276

 Score =  168 bits (426), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 105/258 (40%), Positives = 145/258 (56%), Gaps = 11/258 (4%)

Query: 10  NENQNSIFEWKDKII---KGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVD 66
           NE    IF+ +D++    +G+   VL +      DLIFADPPY L  +G L   +  +V 
Sbjct: 7   NEIACPIFKSQDQLFTLYQGDCNEVLPQF-ENQFDLIFADPPYFLSNDG-LSIQNGKIVS 64

Query: 67  AVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWIL 126
                WDK  S    D F   W+   ++ LK  G+L + G+YHNIF +G +LQ L+F IL
Sbjct: 65  VNKGDWDKEESVNDIDEFNYQWINNAKKALKNTGSLLISGTYHNIFSLGRILQKLDFKIL 124

Query: 127 NDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLI 186
           N I W+K+NP PNF  R   ++ E +IWA  S K K + FNY+ LK  N D QMR  W  
Sbjct: 125 NLITWQKTNPPPNFSCRYLTHSAEQIIWARKSRKHK-HVFNYEVLKKINNDKQMRDVWSF 183

Query: 187 PICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRR 246
           P  +  E+   K     HPTQKP ALL R+L+ ++    +I DPF GS T+G  A  L+R
Sbjct: 184 PAIAPWEKTNGK-----HPTQKPLALLVRLLLMASDENSLIGDPFSGSSTTGIAANLLKR 238

Query: 247 SFIGIEMKQDYIDIATKR 264
            FIGIE + +++ I+  R
Sbjct: 239 QFIGIEKESEFVKISMDR 256


>gi|33337323|gb|AAQ13329.1| HpyIIIM protein [Helicobacter pylori]
          Length = 277

 Score =  168 bits (425), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 104/258 (40%), Positives = 145/258 (56%), Gaps = 11/258 (4%)

Query: 10  NENQNSIFEWKDKII---KGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVD 66
           NE    IF+ +D++    +G+   VL +      DLIFADPPY L  +G L      +V 
Sbjct: 7   NEIARPIFKSQDQLFTLYQGDCNEVLPQF-ENQFDLIFADPPYFLSNDG-LSIQSGKIVS 64

Query: 67  AVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWIL 126
                WDK    +  D F   W+   ++ LK  G+L + G+YHNIF +G +LQ L+F IL
Sbjct: 65  VNKGDWDKEDGIDDIDEFNYQWINNAKKALKNTGSLLISGTYHNIFSLGRILQKLDFKIL 124

Query: 127 NDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLI 186
           N I W+K+NP PNF  R   ++ E +IWA  S K K + FNY+ LK  N D QMR  W  
Sbjct: 125 NLITWQKTNPPPNFSCRYLTHSAEQIIWARKSHKHK-HVFNYEVLKKINNDKQMRDVWSF 183

Query: 187 PICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRR 246
           P  +  E++  K     HPTQKP ALL R+L+ ++    +I DPF GS T+G  A  L++
Sbjct: 184 PAIAPWEKVNGK-----HPTQKPLALLVRLLLMASDENSLIGDPFSGSSTTGIAANLLKK 238

Query: 247 SFIGIEMKQDYIDIATKR 264
            FIGIE + ++I I+  R
Sbjct: 239 QFIGIEKESEFIQISMNR 256


>gi|297379313|gb|ADI34200.1| Modification methylase [Helicobacter pylori v225d]
          Length = 277

 Score =  168 bits (425), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 105/258 (40%), Positives = 144/258 (55%), Gaps = 11/258 (4%)

Query: 10  NENQNSIFEWKDKII---KGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVD 66
           NE    IF+ +D++    +G+   VL +      DLIFADPPY L  +G L      +V 
Sbjct: 7   NEIARPIFKSQDQLFTLYQGDCNEVLPQF-ENQFDLIFADPPYFLSNDG-LSIQSGKIVS 64

Query: 67  AVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWIL 126
                WDK  S    D F   W+   ++ LK  G+L + G+YHNIF +G +LQ L+F IL
Sbjct: 65  VNKGDWDKEESVNDIDEFNYQWINNAKKALKNTGSLLISGTYHNIFSLGRILQKLDFKIL 124

Query: 127 NDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLI 186
           N I W+K+NP PNF  R   ++ E +IWA  S K K + FNY+ LK  N D QMR  W  
Sbjct: 125 NLITWQKTNPPPNFSCRYLTHSAEQIIWARKSHKHK-HVFNYEVLKKINNDKQMRDVWSF 183

Query: 187 PICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRR 246
           P  +  E+   K     HPTQKP ALL R+L+ ++    +I DPF GS T+G  A  L+R
Sbjct: 184 PAIAPWEKTNGK-----HPTQKPLALLVRLLLMASDENSLIGDPFSGSSTTGIAANLLKR 238

Query: 247 SFIGIEMKQDYIDIATKR 264
            FIGIE + +++ I+  R
Sbjct: 239 QFIGIEKESEFVKISIDR 256


>gi|208434055|ref|YP_002265721.1| typeII adenine methyltransferase [Helicobacter pylori G27]
 gi|208431984|gb|ACI26855.1| typeII adenine methyltransferase [Helicobacter pylori G27]
          Length = 277

 Score =  168 bits (425), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 105/258 (40%), Positives = 145/258 (56%), Gaps = 11/258 (4%)

Query: 10  NENQNSIFEWKDKII---KGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVD 66
           NE    IF+  D++    +G+   VL +    + DLIFADPPY L  +G L      +V 
Sbjct: 7   NEIARPIFKSADELFTLYQGDCNEVLPQF-ENAFDLIFADPPYFLSNDG-LSIQSGKIVS 64

Query: 67  AVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWIL 126
                WDK +     D F   W+   ++ LK  G+L + G+YHNIF +G +LQ L+F IL
Sbjct: 65  VNKGDWDKENGINDIDEFNYQWINNAKKALKNTGSLLISGTYHNIFSLGRLLQKLDFKIL 124

Query: 127 NDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLI 186
           N I W+K+NP PNF  R   ++ E +IWA  S K K + FNY+ LK  N D QMR  W  
Sbjct: 125 NLITWQKTNPPPNFSCRYLTHSAEQIIWARKSRKHK-HVFNYEVLKKINNDKQMRDVWSF 183

Query: 187 PICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRR 246
           P  +  E++  K     HPTQKP ALL R+L+ ++    +I DPF GS T+G  A  L+R
Sbjct: 184 PAIAPWEKVNGK-----HPTQKPLALLVRLLLMASDENSLIGDPFSGSSTTGIAANLLKR 238

Query: 247 SFIGIEMKQDYIDIATKR 264
            FIGIE + ++I I+  R
Sbjct: 239 EFIGIEKESEFIKISMDR 256


>gi|308062955|gb|ADO04842.1| type II restriction enzyme M protein (hsdM) [Helicobacter pylori
           Sat464]
          Length = 276

 Score =  167 bits (424), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 105/258 (40%), Positives = 144/258 (55%), Gaps = 11/258 (4%)

Query: 10  NENQNSIFEWKDKII---KGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVD 66
           NE    IF+ +D++    +G+   VL +      DLIFADPPY L  +G L      +V 
Sbjct: 7   NEIARPIFKSQDQLFTLYQGDCNEVLPQF-ENQFDLIFADPPYFLSNDG-LSIQSGKIVS 64

Query: 67  AVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWIL 126
                WDK  S    D F   W+   ++ LK  G+L + G+YHNIF +G +LQ L+F IL
Sbjct: 65  VNKGDWDKEESVNDIDEFNYQWINNAKKALKNTGSLLISGTYHNIFSLGRILQKLDFKIL 124

Query: 127 NDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLI 186
           N I W+K+NP PNF  R   ++ E +IWA  S K K + FNY+ LK  N D QMR  W  
Sbjct: 125 NLITWQKTNPPPNFSCRYLTHSAEQIIWARKSHKHK-HVFNYEILKKINNDKQMRDVWSF 183

Query: 187 PICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRR 246
           P  +  E+   K     HPTQKP ALL R+L+ ++    +I DPF GS T+G  A  L+R
Sbjct: 184 PAIAPWEKANGK-----HPTQKPLALLVRLLLMASDENSLIGDPFSGSSTTGIAANLLKR 238

Query: 247 SFIGIEMKQDYIDIATKR 264
            FIGIE + +++ I+  R
Sbjct: 239 EFIGIEKESEFVKISMDR 256


>gi|317179480|dbj|BAJ57268.1| Type II restriction enzyme M protein [Helicobacter pylori F30]
          Length = 276

 Score =  167 bits (424), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 105/258 (40%), Positives = 144/258 (55%), Gaps = 11/258 (4%)

Query: 10  NENQNSIFEWKDKII---KGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVD 66
           NE    IF+ +D++    +G+   VL +      DLIFADPPY L  +G L      +V 
Sbjct: 7   NEIARPIFKSQDQLFTLYQGDCNEVLPQF-ENQFDLIFADPPYFLSNDG-LSIQSGKIVS 64

Query: 67  AVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWIL 126
                WDK  S    D F   W+   ++ LK  G+L + G+YHNIF +G +LQ L+F IL
Sbjct: 65  VNKGDWDKEESVNDIDEFNYQWINNAKKALKNTGSLLISGTYHNIFSLGRVLQKLDFKIL 124

Query: 127 NDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLI 186
           N I W+K+NP PNF  R   ++ E +IWA  S K K + FNY+ LK  N D QMR  W  
Sbjct: 125 NLITWQKTNPPPNFSCRYLTHSAEQIIWARKSRKHK-HVFNYEVLKKINNDKQMRDVWSF 183

Query: 187 PICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRR 246
           P  +  E+   K     HPTQKP ALL R+L+ ++    +I DPF GS T+G  A  L+R
Sbjct: 184 PAIAPWEKTNGK-----HPTQKPLALLVRLLLMASDGNSLIGDPFSGSSTTGIAANLLKR 238

Query: 247 SFIGIEMKQDYIDIATKR 264
            FIGIE + +++ I+  R
Sbjct: 239 QFIGIEKESEFVKISMDR 256


>gi|188526898|ref|YP_001909585.1| type II restriction enzyme M protein (hsdM) [Helicobacter pylori
           Shi470]
 gi|188143138|gb|ACD47555.1| type II restriction enzyme M protein (hsdM) [Helicobacter pylori
           Shi470]
          Length = 277

 Score =  167 bits (424), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 105/258 (40%), Positives = 143/258 (55%), Gaps = 11/258 (4%)

Query: 10  NENQNSIFEWKDKII---KGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVD 66
           NE    IF+ +D++    +G+   VL +      DLIFADPPY L  +G L      +V 
Sbjct: 7   NEIARPIFKSQDQLFTLYQGDCNEVLPQF-ENQFDLIFADPPYFLSNDG-LSIQSGKIVS 64

Query: 67  AVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWIL 126
                WDK  S    D F   W+   ++ LK  G+L + G+YHNIF +G +LQ L+F IL
Sbjct: 65  VNKGDWDKEESVNDIDEFNYQWINNAKKALKNTGSLLISGTYHNIFSLGRILQKLDFKIL 124

Query: 127 NDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLI 186
           N I W+K+NP PNF  R   ++ E +IWA  S K K + FNY+ LK  N D QMR  W  
Sbjct: 125 NLITWQKTNPPPNFSCRYLTHSAEQIIWARKSHKHK-HVFNYEVLKKINNDKQMRDVWSF 183

Query: 187 PICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRR 246
           P  +  E+   K     HPTQKP ALL R+L+ ++    +I DPF GS T+G  A  L R
Sbjct: 184 PAIAPWEKANGK-----HPTQKPLALLVRLLLMASDENSLIGDPFSGSSTTGIAANLLER 238

Query: 247 SFIGIEMKQDYIDIATKR 264
            FIGIE + +++ I+  R
Sbjct: 239 QFIGIEKESEFVKISMDR 256


>gi|298736964|ref|YP_003729494.1| putative adenine-specific DNA-methyltransferase [Helicobacter
           pylori B8]
 gi|298356158|emb|CBI67030.1| putative adenine-specific DNA-methyltransferase [Helicobacter
           pylori B8]
          Length = 304

 Score =  167 bits (424), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 103/252 (40%), Positives = 142/252 (56%), Gaps = 11/252 (4%)

Query: 16  IFEWKDKII---KGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSW 72
           IF+  D++    +G+   VL +    + DLIFADPPY L  +G L      +V      W
Sbjct: 40  IFKSTDELFTLYQGDCNEVLPQF-ENAFDLIFADPPYFLSNDG-LSIQSGKIVSVNKGDW 97

Query: 73  DKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWR 132
           DK       D F   W+   ++ LK  G+L + G+YHNIF +G +LQ L+F ILN I W+
Sbjct: 98  DKEDGVNGIDEFNYQWINNAKKALKNTGSLLISGTYHNIFSLGRLLQKLDFKILNLITWQ 157

Query: 133 KSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGS 192
           K+NP PNF  R   ++ E +IWA  S K K + FNY+ LK  N D QMR  W  P  +  
Sbjct: 158 KTNPPPNFSCRYLTHSAEQIIWARKSHKHK-HVFNYEVLKKINNDKQMRDVWSFPAIAPW 216

Query: 193 ERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIE 252
           E++  K     HPTQKP ALL R+L+ ++    +I DPF GS T+G  A  L+R FIGIE
Sbjct: 217 EKVNGK-----HPTQKPLALLVRLLLMASDENSLIGDPFSGSSTTGIAANLLKRQFIGIE 271

Query: 253 MKQDYIDIATKR 264
            + ++I I+  R
Sbjct: 272 KESEFIKISINR 283


>gi|217032871|ref|ZP_03438349.1| hypothetical protein HPB128_1g8 [Helicobacter pylori B128]
 gi|216945411|gb|EEC24077.1| hypothetical protein HPB128_1g8 [Helicobacter pylori B128]
          Length = 274

 Score =  167 bits (423), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 103/252 (40%), Positives = 142/252 (56%), Gaps = 11/252 (4%)

Query: 16  IFEWKDKII---KGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSW 72
           IF+  D++    +G+   VL +    + DLIFADPPY L  +G L      +V      W
Sbjct: 10  IFKSTDELFTLYQGDCNEVLPQF-ENAFDLIFADPPYFLSNDG-LSIQSGKIVSVNKGDW 67

Query: 73  DKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWR 132
           DK       D F   W+   ++ LK  G+L + G+YHNIF +G +LQ L+F ILN I W+
Sbjct: 68  DKEDGVNGIDEFNYQWINNAKKALKNTGSLLISGTYHNIFSLGRLLQKLDFKILNLITWQ 127

Query: 133 KSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGS 192
           K+NP PNF  R   ++ E +IWA  S K K + FNY+ LK  N D QMR  W  P  +  
Sbjct: 128 KTNPPPNFSCRYLTHSAEQIIWARKSHKHK-HVFNYEVLKKINNDKQMRDVWSFPAIAPW 186

Query: 193 ERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIE 252
           E++  K     HPTQKP ALL R+L+ ++    +I DPF GS T+G  A  L+R FIGIE
Sbjct: 187 EKVNGK-----HPTQKPLALLVRLLLMASDENSLIGDPFSGSSTTGIAANLLKRQFIGIE 241

Query: 253 MKQDYIDIATKR 264
            + ++I I+  R
Sbjct: 242 KESEFIKISINR 253


>gi|33337327|gb|AAQ13331.1| HpyIIIM protein [Helicobacter pylori]
          Length = 274

 Score =  167 bits (423), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 103/252 (40%), Positives = 143/252 (56%), Gaps = 11/252 (4%)

Query: 16  IFEWKDKII---KGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSW 72
           IF+ +D++    +G+   VL +      DLIFADPPY L  +G L      +V      W
Sbjct: 10  IFKSQDQLFTLYQGDCNEVLPQF-ENQFDLIFADPPYFLSNDG-LSIQSGKIVSVNKGDW 67

Query: 73  DKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWR 132
           DK  S    D F   W+   ++ LK  G+L + G+YHN+F +G +LQ L+F ILN I W+
Sbjct: 68  DKEESVNDIDEFNYQWINNAKKALKNTGSLLISGTYHNLFSLGRILQKLDFKILNLITWQ 127

Query: 133 KSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGS 192
           K+NP PNF  R   ++ E +IWA  S K K + FNY+ LK  N D QMR  W  P  +  
Sbjct: 128 KTNPPPNFSCRYLTHSAEQIIWARKSHKHK-HVFNYEVLKKINNDKQMRDVWSFPAIAPW 186

Query: 193 ERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIE 252
           E++  K     HPTQKP ALL R+L+ ++    +I DPF GS T+G  A  L+R FIGIE
Sbjct: 187 EKVNGK-----HPTQKPLALLVRLLLMASDENSLIGDPFSGSSTTGIAANLLKRQFIGIE 241

Query: 253 MKQDYIDIATKR 264
            + ++I I+  R
Sbjct: 242 KESEFIQISMDR 253


>gi|315586126|gb|ADU40507.1| site-specific DNA-methyltransferase (adenine-specific)
           [Helicobacter pylori 35A]
          Length = 276

 Score =  167 bits (422), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 105/258 (40%), Positives = 144/258 (55%), Gaps = 11/258 (4%)

Query: 10  NENQNSIFEWKDKII---KGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVD 66
           NE  + IF+ +D++    +G+   VL +      DLIFADPPY L  +G L      +V 
Sbjct: 7   NEIAHPIFKSQDQLFTLYQGDCNEVLPQF-ENQFDLIFADPPYFLSNDG-LSIQSGKIVS 64

Query: 67  AVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWIL 126
                WDK  S    D F   W+   ++ LK  G+L + G+YHNIF +G +LQ L+F IL
Sbjct: 65  VNKGDWDKEESVNDIDEFNYQWINNAKKALKNTGSLLISGTYHNIFSLGRVLQKLDFKIL 124

Query: 127 NDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLI 186
           N I W+K+NP PNF  R   ++ E +IWA  S K K + FNY+ LK  N D QM   W  
Sbjct: 125 NLITWQKTNPPPNFSCRYLTHSAEQIIWARKSRKHK-HVFNYEVLKKINNDKQMHDVWSF 183

Query: 187 PICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRR 246
           P  +  E+   K     HPTQKP ALL R+L+ ++    +I DPF GS T+G  A  L+R
Sbjct: 184 PAIAPWEKTNGK-----HPTQKPLALLVRLLLMASDGNSLIGDPFSGSSTTGIAANLLKR 238

Query: 247 SFIGIEMKQDYIDIATKR 264
            FIGIE + ++I I+  R
Sbjct: 239 QFIGIEKESEFIQISMNR 256


>gi|261838963|gb|ACX98728.1| typeII adenine methyltransferase [Helicobacter pylori 52]
          Length = 277

 Score =  166 bits (421), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 104/258 (40%), Positives = 144/258 (55%), Gaps = 11/258 (4%)

Query: 10  NENQNSIFEWKDKII---KGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVD 66
           NE    IF+ +D++    +G+   +L +      DLIFADPPY L  +G L      +V 
Sbjct: 7   NEIARPIFKSQDQLFTLYQGDCNEILPQF-ENQFDLIFADPPYFLSNDG-LSIQSGKIVS 64

Query: 67  AVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWIL 126
                WDK  S    D F   W+   ++ LK  G+L + G+YHNIF +G +LQ L+F IL
Sbjct: 65  VNKGDWDKEESVNDIDEFNYQWINNAKKALKNTGSLLISGTYHNIFSLGRILQKLDFKIL 124

Query: 127 NDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLI 186
           N I W+K+NP PNF  R   ++ E +IWA  S K K + FNY+ LK  N D QMR  W  
Sbjct: 125 NLITWQKTNPPPNFSCRYLTHSAEQIIWARKSHKHK-HVFNYEILKKINNDKQMRDVWSF 183

Query: 187 PICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRR 246
           P  +  E+   K     HPTQKP ALL R+L+ ++    +I DPF GS T+G  A  L+R
Sbjct: 184 PAIAPWEKANGK-----HPTQKPLALLVRLLLMASDGNSLIGDPFSGSSTTGIAANLLKR 238

Query: 247 SFIGIEMKQDYIDIATKR 264
            FIGIE + +++ I+  R
Sbjct: 239 QFIGIEKESEFVKISMDR 256


>gi|210134296|ref|YP_002300735.1| type II R-M system methyltransferase [Helicobacter pylori P12]
 gi|210132264|gb|ACJ07255.1| type II R-M system methyltransferase [Helicobacter pylori P12]
          Length = 282

 Score =  166 bits (419), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 104/258 (40%), Positives = 144/258 (55%), Gaps = 11/258 (4%)

Query: 10  NENQNSIFEWKDKII---KGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVD 66
           NE  + IF+  D++    +G+   VL +    + DLIFADPPY L  +G L      +V 
Sbjct: 7   NEIAHPIFKSTDELFTLYQGDCNEVLSQF-ENAFDLIFADPPYFLSNDG-LSIQSGKIVS 64

Query: 67  AVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWIL 126
                WDK       D F   W+   ++ LK  G+L + G+YHNIF +G +LQ L+F IL
Sbjct: 65  VNKGDWDKEDGINGIDEFNYQWINNAKKALKNTGSLLISGTYHNIFSLGRILQKLDFKIL 124

Query: 127 NDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLI 186
           N I W+K+NP PNF  R   ++ E +IWA  S K K + FNY+ LK  N + QMR  W  
Sbjct: 125 NLITWQKTNPPPNFSCRYLTHSAEQIIWARKSRKHK-HVFNYEILKKINNNKQMRDVWSF 183

Query: 187 PICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRR 246
           P  +  E+   K     HPTQKP ALL R+L+ ++    +I DPF GS T+G  A  L+R
Sbjct: 184 PAIAPWEKANGK-----HPTQKPLALLVRLLLMASDENSLIGDPFSGSSTTGIAANLLKR 238

Query: 247 SFIGIEMKQDYIDIATKR 264
            FIGIE + ++I I+  R
Sbjct: 239 EFIGIEKESEFIKISINR 256


>gi|237749758|ref|ZP_04580238.1| DNA methylase [Helicobacter bilis ATCC 43879]
 gi|229374623|gb|EEO25014.1| DNA methylase [Helicobacter bilis ATCC 43879]
          Length = 284

 Score =  166 bits (419), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 99/245 (40%), Positives = 141/245 (57%), Gaps = 8/245 (3%)

Query: 20  KDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFE 79
           K  + +G+  ++L ++  +S D+IFADPPY L  +G L      +V      WD+  + +
Sbjct: 18  KFSLYQGDCNALLPQM-KESFDVIFADPPYFLSNDG-LSIQSGKIVSVNKGEWDRGENID 75

Query: 80  AYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPN 139
             D F   W+   +  LKP G++ + G+YHNIF +G  LQ L+F ILN I W+K+NP PN
Sbjct: 76  EIDRFNMEWIANAKIALKPTGSIMISGTYHNIFSLGRALQKLDFKILNIITWQKTNPPPN 135

Query: 140 FRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKD 199
           F  R   ++ E +IWA  S K K + FNY+ LK  N D QMR  W  P  +  E+   K 
Sbjct: 136 FSCRYLTHSTEQIIWARKSHKYK-HIFNYEILKKLNNDKQMRDVWSFPAIAPWEKTFGK- 193

Query: 200 GEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYID 259
               HPTQKP ALL R+L+ ++    II DPF GS T+G  A  L R F+GIE +  +I+
Sbjct: 194 ----HPTQKPLALLVRLLLMASNDDSIICDPFSGSSTTGIAANLLGRQFVGIERESSFIN 249

Query: 260 IATKR 264
           ++ KR
Sbjct: 250 LSIKR 254


>gi|33337333|gb|AAQ13334.1| HpyIIIM protein [Helicobacter pylori]
          Length = 268

 Score =  166 bits (419), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 103/252 (40%), Positives = 143/252 (56%), Gaps = 11/252 (4%)

Query: 16  IFEWKDKII---KGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSW 72
           IF+ +D++    +G+   VL +    + DLIFADPPY L  +G L      +V      W
Sbjct: 10  IFKSQDQLFTLYQGDCNEVLPQF-ENAFDLIFADPPYFLSNDG-LSIQSGKIVSVNKGDW 67

Query: 73  DKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWR 132
           DK +     D F   W+   ++ LK  G+L + G+YHNIF +G +LQ L+F ILN I W+
Sbjct: 68  DKENGINDIDEFNCQWINNAKKALKNTGSLLISGTYHNIFSLGRILQKLDFKILNLITWQ 127

Query: 133 KSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGS 192
           K+NP PNF  R   ++ E +IWA  S K K + FNY+ LK  N D QMR  W  P  +  
Sbjct: 128 KTNPPPNFSCRYLTHSAEQIIWARKSRKHK-HVFNYEVLKKINNDKQMRDVWSFPAIAPW 186

Query: 193 ERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIE 252
           E+   K     HPTQKP ALL R+L+ ++    +I DPF GS T+G  A  L+R FIGIE
Sbjct: 187 EKANGK-----HPTQKPLALLVRLLLMASDGNSLIGDPFSGSSTTGIAANLLKRQFIGIE 241

Query: 253 MKQDYIDIATKR 264
            + ++I I+  R
Sbjct: 242 KESEFIKISMNR 253


>gi|317011937|gb|ADU82545.1| type II adenine methyltransferase [Helicobacter pylori Lithuania75]
          Length = 273

 Score =  165 bits (418), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 102/252 (40%), Positives = 142/252 (56%), Gaps = 11/252 (4%)

Query: 16  IFEWKDKII---KGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSW 72
           IF+ +D++    +G+   VL +    + DLIFADPPY L  +G L      +V      W
Sbjct: 10  IFKSQDQLFTLYQGDCNEVLPQF-ENAFDLIFADPPYFLSNDG-LSIQSGKIVSVNKGDW 67

Query: 73  DKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWR 132
           DK       D F   W+   ++ LK  G+L + G+YHN+F +G +LQ L+F ILN I W+
Sbjct: 68  DKEDGINGIDEFNYQWINNAKKALKNTGSLLISGTYHNLFSLGRILQKLDFKILNLITWQ 127

Query: 133 KSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGS 192
           K+NP PNF  R   ++ E +IWA  S K K + FNY+ LK  N D QMR  W  P  +  
Sbjct: 128 KTNPPPNFSCRYLTHSAEQIIWARKSRKHK-HVFNYEVLKKINNDKQMRDVWSFPAIAPW 186

Query: 193 ERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIE 252
           E++  K     HPTQKP ALL R+L+ ++    +I DPF GS T+G  A  L+R FIGIE
Sbjct: 187 EKVNGK-----HPTQKPLALLVRLLLMASDENSLIGDPFSGSSTTGIAANLLKREFIGIE 241

Query: 253 MKQDYIDIATKR 264
            +  +I I+  R
Sbjct: 242 KESGFIKISMDR 253


>gi|33337325|gb|AAQ13330.1| HpyIIIM protein [Helicobacter pylori]
          Length = 276

 Score =  165 bits (417), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 104/258 (40%), Positives = 143/258 (55%), Gaps = 11/258 (4%)

Query: 10  NENQNSIFEWKDKII---KGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVD 66
           NE    IF  +D++    +G+   VL +   +  DLIFADPPY L  +G L      +V 
Sbjct: 7   NEIARPIFTSQDQLFTLYQGDCNEVLPQFENQ-FDLIFADPPYFLSNDG-LSIQSGKIVS 64

Query: 67  AVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWIL 126
                WDK  S    D F   W+   ++ LK  G+L + G+YHNIF +G +LQ L+F IL
Sbjct: 65  VNKGDWDKEESVNGIDEFNYQWISNAKKALKNTGSLLISGTYHNIFSLGRILQKLDFKIL 124

Query: 127 NDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLI 186
           N I W+K+N  PNF  R   ++ E +IWA  S K K + FNY+ LK  N D QMR  W  
Sbjct: 125 NLITWQKTNHPPNFSCRYLTHSAEQIIWARKSRKHK-HVFNYEVLKKINNDKQMRDVWSF 183

Query: 187 PICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRR 246
           P  +  E+   K     HPTQKP ALL R+L+ ++    +I DPF GS T+G  A  L+R
Sbjct: 184 PAIAPWEKANGK-----HPTQKPLALLVRLLLMASGENSLIGDPFSGSSTTGIAANLLKR 238

Query: 247 SFIGIEMKQDYIDIATKR 264
            FIGIE + +++ I+  R
Sbjct: 239 QFIGIEKESEFVKISMDR 256


>gi|108562518|ref|YP_626834.1| type II adenine methyltransferase [Helicobacter pylori HPAG1]
 gi|107836291|gb|ABF84160.1| type II adenine methyltransferase [Helicobacter pylori HPAG1]
          Length = 273

 Score =  164 bits (416), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 102/252 (40%), Positives = 142/252 (56%), Gaps = 11/252 (4%)

Query: 16  IFEWKDKII---KGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSW 72
           IF+ +D++    +G+   VL +    + DLIFADPPY L  +G L      +V      W
Sbjct: 10  IFKSQDQLFTLYQGDCNEVLPQF-ENAFDLIFADPPYFLSNDG-LSIQSGKIVSVNKGDW 67

Query: 73  DKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWR 132
           DK +     D F   W+   ++ LK  G+L + G+YHNIF +G +LQ L+F ILN I W+
Sbjct: 68  DKENGINDIDEFNYQWINNAKKALKNTGSLLISGTYHNIFSLGRLLQKLDFKILNLITWQ 127

Query: 133 KSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGS 192
           K+NP PNF  R   ++ E +IWA  S K K + FNY+ LK  N D QM   W  P  +  
Sbjct: 128 KTNPPPNFSCRYLTHSAEQIIWARKSRKHK-HVFNYEVLKKINNDKQMHDVWSFPAIAPW 186

Query: 193 ERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIE 252
           E++  K     HPTQKP ALL R+L+ ++    +I DPF GS T+G  A  L R FIGIE
Sbjct: 187 EKVNGK-----HPTQKPLALLVRLLLMASDENSLIGDPFSGSSTTGIAANLLNREFIGIE 241

Query: 253 MKQDYIDIATKR 264
            + ++I I+  R
Sbjct: 242 KESEFIKISMDR 253


>gi|317010373|gb|ADU84120.1| typeII adenine methyltransferase [Helicobacter pylori SouthAfrica7]
          Length = 284

 Score =  164 bits (416), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 103/257 (40%), Positives = 140/257 (54%), Gaps = 9/257 (3%)

Query: 10  NENQNSIFEWKDKIIKGNSISVLEKLP--AKSVDLIFADPPYNLQLNGQLYRPDHSLVDA 67
           N+    IFE  D++         E LP    + DLIFADPPY L  +G L      +V  
Sbjct: 7   NQPPRPIFESIDELFTLYQEDCNEVLPLFENAFDLIFADPPYFLSNDG-LSIQSGKIVSV 65

Query: 68  VTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILN 127
               WDK       D F   W+   ++ LK  G+L + G+YHN+F +G +LQ L+F ILN
Sbjct: 66  NKGDWDKEEGVNGIDEFNHQWINNAKKALKNTGSLLISGTYHNLFSLGRILQKLDFKILN 125

Query: 128 DIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIP 187
            I W+K+NP PNF  R   ++ E +IWA  S K K + FNY+ LK  N D QMR  W  P
Sbjct: 126 LITWQKTNPPPNFSCRYLTHSAEQIIWARKSRKHK-HVFNYEILKKINNDKQMRDVWNFP 184

Query: 188 ICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRS 247
             +  E+   K     HPTQKP ALL R+L+ ++    +I DPF GS T+G  A  L+R 
Sbjct: 185 AIAPWEKANGK-----HPTQKPLALLVRLLLMASDDNSLIGDPFSGSSTTGIAANLLKRK 239

Query: 248 FIGIEMKQDYIDIATKR 264
           FIGIE + +++ I+  R
Sbjct: 240 FIGIEKESEFVKISMNR 256


>gi|308183890|ref|YP_003928023.1| M.HpyAIII, type II adenine methyltransferase [Helicobacter pylori
           SJM180]
 gi|308059810|gb|ADO01706.1| M.HpyAIII, type II adenine methyltransferase [Helicobacter pylori
           SJM180]
          Length = 273

 Score =  164 bits (416), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 102/252 (40%), Positives = 142/252 (56%), Gaps = 11/252 (4%)

Query: 16  IFEWKDKII---KGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSW 72
           IF+ +D++    +G+   VL +    + DLIFADPPY L  +G L      +V      W
Sbjct: 10  IFKSQDQLFTLYQGDCNEVLPQF-ENAFDLIFADPPYFLSNDG-LSIQSGKIVSVNKGDW 67

Query: 73  DKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWR 132
           DK +     D F   W+   ++ LK  G+L + G+YHN+F +G +LQ L+F ILN I W+
Sbjct: 68  DKENGINDIDEFNHQWINNAKKALKNTGSLLISGTYHNLFSLGRILQKLDFKILNLITWQ 127

Query: 133 KSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGS 192
           K+NP PNF  R   ++ E +IWA  S K K + FNY+ LK  N D QMR  W  P  +  
Sbjct: 128 KTNPPPNFSCRYLTHSAEQIIWARKSFKHK-HVFNYEVLKKINNDKQMRDVWSFPAIAPW 186

Query: 193 ERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIE 252
           E+   K     HPTQKP ALL R+L+ ++    +I DPF GS T+G  A  L+R FIGIE
Sbjct: 187 EKANGK-----HPTQKPLALLVRLLLMASDENSLIGDPFSGSSTTGIAANLLKREFIGIE 241

Query: 253 MKQDYIDIATKR 264
            +  +I I+  R
Sbjct: 242 KESGFIKISMNR 253


>gi|217034170|ref|ZP_03439589.1| hypothetical protein HP9810_886g7 [Helicobacter pylori 98-10]
 gi|216943338|gb|EEC22797.1| hypothetical protein HP9810_886g7 [Helicobacter pylori 98-10]
          Length = 276

 Score =  164 bits (414), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 103/257 (40%), Positives = 141/257 (54%), Gaps = 9/257 (3%)

Query: 10  NENQNSIFEWKDKIIKGNSISVLEKLP--AKSVDLIFADPPYNLQLNGQLYRPDHSLVDA 67
           NE    IF+ +D++         E LP      DLIFADPPY L  +G L      +V  
Sbjct: 7   NEIARPIFKSQDQLFTLYQGDCNEILPQFENQFDLIFADPPYFLSNDG-LSIQSGKIVSV 65

Query: 68  VTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILN 127
               WDK  S    D F   W+   ++ LK  G+L + G+YHN+F +G +LQ L+F ILN
Sbjct: 66  NKGDWDKEESVNDIDEFNYQWINNAKKALKNTGSLLISGTYHNLFSLGRILQKLDFKILN 125

Query: 128 DIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIP 187
            I W+K+NP PNF  R   ++ E +IWA  S K K + FNY+ LK  N + QMR  W  P
Sbjct: 126 LITWQKTNPPPNFSCRYLTHSAEQIIWARKSRKHK-HVFNYEILKKINNNKQMRDVWSFP 184

Query: 188 ICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRS 247
             +  E+   K     HPTQKP ALL R+L+ ++    +I DPF GS T+G  A  L+R 
Sbjct: 185 AIAPWEKANGK-----HPTQKPLALLVRLLLMASDENSLIGDPFSGSSTTGIAANLLKRQ 239

Query: 248 FIGIEMKQDYIDIATKR 264
           FIGIE + +++ I+  R
Sbjct: 240 FIGIEKESEFVKISMDR 256


>gi|33337331|gb|AAQ13333.1| HpyIIIM protein [Helicobacter pylori]
          Length = 274

 Score =  164 bits (414), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 101/252 (40%), Positives = 143/252 (56%), Gaps = 11/252 (4%)

Query: 16  IFEWKDKII---KGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSW 72
           IF+ +D++    +G+   VL +      DLIFADPPY L  +G L   +  +V      W
Sbjct: 10  IFKSQDQLFTLYQGDCNEVLPQF-ENQFDLIFADPPYFLSNDG-LSIQNGKIVSVNKGDW 67

Query: 73  DKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWR 132
           DK  S    D F   W+   ++ LK  G+L + G+YHN+F +G +LQ L+F ILN I W+
Sbjct: 68  DKEESVNDIDEFNYQWINNAKKALKNTGSLLISGTYHNLFSLGRILQKLDFKILNLITWQ 127

Query: 133 KSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGS 192
           K+NP PNF  R   ++ E +IWA  S K K + FNY+ LK  N D QMR  W  P  +  
Sbjct: 128 KTNPPPNFSCRYLTHSAEQIIWARKSHKHK-HVFNYEVLKKINNDKQMRDVWSFPAIAPW 186

Query: 193 ERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIE 252
           E++  K      PTQKP ALL R+L+ ++    +I DPF GS T+G  A  L+R FIGIE
Sbjct: 187 EKVNGK-----RPTQKPLALLVRLLLMASDENSLIGDPFSGSSTTGIAANLLKRQFIGIE 241

Query: 253 MKQDYIDIATKR 264
            + +++ I+  R
Sbjct: 242 KESEFVKISMDR 253


>gi|15611155|ref|NP_222806.1| type II DNA modification (methyltransferase [Helicobacter pylori
           J99]
 gi|4154584|gb|AAD05658.1| TYPE II DNA MODIFICATION ENZYME (METHYLTRANSFERASE) [Helicobacter
           pylori J99]
          Length = 277

 Score =  163 bits (413), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 104/258 (40%), Positives = 144/258 (55%), Gaps = 11/258 (4%)

Query: 10  NENQNSIFEWKDKII---KGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVD 66
           NE  + IF+  DK+    +G+   VL +    + DLIFADPPY L  +G L      +V 
Sbjct: 7   NEIAHPIFKSADKLFTLYQGDCNEVLPQF-ENAFDLIFADPPYFLSNDG-LSIQSGKIVS 64

Query: 67  AVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWIL 126
                WDK +     D F   W+   ++ LK  G+L + G+YHN+F +G +LQ L+F IL
Sbjct: 65  VNKGDWDKENGINDIDEFNYQWINNAKKALKNTGSLLISGTYHNLFSLGRILQKLDFKIL 124

Query: 127 NDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLI 186
           N I W+K+NP PNF  R   ++ E +IWA  S K K + FNY+ LK  N + QMR  W  
Sbjct: 125 NLITWQKTNPPPNFSCRYLTHSAEQIIWARKSYKHK-HVFNYEILKKINNNKQMRDVWNF 183

Query: 187 PICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRR 246
           P  +  E+   K     HPTQKP ALL R+L+ ++    +I DPF GS T+G  A  L+R
Sbjct: 184 PAIAPWEKANGK-----HPTQKPLALLVRLLLMASDDNSLIGDPFSGSSTTGIAANLLKR 238

Query: 247 SFIGIEMKQDYIDIATKR 264
            FIGIE +  +I I+  R
Sbjct: 239 EFIGIEKESRFIKISMNR 256


>gi|308182268|ref|YP_003926395.1| type II adenine methyltransferase [Helicobacter pylori PeCan4]
 gi|308064453|gb|ADO06345.1| type II adenine methyltransferase [Helicobacter pylori PeCan4]
          Length = 273

 Score =  163 bits (412), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 102/252 (40%), Positives = 141/252 (55%), Gaps = 11/252 (4%)

Query: 16  IFEWKDKII---KGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSW 72
           IF+  D++    +G+   VL +    + DLIFADPPY L  +G L      +V      W
Sbjct: 10  IFKSADELFTLYQGDCNEVLPQF-ENAFDLIFADPPYFLSNDG-LSIQSGKIVSVNKGDW 67

Query: 73  DKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWR 132
           DK +     D F   W+   ++ LK  G+L + G+YHN+F +G +LQ L+F ILN I W+
Sbjct: 68  DKENGINDIDEFNYQWINNAKKALKNTGSLLISGTYHNLFSLGRILQKLDFKILNLITWQ 127

Query: 133 KSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGS 192
           K+NP PNF  R   ++ E +IWA  S K K + FNY+ LK  N D QMR  W  P  +  
Sbjct: 128 KTNPPPNFSCRYLTHSAEQIIWARKSRKHK-HVFNYEVLKKINNDKQMRDVWSFPAIAPW 186

Query: 193 ERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIE 252
           E+   K     HPTQKP ALL R+L+ ++    +I DPF GS T+G  A  L+R FIGIE
Sbjct: 187 EKTNGK-----HPTQKPLALLVRLLLMASDDNSLIGDPFSGSSTTGIAANLLKREFIGIE 241

Query: 253 MKQDYIDIATKR 264
            +  +I I+  R
Sbjct: 242 KESGFIKISMNR 253


>gi|33337329|gb|AAQ13332.1| HpyIIIM protein [Helicobacter pylori]
          Length = 274

 Score =  163 bits (412), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 102/252 (40%), Positives = 141/252 (55%), Gaps = 11/252 (4%)

Query: 16  IFEWKDKII---KGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSW 72
           IF+ +D++    +G+   VL +      DLIFADPPY L  +G L      +V      W
Sbjct: 10  IFKSQDQLFTLYQGDCNEVLPQF-ENQFDLIFADPPYFLSNDG-LSIQSGKIVSVNKGDW 67

Query: 73  DKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWR 132
           DK  S    D F   W+   ++ LK  G+L +  +YHNIF +G +LQ L+F ILN I W+
Sbjct: 68  DKEESVNDIDEFNYQWINNAKKALKNTGSLLISRTYHNIFSLGRVLQKLDFKILNLITWQ 127

Query: 133 KSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGS 192
           K+NP PNF  R   ++ E +IWA  S K K + FNY+ LK  N D QMR  W  P  +  
Sbjct: 128 KTNPPPNFSCRYLTHSAEQIIWARKSRKHK-HVFNYEVLKKINNDKQMRDVWSFPAIAPW 186

Query: 193 ERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIE 252
           E+   K     HPTQKP ALL R+L+ ++    +I DPF GS T+G  A  L+R FIGIE
Sbjct: 187 EKANGK-----HPTQKPLALLVRLLLMASGENSLIGDPFSGSSTTGIAANLLKRQFIGIE 241

Query: 253 MKQDYIDIATKR 264
            + +++ I+  R
Sbjct: 242 KESEFVKISMDR 253


>gi|332672934|gb|AEE69751.1| DNA (cytosine-5-)-methyltransferase [Helicobacter pylori 83]
          Length = 273

 Score =  162 bits (411), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 101/252 (40%), Positives = 142/252 (56%), Gaps = 11/252 (4%)

Query: 16  IFEWKDKII---KGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSW 72
           IF+  D++    +G+   VL +    + DLIFADPPY L  +G L      +V      W
Sbjct: 10  IFKSTDRLFTLYQGDCNEVLPQF-ENAFDLIFADPPYFLSNDG-LNIQSGKIVSVNKGDW 67

Query: 73  DKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWR 132
           DK    +  D F   W+   ++ LK  G+L + G+YHNIF +  +LQ L+F ILN I W+
Sbjct: 68  DKEYGIDDIDEFNYQWINNAKKALKNTGSLLISGTYHNIFSLRRLLQKLDFKILNLITWQ 127

Query: 133 KSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGS 192
           K+NP PNF  R   ++ E +IWA  S K K + FNY+ LK  N D QMR  W  P  +  
Sbjct: 128 KTNPPPNFSCRYLTHSAEQIIWARKSHKHK-HVFNYEVLKKINNDKQMRDVWSFPAIAPW 186

Query: 193 ERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIE 252
           E++  K     HPTQKP ALL R+L+ ++    +I DPF GS T+G  A  L+R FIGIE
Sbjct: 187 EKVNGK-----HPTQKPLALLVRLLLMASGENSLIGDPFSGSSTTGIAANLLKRQFIGIE 241

Query: 253 MKQDYIDIATKR 264
            + +++ I+  R
Sbjct: 242 KESEFVKISMDR 253


>gi|315639073|ref|ZP_07894241.1| modification methylase BabI [Campylobacter upsaliensis JV21]
 gi|315480849|gb|EFU71485.1| modification methylase BabI [Campylobacter upsaliensis JV21]
          Length = 221

 Score =  162 bits (410), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 86/208 (41%), Positives = 126/208 (60%), Gaps = 1/208 (0%)

Query: 158 SPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRIL 217
           S K   +TFNY  +K  N + Q +S W I IC G+ERL++K+G+K H TQKPEALL +++
Sbjct: 5   SIKNAKFTFNYKTMKFLNHNKQEKSIWNIGICIGNERLKDKNGKKAHSTQKPEALLEKVI 64

Query: 218 VSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELT 277
           +SSTK G ++LDPFFG+GT+GAVAK+L R FIGIE  ++Y+ IA  RI  V    N ELT
Sbjct: 65  LSSTKNGALVLDPFFGTGTTGAVAKRLGRHFIGIEQDENYVKIAKARIEQVCVEDN-ELT 123

Query: 278 VLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTLISGTELGSIHRVGAK 337
               +   P+V+   L+  G ++  +   +   N    +  +  +    E+ SIH++ AK
Sbjct: 124 RNELEIKPPKVSLEKLLNAGFLKENERFYDKNQNFICYLVHNNKVSDNKEILSIHKMAAK 183

Query: 338 VSGSETCNGWNFWYFEKLGELHSINTLR 365
                  NGW+++Y  K  +L SI+ LR
Sbjct: 184 YLNKANHNGWSYFYILKDEKLISIDALR 211


>gi|33337335|gb|AAQ13335.1| HpyIIIM protein [Helicobacter pylori]
          Length = 273

 Score =  162 bits (410), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 102/252 (40%), Positives = 141/252 (55%), Gaps = 11/252 (4%)

Query: 16  IFEWKDKII---KGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSW 72
           IF+ +D++    +G+   VL +   +  DLIFADPPY L  +G L      +V      W
Sbjct: 10  IFKSQDQLFTLYQGDCNEVLPQFENR-FDLIFADPPYFLSNDG-LSIQSGKIVSVNKGDW 67

Query: 73  DKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWR 132
           DK       D F   W+   ++ LK  G+L + G+YHNIF +G +LQ L+F ILN I W+
Sbjct: 68  DKEEGVNGIDEFNYQWINNAKKALKNTGSLLISGTYHNIFSLGRLLQKLDFKILNLITWQ 127

Query: 133 KSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGS 192
           K+NP PNF  R   ++ E +IWA  S K K + FNY+ LK  N D QMR  W  P  +  
Sbjct: 128 KTNPPPNFSCRYLTHSAEQIIWARKSYKHK-HVFNYEVLKKINNDKQMRDVWSFPAIAPW 186

Query: 193 ERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIE 252
           E++  K     HPTQKP ALL R+L+ ++    +I DPF  S T+G  A  L+R FIGIE
Sbjct: 187 EKVNGK-----HPTQKPLALLVRLLLMASDENSLIGDPFSWSSTTGIAANLLKREFIGIE 241

Query: 253 MKQDYIDIATKR 264
            +  +I I+  R
Sbjct: 242 KESGFIKISMDR 253


>gi|317013518|gb|ADU80954.1| M.HpyAIII, type II adenine methyltransferase [Helicobacter pylori
           Gambia94/24]
          Length = 274

 Score =  162 bits (409), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 102/252 (40%), Positives = 141/252 (55%), Gaps = 11/252 (4%)

Query: 16  IFEWKDKII---KGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSW 72
           IF+  D++    +G+   VL +    + DLIFADPPY L  +G L      +V      W
Sbjct: 10  IFKSTDRLFTLYQGDCNEVLPQF-ENAFDLIFADPPYFLSNDG-LSIQSGKIVSVNKGDW 67

Query: 73  DKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWR 132
           DK +     D F   W+   ++ LK  G+L + G+YHN+F +G +LQ L+F ILN I W+
Sbjct: 68  DKENGINDIDEFNYQWINNAKKALKNTGSLLISGTYHNLFSLGRVLQKLDFKILNLITWQ 127

Query: 133 KSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGS 192
           K+NP PNF  R   ++ E +IWA  S K K + FNY+ LK  N D QMR  W  P  +  
Sbjct: 128 KTNPPPNFSCRYLTHSAEQIIWARKSRKHK-HVFNYEILKKINNDKQMRDVWNFPAIAPW 186

Query: 193 ERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIE 252
           E+   K     HPTQKP ALL R+L+ ++    +I DPF GS T+G  A  L+R FIGIE
Sbjct: 187 EKANGK-----HPTQKPLALLVRLLLMASDDNSLIGDPFSGSSTTGIAANLLKREFIGIE 241

Query: 253 MKQDYIDIATKR 264
            +  +I I+  R
Sbjct: 242 KESGFIKISMNR 253


>gi|307636783|gb|ADN79233.1| type II DNA modification enzyme /methyl transferase [Helicobacter
           pylori 908]
 gi|325996968|gb|ADZ49176.1| Type II adenine methyltransferase [Helicobacter pylori 2017]
          Length = 281

 Score =  160 bits (406), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 101/252 (40%), Positives = 141/252 (55%), Gaps = 11/252 (4%)

Query: 16  IFEWKDKII---KGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSW 72
           IF+  D++    +G+   VL +    + DLIFADPPY L  +G L      ++      W
Sbjct: 10  IFKSTDRLFTLYQGDCNEVLPQF-ENAFDLIFADPPYFLSNDG-LSIQSGKIMSVNKGDW 67

Query: 73  DKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWR 132
           DK +     D F   W+   ++ LK  G+L + G+YHN+F +G +LQ L+F ILN I W+
Sbjct: 68  DKENGINDIDEFNYQWINNAKKALKNTGSLLISGTYHNLFSLGRILQKLDFKILNLITWQ 127

Query: 133 KSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGS 192
           K+NP PNF  R   ++ E +IWA  S K K + FNY+ LK  N D QMR  W  P  +  
Sbjct: 128 KTNPPPNFSCRYLTHSAEQIIWARKSRKHK-HVFNYEILKKINNDKQMRDVWSFPAIAPW 186

Query: 193 ERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIE 252
           E+   K     HPTQKP ALL R+L+ ++    +I DPF GS T+G  A  L+R FIGIE
Sbjct: 187 EKANGK-----HPTQKPLALLVRLLLMASDDNSLIGDPFSGSSTTGIAANLLKREFIGIE 241

Query: 253 MKQDYIDIATKR 264
            +  +I I+  R
Sbjct: 242 KESGFIKISMNR 253


>gi|325995371|gb|ADZ50776.1| Type II DNA modification enzyme/methyl transferase [Helicobacter
           pylori 2018]
          Length = 281

 Score =  160 bits (406), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 101/252 (40%), Positives = 141/252 (55%), Gaps = 11/252 (4%)

Query: 16  IFEWKDKII---KGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSW 72
           IF+  D++    +G+   VL +    + DLIFADPPY L  +G L      ++      W
Sbjct: 10  IFKSTDRLFTLYQGDCNEVLPQF-ENAFDLIFADPPYFLSNDG-LSIQSGKIMSVNKGDW 67

Query: 73  DKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWR 132
           DK +     D F   W+   ++ LK  G+L + G+YHN+F +G +LQ L+F ILN I W+
Sbjct: 68  DKENGINDIDEFNYQWINNAKKALKNTGSLLISGTYHNLFSLGRILQKLDFKILNLITWQ 127

Query: 133 KSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGS 192
           K+NP PNF  R   ++ E +IWA  S K K + FNY+ LK  N D QMR  W  P  +  
Sbjct: 128 KTNPPPNFTCRYLTHSAEQIIWARKSRKHK-HVFNYEILKKINNDKQMRDVWSFPAIAPW 186

Query: 193 ERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIE 252
           E+   K     HPTQKP ALL R+L+ ++    +I DPF GS T+G  A  L+R FIGIE
Sbjct: 187 EKANGK-----HPTQKPLALLVRLLLMASDDNSLIGDPFSGSSTTGIAANLLKREFIGIE 241

Query: 253 MKQDYIDIATKR 264
            +  +I I+  R
Sbjct: 242 KESGFIKISMNR 253


>gi|57242503|ref|ZP_00370441.1| adenine specific DNA methyltransferase (HINFIM) [Campylobacter
           upsaliensis RM3195]
 gi|57016788|gb|EAL53571.1| adenine specific DNA methyltransferase (HINFIM) [Campylobacter
           upsaliensis RM3195]
          Length = 221

 Score =  160 bits (406), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 85/208 (40%), Positives = 125/208 (60%), Gaps = 1/208 (0%)

Query: 158 SPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRIL 217
           S K   +TFNY  +K  N + Q +S W I IC G+ERL++K+G+K H TQKPEALL +++
Sbjct: 5   SIKNTKFTFNYKTMKFLNHNKQEKSIWNIGICIGNERLKDKNGKKAHSTQKPEALLEKVI 64

Query: 218 VSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELT 277
           +SSTK   ++LDPFFG+GT+GAVAK+L R FIGIE  ++Y+ IA  RI  V    N ELT
Sbjct: 65  LSSTKKDALVLDPFFGTGTTGAVAKRLGRHFIGIEQDENYVKIAKARIKQVCVEDN-ELT 123

Query: 278 VLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTLISGTELGSIHRVGAK 337
               +   P+V+   L+  G ++  +   +   N    +  +  +    E+ SIH++ AK
Sbjct: 124 RNELEIKPPKVSLEKLLNAGFLKENERFYDKNQNFICYLVHNNKVSDNKEILSIHKMAAK 183

Query: 338 VSGSETCNGWNFWYFEKLGELHSINTLR 365
                  NGW+++Y  K  +L SI+ LR
Sbjct: 184 YLNKANYNGWSYFYILKDEKLISIDALR 211


>gi|312869218|ref|ZP_07729390.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus oris PB013-T2-3]
 gi|311095239|gb|EFQ53511.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus oris PB013-T2-3]
          Length = 256

 Score =  159 bits (401), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 88/248 (35%), Positives = 134/248 (54%), Gaps = 11/248 (4%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           + + ++ + ++++P  +VD+I ADPPY L  +G         V      WDK  S +  +
Sbjct: 11  LYQDDAFNFMKRIPNNAVDVIVADPPYFLSNDG-FSNSGGKFVSVNKGKWDKLPS-KDIE 68

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            F    L   +R+L  NGT W+ GS HNI+ IG +L   +F ILN+I W+KSNP PN   
Sbjct: 69  KFYAEMLSQFQRILNKNGTAWIFGSMHNIYVIGYLLNRYDFKILNNITWQKSNPAPNLSR 128

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSE-RLRNKDGE 201
           R F ++ ET++W     K     FNYD ++  N + QM+  W     + SE R  N    
Sbjct: 129 RMFTHSTETILWI--KKKDGKQFFNYDLMRKLNGNKQMKDVWTTATINKSEKRFGN---- 182

Query: 202 KLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIA 261
             HPTQKP +++ RI+ +ST  G I+LDPF G+GT+    K      +G++    Y++IA
Sbjct: 183 --HPTQKPLSIIMRIIKASTTDGMIVLDPFIGAGTTAVAGKLCGVKVVGVDNSAGYLNIA 240

Query: 262 TKRIASVQ 269
            +R+   Q
Sbjct: 241 VQRLKDYQ 248


>gi|46206074|ref|ZP_00047737.2| COG0863: DNA modification methylase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 181

 Score =  158 bits (400), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 83/126 (65%), Positives = 98/126 (77%), Gaps = 1/126 (0%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQL-NGQLYRPDHSLVDAVTDSWDKFSSFE 79
           D+I+ G+ I+ +E+LPA SVD +FADPPYNLQL    L RPD S+VDAV D WDKFSSF 
Sbjct: 45  DEILVGDCIAAMERLPASSVDCVFADPPYNLQLGEAGLTRPDQSVVDAVDDDWDKFSSFS 104

Query: 80  AYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPN 139
           AYD FTRAWL A RRV+KPN TLWVIGSYHNIFR+G+ LQ+L +WILNDIVWR+  P   
Sbjct: 105 AYDEFTRAWLTAARRVMKPNATLWVIGSYHNIFRVGSALQDLGYWILNDIVWRQGQPDAE 164

Query: 140 FRGRRF 145
              +RF
Sbjct: 165 LPRQRF 170


>gi|62181894|ref|YP_218311.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|62129527|gb|AAX67230.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|322716384|gb|EFZ07955.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
          Length = 296

 Score =  138 bits (348), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 96/289 (33%), Positives = 149/289 (51%), Gaps = 53/289 (18%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           KII G++++ L+KLP++S+DLIFADPPYN+  +           D + +SWD+ S     
Sbjct: 18  KIIHGDALTELKKLPSESIDLIFADPPYNIGKD----------FDGMVESWDEASFL--- 64

Query: 82  DAFTRAWLLAC----RRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPM 137
                AWL  C     RVLK +GT++++ S  N+  I    + L F I + IVW   +  
Sbjct: 65  -----AWLYECIDECHRVLKKHGTMYIMNSTENMPYIDLKCRTL-FTIKSRIVWSYDSSG 118

Query: 138 PNFRGRRFQNAHETLIWASPSPKAKGYTFNYDAL------KAANEDVQMRSD-------- 183
              + + F + +E ++    +PK+  YTFN DA+       A    +  R +        
Sbjct: 119 VQAK-KYFGSMYEPILMMVKNPKS--YTFNRDAILVETTTGAKRALIDYRKNPPQPYNQK 175

Query: 184 ------WLIPICSGSERLRN-KDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGT 236
                 W  P      R+R   D  + HPTQKP ALL RI+++S+ P D +LDPF GS T
Sbjct: 176 KVPGNVWSFP------RVRYLMDEYENHPTQKPSALLKRIILASSNPSDTVLDPFAGSFT 229

Query: 237 SGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRTE 285
           +GAVA +  R FIGIE+  +Y+ +  +R++        EL  +  ++T+
Sbjct: 230 TGAVAAESGRKFIGIELNNEYVKMGLRRLSVTSHYSENELAKVKKRKTQ 278


>gi|224585184|ref|YP_002638983.1| methyltransferase [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|224469712|gb|ACN47542.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
          Length = 294

 Score =  138 bits (347), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 96/289 (33%), Positives = 149/289 (51%), Gaps = 53/289 (18%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           KII G++++ L+KLP++S+DLIFADPPYN+  +           D + +SWD+ S     
Sbjct: 16  KIIHGDALTELKKLPSESIDLIFADPPYNIGKD----------FDGMVESWDEASFL--- 62

Query: 82  DAFTRAWLLAC----RRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPM 137
                AWL  C     RVLK +GT++++ S  N+  I    + L F I + IVW   +  
Sbjct: 63  -----AWLYECIDECHRVLKKHGTMYIMNSTENMPYIDLKCRTL-FTIKSRIVWSYDSSG 116

Query: 138 PNFRGRRFQNAHETLIWASPSPKAKGYTFNYDAL------KAANEDVQMRSD-------- 183
              + + F + +E ++    +PK+  YTFN DA+       A    +  R +        
Sbjct: 117 VQAK-KYFGSMYEPILMMVKNPKS--YTFNRDAILVETTTGAKRALIDYRKNPPQPYNQK 173

Query: 184 ------WLIPICSGSERLRN-KDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGT 236
                 W  P      R+R   D  + HPTQKP ALL RI+++S+ P D +LDPF GS T
Sbjct: 174 KVPGNVWSFP------RVRYLMDEYENHPTQKPSALLKRIILASSNPSDTVLDPFAGSFT 227

Query: 237 SGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRTE 285
           +GAVA +  R FIGIE+  +Y+ +  +R++        EL  +  ++T+
Sbjct: 228 TGAVAAESGRKFIGIELNNEYVKMGLRRLSVTSHYSENELAKVKKRKTQ 276


>gi|168262589|ref|ZP_02684562.1| DNA methylase [Salmonella enterica subsp. enterica serovar Hadar
           str. RI_05P066]
 gi|205348404|gb|EDZ35035.1| DNA methylase [Salmonella enterica subsp. enterica serovar Hadar
           str. RI_05P066]
          Length = 294

 Score =  137 bits (346), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 96/289 (33%), Positives = 148/289 (51%), Gaps = 53/289 (18%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           KII G++++ L+KLP++S+DLIFADPPYN+  +           D + +SWD+ S     
Sbjct: 16  KIIHGDALTELKKLPSESIDLIFADPPYNIGKD----------FDGMVESWDETSFL--- 62

Query: 82  DAFTRAWLL----ACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPM 137
                AWL      C RVLK +GT++++ S  N+  I    + L F I + IVW   +  
Sbjct: 63  -----AWLYECIDECHRVLKKHGTMYIMNSTENMPYIDLKCRTL-FTIKSRIVWSYDSSG 116

Query: 138 PNFRGRRFQNAHETLIWASPSPKAKGYTFNYDAL------KAANEDVQMRSD-------- 183
              + + F + +E ++    +PK+  YTFN DA+       A    +  R +        
Sbjct: 117 VQAK-KYFGSMYEPILMMVKNPKS--YTFNRDAILVETTTGAKRALIDYRKNPPQPYNQK 173

Query: 184 ------WLIPICSGSERLRN-KDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGT 236
                 W  P      R+R   D  + HPTQKP ALL RI+++S+ P D +LDPF GS T
Sbjct: 174 KVPGNVWSFP------RVRYLMDEYENHPTQKPSALLKRIILASSNPSDTVLDPFAGSFT 227

Query: 237 SGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRTE 285
           +GAVA    R FIGIE+  +Y+ +  +R++        EL  +  ++T+
Sbjct: 228 TGAVAAASGRKFIGIELNNEYVKMGLRRLSVTSHYSENELAKVKKRKTQ 276


>gi|16762145|ref|NP_457762.1| methyltransferase [Salmonella enterica subsp. enterica serovar
           Typhi str. CT18]
 gi|16766681|ref|NP_462296.1| methyltransferase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|29143634|ref|NP_806976.1| methyltransferase [Salmonella enterica subsp. enterica serovar
           Typhi str. Ty2]
 gi|161616411|ref|YP_001590376.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Paratyphi B str. SPB7]
 gi|167552904|ref|ZP_02346655.1| DNA methylase [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA29]
 gi|167993974|ref|ZP_02575067.1| DNA methylase [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|168233973|ref|ZP_02659031.1| DNA methylase [Salmonella enterica subsp. enterica serovar Kentucky
           str. CDC 191]
 gi|168239415|ref|ZP_02664473.1| DNA methylase [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|168245210|ref|ZP_02670142.1| DNA methylase [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|168463376|ref|ZP_02697293.1| DNA methylase [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|168822713|ref|ZP_02834713.1| DNA methylase [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|194442303|ref|YP_002042642.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194449918|ref|YP_002047414.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194469895|ref|ZP_03075879.1| DNA methylase [Salmonella enterica subsp. enterica serovar Kentucky
           str. CVM29188]
 gi|194736425|ref|YP_002116334.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197251530|ref|YP_002148310.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197265136|ref|ZP_03165210.1| DNA methylase [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|198244548|ref|YP_002217356.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|200389115|ref|ZP_03215727.1| DNA methylase [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|204931162|ref|ZP_03221956.1| DNA methylase [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
 gi|207858634|ref|YP_002245285.1| methyltransferase [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|213162245|ref|ZP_03347955.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Typhi str. E00-7866]
 gi|213428297|ref|ZP_03361047.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
 gi|213649888|ref|ZP_03379941.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|213853025|ref|ZP_03382557.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Typhi str. M223]
 gi|289824094|ref|ZP_06543691.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
 gi|25286118|pir||AG0913 probable adenine-specific DNA-modification methylase STY3566
           [imported] - Salmonella enterica subsp. enterica serovar
           Typhi (strain CT18)
 gi|16421947|gb|AAL22255.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|16504448|emb|CAD07901.1| putative adenine-specific DNA-modification methylase [Salmonella
           enterica subsp. enterica serovar Typhi]
 gi|29139269|gb|AAO70836.1| putative adenine-specific DNA-modification methylase [Salmonella
           enterica subsp. enterica serovar Typhi str. Ty2]
 gi|161365775|gb|ABX69543.1| hypothetical protein SPAB_04220 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194400966|gb|ACF61188.1| DNA methylase [Salmonella enterica subsp. enterica serovar Newport
           str. SL254]
 gi|194408222|gb|ACF68441.1| DNA methylase [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|194456259|gb|EDX45098.1| DNA methylase [Salmonella enterica subsp. enterica serovar Kentucky
           str. CVM29188]
 gi|194711927|gb|ACF91148.1| DNA methylase [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|195633408|gb|EDX51822.1| DNA methylase [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|197215233|gb|ACH52630.1| DNA methylase [Salmonella enterica subsp. enterica serovar Agona
           str. SL483]
 gi|197243391|gb|EDY26011.1| DNA methylase [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|197287877|gb|EDY27265.1| DNA methylase [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|197939064|gb|ACH76397.1| DNA methylase [Salmonella enterica subsp. enterica serovar Dublin
           str. CT_02021853]
 gi|199606213|gb|EDZ04758.1| DNA methylase [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|204319929|gb|EDZ05135.1| DNA methylase [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
 gi|205322540|gb|EDZ10379.1| DNA methylase [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA29]
 gi|205328111|gb|EDZ14875.1| DNA methylase [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|205332006|gb|EDZ18770.1| DNA methylase [Salmonella enterica subsp. enterica serovar Kentucky
           str. CDC 191]
 gi|205336037|gb|EDZ22801.1| DNA methylase [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|205340921|gb|EDZ27685.1| DNA methylase [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|206710437|emb|CAR34795.1| putative adenine-specific DNA-modification methylase [Salmonella
           enterica subsp. enterica serovar Enteritidis str.
           P125109]
 gi|261248549|emb|CBG26387.1| putative adenine-specific DNA-modification methylase [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           D23580]
 gi|267995595|gb|ACY90480.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|301159935|emb|CBW19454.1| putative adenine-specific DNA-modification methylase [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           SL1344]
 gi|312914414|dbj|BAJ38388.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|320087834|emb|CBY97598.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
 gi|321225192|gb|EFX50251.1| Adenine-specific methyltransferase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|322614527|gb|EFY11457.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322618251|gb|EFY15142.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322625964|gb|EFY22778.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322626734|gb|EFY23531.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322631302|gb|EFY28062.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322635431|gb|EFY32145.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322643431|gb|EFY39995.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322647265|gb|EFY43763.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322649729|gb|EFY46156.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322655597|gb|EFY51903.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322658373|gb|EFY54638.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322664403|gb|EFY60599.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322667377|gb|EFY63539.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322674625|gb|EFY70717.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322675744|gb|EFY71817.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322682380|gb|EFY78403.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322684755|gb|EFY80756.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|323131748|gb|ADX19178.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|323196167|gb|EFZ81327.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323196733|gb|EFZ81878.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323204370|gb|EFZ89379.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323207718|gb|EFZ92665.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323209992|gb|EFZ94897.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323214293|gb|EFZ99046.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323219030|gb|EGA03536.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323225048|gb|EGA09301.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323230400|gb|EGA14519.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323233376|gb|EGA17470.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323239413|gb|EGA23463.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323242336|gb|EGA26362.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323247310|gb|EGA31275.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323250400|gb|EGA34284.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323256848|gb|EGA40563.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323263868|gb|EGA47387.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323264111|gb|EGA47619.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323271630|gb|EGA55049.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
 gi|326625135|gb|EGE31480.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
 gi|332990244|gb|AEF09227.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 294

 Score =  137 bits (345), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 96/289 (33%), Positives = 148/289 (51%), Gaps = 53/289 (18%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           KII G++++ L+KLP++S+DLIFADPPYN+  +           D + +SWD+ S     
Sbjct: 16  KIIHGDALTELKKLPSESIDLIFADPPYNIGKD----------FDGMVESWDEASFL--- 62

Query: 82  DAFTRAWLL----ACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPM 137
                AWL      C RVLK +GT++++ S  N+  I    + L F I + IVW   +  
Sbjct: 63  -----AWLYECIDECHRVLKKHGTMYIMNSTENMPYIDLKCRTL-FTIKSRIVWSYDSSG 116

Query: 138 PNFRGRRFQNAHETLIWASPSPKAKGYTFNYDAL------KAANEDVQMRSD-------- 183
              + + F + +E ++    +PK+  YTFN DA+       A    +  R +        
Sbjct: 117 VQAK-KYFGSMYEPILMMVKNPKS--YTFNRDAILVETTTGAKRALIDYRKNPPQPYNQK 173

Query: 184 ------WLIPICSGSERLRN-KDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGT 236
                 W  P      R+R   D  + HPTQKP ALL RI+++S+ P D +LDPF GS T
Sbjct: 174 KVPGNVWSFP------RVRYLMDEYENHPTQKPSALLKRIILASSNPSDTVLDPFAGSFT 227

Query: 237 SGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRTE 285
           +GAVA    R FIGIE+  +Y+ +  +R++        EL  +  ++T+
Sbjct: 228 TGAVAAASGRKFIGIELNNEYVKMGLRRLSVTSHYSENELAKVKKRKTQ 276


>gi|227431774|ref|ZP_03913801.1| adenine-specific methyltransferase [Leuconostoc mesenteroides
           subsp. cremoris ATCC 19254]
 gi|227352457|gb|EEJ42656.1| adenine-specific methyltransferase [Leuconostoc mesenteroides
           subsp. cremoris ATCC 19254]
          Length = 231

 Score =  137 bits (345), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 82/250 (32%), Positives = 124/250 (49%), Gaps = 22/250 (8%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           K+I GN++  L  +P  S+DLI  DPPYN+         + + +D     WDK       
Sbjct: 2   KLINGNNLDALSDIPDNSIDLILTDPPYNISRKNNFESLNRAGIDF--GDWDK------- 52

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFR 141
           +A    W+    R++K   ++ +  ++ N+  I   L+   F + + I W K+NPMP  R
Sbjct: 53  NADLLTWIDKVPRIVKKGASIIIFNAWRNLGDIAERLEKNGFVVKDIIRWEKTNPMPRNR 112

Query: 142 GRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGE 201
            RR+   +E  IWA    K   + FN  + K        RS+  +PI   +E++      
Sbjct: 113 DRRYIVDYEFAIWAVE--KHNKWIFNRQSNKYD------RSEIRVPITGKAEKILGS--- 161

Query: 202 KLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIA 261
             HPTQKP  L+  +L+  +   DI+LDPF GSG++G   + L R FIGIE+ + Y  IA
Sbjct: 162 --HPTQKPIKLMEELLLRHSNENDIVLDPFMGSGSTGVACRNLNREFIGIELDETYFKIA 219

Query: 262 TKRIASVQPL 271
             RI   Q L
Sbjct: 220 ENRIREAQTL 229


>gi|238913534|ref|ZP_04657371.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
          Length = 287

 Score =  135 bits (339), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 95/287 (33%), Positives = 146/287 (50%), Gaps = 53/287 (18%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           KII G++++ L+KLP++S+DLIFADPPYN+  +           D + +SWD+ S     
Sbjct: 16  KIIHGDALTELKKLPSESIDLIFADPPYNIGKD----------FDGMVESWDEASFL--- 62

Query: 82  DAFTRAWLL----ACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPM 137
                AWL      C RVLK +GT++++ S  N+  I    + L F I + IVW   +  
Sbjct: 63  -----AWLYECIDECHRVLKKHGTMYIMNSTENMPYIDLKCRTL-FTIKSRIVWSYDSSG 116

Query: 138 PNFRGRRFQNAHETLIWASPSPKAKGYTFNYDAL------KAANEDVQMRSD-------- 183
              + + F + +E ++    +PK+  YTFN DA+       A    +  R +        
Sbjct: 117 VQAK-KYFGSMYEPILMMVKNPKS--YTFNRDAILVETTTGAKRALIDYRKNPPQPYNQK 173

Query: 184 ------WLIPICSGSERLRN-KDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGT 236
                 W  P      R+R   D  + HPTQKP ALL RI+++S+ P D +LDPF GS T
Sbjct: 174 KVPGNVWSFP------RVRYLMDEYENHPTQKPSALLKRIILASSNPSDTVLDPFAGSFT 227

Query: 237 SGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKR 283
           +GAVA    R FIGIE+  +Y+ +  +R++        EL  +  ++
Sbjct: 228 TGAVAAASGRKFIGIELNNEYVKMGLRRLSVTSHYSENELAKVKKRK 274


>gi|324115134|gb|EGC09098.1| DNA methylase [Escherichia fergusonii B253]
          Length = 292

 Score =  135 bits (339), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 98/282 (34%), Positives = 146/282 (51%), Gaps = 41/282 (14%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           +II G+++S L+KLP++SVDLIFADPPYN+  N           D + +SWD        
Sbjct: 16  RIIHGDALSELKKLPSESVDLIFADPPYNIGKN----------FDGLVESWD-------- 57

Query: 82  DAFTRAWLL----ACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPM 137
           DA  R+WL      C RVLK  G+++++ S  N+  I    + L F I + I+W   +  
Sbjct: 58  DADFRSWLFEIIAECHRVLKKQGSMYIMNSTENMPWIDLECRKL-FTIKSRIIWAYDSSG 116

Query: 138 PNFRGRRFQNAHETLIWASPSPKAKGYTFNYDAL------KAANEDVQMRSDWLIPICSG 191
              + + F + +E ++       AK YTFN DA+       A    +  R +   P  S 
Sbjct: 117 VQAK-KYFGSMYEPILMMVKD--AKNYTFNSDAILVEAKTGAKRALIDYRKNPPQPYNSQ 173

Query: 192 S--------ERLRN-KDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAK 242
                     R+R   D  + HPTQKP ALL RI+++S+ PGDI+LDPF GS T+G VA 
Sbjct: 174 KVPGNVWEFSRVRYLMDEYENHPTQKPVALLKRIILASSCPGDIVLDPFAGSFTTGEVAV 233

Query: 243 KLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRT 284
           +  R FIGIE+  +Y+ +  +R+         EL  +  ++T
Sbjct: 234 ETGRRFIGIEVNCEYVKMGLRRLNVDSHFSAEELAKVKKRKT 275


>gi|167631056|ref|YP_001681555.1| DNA methylase [Heliobacterium modesticaldum Ice1]
 gi|167593796|gb|ABZ85544.1| DNA methylase [Heliobacterium modesticaldum Ice1]
          Length = 304

 Score =  135 bits (339), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 91/282 (32%), Positives = 141/282 (50%), Gaps = 54/282 (19%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           D+I  G+++  + +LPA+SVDLIFADPPY   L         S         + + + E 
Sbjct: 45  DRIYCGDALVGMSRLPARSVDLIFADPPY-FGLKKDFGSGKRS---------NPWKTIEE 94

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           Y  +TRAW     R+LKP+G ++V   +    R+  ML + +F +LN I WR+       
Sbjct: 95  YMEWTRAWFAEAARLLKPHGAIYVCCDWEYSGRVQEMLSD-SFDVLNRITWRREKG---- 149

Query: 141 RG--RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSER---- 194
           RG  + ++N  E + +A     ++ Y FN        EDV+ R + + P  +   +    
Sbjct: 150 RGAAKNWKNNMEDIWFAVVD--SRQYIFNL-------EDVKFRKEIIAPYTTTDGKPKDW 200

Query: 195 LRNKDGEKL------------------------HPTQKPEALLSRILVSSTKPGDIILDP 230
           +  + GE+                         HPTQKPE L+ R +++S+ PG ++LDP
Sbjct: 201 VETETGERFRMTCPPNIWTDLTVPFWSMPENTPHPTQKPEKLVERCILASSNPGALVLDP 260

Query: 231 FFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLG 272
           F GSGT+ AVA++L R FIG E  +DY+ +A KR+  V   G
Sbjct: 261 FMGSGTTAAVARRLGRHFIGFETNEDYVRLAMKRLDRVSLCG 302


>gi|152981599|ref|YP_001354977.1| DNA modification methylase [Janthinobacterium sp. Marseille]
 gi|151281676|gb|ABR90086.1| DNA modification methylase [Janthinobacterium sp. Marseille]
          Length = 273

 Score =  135 bits (339), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 87/288 (30%), Positives = 149/288 (51%), Gaps = 33/288 (11%)

Query: 19  WKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSF 78
           W+D+I   ++++ L ++P  ++DLI ADPPY L   G+ Y  D   +DA           
Sbjct: 4   WRDRIFCEDALAGLARIPDAAIDLIIADPPYGL---GKDYGNDSDKLDA----------- 49

Query: 79  EAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
           +AY ++   W+ A    LKPNG+L++  ++     +  ML+     +LN+IVW +  P  
Sbjct: 50  DAYLSWMEQWIDAALPKLKPNGSLYIFLTWRYSPEVFVMLKK-RMTMLNEIVWDRRVPSM 108

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDAL---------KAANEDVQMRSDWLIPIC 189
               R+F + H+T+ + +   KAK Y F+ DA+         KA +  + + + WL    
Sbjct: 109 GGGTRKFSSVHDTIGFFA---KAKDYYFDLDAVRIPYDAETKKARSRSIFVGAKWLEMGY 165

Query: 190 SGSE-----RLRNKDGEKL-HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKK 243
           +  +     RL  +  E+  HPTQKP  ++ R+L +S  PG ++LDPF GSGT+ A AK+
Sbjct: 166 NPKDVWSVSRLHKEHRERADHPTQKPLEIVERMLKASCPPGGVVLDPFMGSGTTAAAAKR 225

Query: 244 LRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRTEPRVAFN 291
             R F+G E+  +Y ++  KR+ +++ +    +    G+   P    N
Sbjct: 226 CGRHFVGFELNAEYCEMIEKRLQALESIPASNIAPAPGQELNPAAEEN 273


>gi|325498841|gb|EGC96700.1| methyltransferase [Escherichia fergusonii ECD227]
          Length = 294

 Score =  135 bits (339), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 98/282 (34%), Positives = 146/282 (51%), Gaps = 41/282 (14%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           +II G+++S L+KLP++SVDLIFADPPYN+  N           D + +SWD        
Sbjct: 18  RIIHGDALSELKKLPSESVDLIFADPPYNIGKN----------FDGLVESWD-------- 59

Query: 82  DAFTRAWLL----ACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPM 137
           DA  R+WL      C RVLK  G+++++ S  N+  I    + L F I + I+W   +  
Sbjct: 60  DADFRSWLFEIIAECHRVLKKQGSMYIMNSTENMPWIDLECRKL-FTIKSRIIWAYDSSG 118

Query: 138 PNFRGRRFQNAHETLIWASPSPKAKGYTFNYDAL------KAANEDVQMRSDWLIPICSG 191
              + + F + +E ++       AK YTFN DA+       A    +  R +   P  S 
Sbjct: 119 VQAK-KYFGSMYEPILMMVKD--AKNYTFNSDAILVEAKTGAKRALIDYRKNPPQPYNSQ 175

Query: 192 S--------ERLRN-KDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAK 242
                     R+R   D  + HPTQKP ALL RI+++S+ PGDI+LDPF GS T+G VA 
Sbjct: 176 KVPGNVWEFSRVRYLMDEYENHPTQKPVALLKRIILASSCPGDIVLDPFAGSFTTGKVAV 235

Query: 243 KLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRT 284
           +  R FIGIE+  +Y+ +  +R+         EL  +  ++T
Sbjct: 236 ETGRRFIGIEVNCEYVKMGLRRLNVDSHFSAEELAKVKKRKT 277


>gi|218550546|ref|YP_002384337.1| methyltransferase [Escherichia fergusonii ATCC 35469]
 gi|218358087|emb|CAQ90733.1| methyltransferase [Escherichia fergusonii ATCC 35469]
          Length = 299

 Score =  135 bits (339), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 98/282 (34%), Positives = 146/282 (51%), Gaps = 41/282 (14%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           +II G+++S L+KLP++SVDLIFADPPYN+  N           D + +SWD        
Sbjct: 23  RIIHGDALSELKKLPSESVDLIFADPPYNIGKN----------FDGLVESWD-------- 64

Query: 82  DAFTRAWLL----ACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPM 137
           DA  R+WL      C RVLK  G+++++ S  N+  I    + L F I + I+W   +  
Sbjct: 65  DADFRSWLFEIIAECHRVLKKQGSMYIMNSTENMPWIDLECRKL-FTIKSRIIWAYDSSG 123

Query: 138 PNFRGRRFQNAHETLIWASPSPKAKGYTFNYDAL------KAANEDVQMRSDWLIPICSG 191
              + + F + +E ++       AK YTFN DA+       A    +  R +   P  S 
Sbjct: 124 VQAK-KYFGSMYEPILMMVKD--AKNYTFNSDAILVEAKTGAKRALIDYRKNPPQPYNSQ 180

Query: 192 S--------ERLRN-KDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAK 242
                     R+R   D  + HPTQKP ALL RI+++S+ PGDI+LDPF GS T+G VA 
Sbjct: 181 KVPGNVWEFSRVRYLMDEYENHPTQKPVALLKRIILASSCPGDIVLDPFAGSFTTGEVAV 240

Query: 243 KLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRT 284
           +  R FIGIE+  +Y+ +  +R+         EL  +  ++T
Sbjct: 241 ETGRRFIGIEVNCEYVKMGLRRLNVDSHFSAEELAKVKKRKT 282


>gi|157148841|ref|YP_001456160.1| putative methyltransferase [Citrobacter koseri ATCC BAA-895]
 gi|157086046|gb|ABV15724.1| hypothetical protein CKO_04674 [Citrobacter koseri ATCC BAA-895]
          Length = 294

 Score =  134 bits (338), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 93/278 (33%), Positives = 145/278 (52%), Gaps = 33/278 (11%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           KII G+++S L+KLP +S DLIFADPPYN+  N           D + +SWD+    E +
Sbjct: 16  KIIHGDALSELKKLPPESADLIFADPPYNIGKN----------FDGLVESWDE----ETF 61

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFR 141
            A+    +  C RVLK +GT++++ S  N+  +    + L F I + I+W   +     +
Sbjct: 62  LAWLFECIDECHRVLKKHGTMYIMNSTENMPYLDLKCRKL-FDIKSRIIWSYDSSGVQAK 120

Query: 142 GRRFQNAHETLIWASPSPKAKGYTFNYDAL------KAANEDVQMRSDWLIPICSGS--- 192
            + F + +E ++       AK YTFN D +       A    +  R +   P  +     
Sbjct: 121 -KYFGSMYEPILMMVKD--AKNYTFNRDDILVETKTGAKRALIDYRKNPPQPYNTQKVPG 177

Query: 193 -----ERLRN-KDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRR 246
                 R+R   D  + HPTQKP ALLSRI+++S+ PGD +LDPF GS T+GAVA +  R
Sbjct: 178 NVWDFPRVRYLMDEYENHPTQKPRALLSRIILASSNPGDTVLDPFAGSFTTGAVAVETGR 237

Query: 247 SFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRT 284
            F+GIE+  +Y+ +  +R+         EL  +  ++T
Sbjct: 238 KFVGIEINDEYVKMGIRRLNVTSHYAENELAKVKKRKT 275


>gi|205354287|ref|YP_002228088.1| methyltransferase [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|205274068|emb|CAR39074.1| putative adenine-specific DNA-modification methylase [Salmonella
           enterica subsp. enterica serovar Gallinarum str. 287/91]
 gi|326629410|gb|EGE35753.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
          Length = 294

 Score =  134 bits (337), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 95/289 (32%), Positives = 147/289 (50%), Gaps = 53/289 (18%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           KII G++++ L+KLP++S+DLIFADPPYN+  +           D + +SWD+ S     
Sbjct: 16  KIIHGDALTELKKLPSESIDLIFADPPYNIGKD----------FDGMVESWDEASFL--- 62

Query: 82  DAFTRAWLL----ACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPM 137
                AWL      C RVLK +GT++++ S  N+  I    + L F I + IVW   +  
Sbjct: 63  -----AWLYECIDECHRVLKKHGTMYIMNSTENMPYIDLKCRTL-FTIKSRIVWSYDSSG 116

Query: 138 PNFRGRRFQNAHETLIWASPSPKAKGYTFNYDAL------KAANEDVQMRSD-------- 183
              + + F + +E ++    +PK+  YTFN DA+       A    +  R +        
Sbjct: 117 VQAK-KYFGSMYEPILMMVKNPKS--YTFNRDAILVETTTGAKRALIDYRKNPPQPYNQK 173

Query: 184 ------WLIPICSGSERLRN-KDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGT 236
                 W  P      R+R   D  + HPTQKP ALL RI+++S+ P D +LDPF GS T
Sbjct: 174 KVPGNVWSFP------RVRYLMDEYENHPTQKPSALLKRIILASSNPSDTVLDPFAGSFT 227

Query: 237 SGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRTE 285
           +GAVA      FIGIE+  +Y+ +  +R++        EL  +  ++T+
Sbjct: 228 TGAVAAASGCKFIGIELNNEYVKMGLRRLSVTSHYSENELAKVKKRKTQ 276


>gi|213580282|ref|ZP_03362108.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-0664]
          Length = 267

 Score =  134 bits (337), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 95/280 (33%), Positives = 143/280 (51%), Gaps = 53/280 (18%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           KII G++++ L+KLP++S+DLIFADPPYN+  +           D + +SWD+ S     
Sbjct: 16  KIIHGDALTELKKLPSESIDLIFADPPYNIGKD----------FDGMVESWDEASFL--- 62

Query: 82  DAFTRAWLL----ACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPM 137
                AWL      C RVLK +GT++++ S  N+  I    + L F I + IVW   +  
Sbjct: 63  -----AWLYECIDECHRVLKKHGTMYIMNSTENMPYIDLKCRTL-FTIKSRIVWSYDSSG 116

Query: 138 PNFRGRRFQNAHETLIWASPSPKAKGYTFNYDAL------KAANEDVQMRSD-------- 183
              + + F + +E ++    +PK+  YTFN DA+       A    +  R +        
Sbjct: 117 VQAK-KYFGSMYEPILMMVKNPKS--YTFNRDAILVETTTGAKRALIDYRKNPPQPYNQK 173

Query: 184 ------WLIPICSGSERLRN-KDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGT 236
                 W  P      R+R   D  + HPTQKP ALL RI+++S+ P D +LDPF GS T
Sbjct: 174 KVPGNVWSFP------RVRYLMDEYENHPTQKPSALLKRIILASSNPSDTVLDPFAGSFT 227

Query: 237 SGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIEL 276
           +GAVA    R FIGIE+  +Y+ +  +R++        EL
Sbjct: 228 TGAVAAASGRKFIGIELNNEYVKMGLRRLSVTSHYSENEL 267


>gi|317130947|ref|YP_004097229.1| Site-specific DNA-methyltransferase (adenine-specific) [Bacillus
           cellulosilyticus DSM 2522]
 gi|315475895|gb|ADU32498.1| Site-specific DNA-methyltransferase (adenine-specific) [Bacillus
           cellulosilyticus DSM 2522]
          Length = 254

 Score =  134 bits (336), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 77/249 (30%), Positives = 123/249 (49%), Gaps = 10/249 (4%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           ++I + N    ++ +P +S+ L+ ADPPYN+   G            + + WD       
Sbjct: 11  NRIYQRNCTEGMKMIPGESISLVIADPPYNIGKKGSFIEAKDKHHHTIREDWDNIP-LNE 69

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           ++ F   W+  C RVLKP G+L   GS+HNI  I  +++   + +    +W KSNP P++
Sbjct: 70  FEKFNNDWINECFRVLKPGGSLLAWGSHHNIHIIAQLMEQTGYDMKPFYIWEKSNPAPSW 129

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
            GR    + E L+W +   K K +T+N D  K+ N    +++ +   +    E+ + +  
Sbjct: 130 SGRLPTTSTEYLLWGT---KGKNWTYNLDYAKSINNGKNIKNVFKTSLTPPKEKKKGR-- 184

Query: 201 EKLHPTQKP-EALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYID 259
               P QK  E L   ++   +  GDIIL PF GSGT   VAK   R FI  E K +YI 
Sbjct: 185 ---FPCQKRIEGLTDHLVKLHSLKGDIILVPFCGSGTECVVAKMYGRDFISFETKPEYIV 241

Query: 260 IATKRIASV 268
           +A  R+  +
Sbjct: 242 LANNRLDDI 250


>gi|213028799|ref|ZP_03343246.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Typhi str. 404ty]
          Length = 279

 Score =  134 bits (336), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 93/276 (33%), Positives = 141/276 (51%), Gaps = 45/276 (16%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           KII G++++ L+KLP++S+DLIFADPPYN+  +           D + +SWD+ S     
Sbjct: 16  KIIHGDALTELKKLPSESIDLIFADPPYNIGKD----------FDGMVESWDEASFL--- 62

Query: 82  DAFTRAWLL----ACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPM 137
                AWL      C RVLK +GT++++ S  N+  I    + L F I + IVW   +  
Sbjct: 63  -----AWLYECIDECHRVLKKHGTMYIMNSTENMPYIDLKCRTL-FTIKSRIVWSYDSSG 116

Query: 138 PNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRN 197
              + + F + +E ++    +PK+  YTFN DA+         R+  LI       +  N
Sbjct: 117 VQAK-KYFGSMYEPILMMVKNPKS--YTFNRDAILVETTTGAKRA--LIDYRKNPPQPYN 171

Query: 198 K-----------------DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAV 240
           +                 D  + HPTQKP ALL RI+++S+ P D +LDPF GS T+GAV
Sbjct: 172 QKKVPGNVWSFPRVRYLMDEYENHPTQKPSALLKRIILASSNPSDTVLDPFAGSFTTGAV 231

Query: 241 AKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIEL 276
           A    R FIGIE+  +Y+ +  +R++        EL
Sbjct: 232 AAASGRKFIGIELNNEYVKMGLRRLSVTSHYSENEL 267


>gi|237730180|ref|ZP_04560661.1| conserved hypothetical protein [Citrobacter sp. 30_2]
 gi|226908786|gb|EEH94704.1| conserved hypothetical protein [Citrobacter sp. 30_2]
          Length = 294

 Score =  133 bits (334), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 91/281 (32%), Positives = 148/281 (52%), Gaps = 37/281 (13%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           KII G++++ L+KLP++SV+LIFADPPYN+  +           D + +SWD+    EA+
Sbjct: 16  KIILGDALTELKKLPSESVELIFADPPYNIGKD----------FDGMVESWDE----EAF 61

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFR 141
            A+    +  C R+LKP+GT++++ S  N+  I    + L F I + IVW   +     +
Sbjct: 62  LAWLFECIDECHRILKPHGTMYIMNSTENMPYIDLKCRPL-FTIKSRIVWSYDSSGVQAK 120

Query: 142 GRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK--- 198
              F + +E ++        K YTFN D +    +    R+  LI       +  N+   
Sbjct: 121 NY-FGSMYEPILMMVKD--QKNYTFNRDDILVEAKTGAKRA--LIDYRKNPPQPYNQKKV 175

Query: 199 --------------DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKL 244
                         D  + HPTQKP+ALL RI+++S+ P D +LDPF GS T+GA A +L
Sbjct: 176 PGNVWEFPRVRYLMDEYENHPTQKPKALLERIILASSNPDDKVLDPFAGSFTTGATAVEL 235

Query: 245 RRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRTE 285
            R F+GIE+  +Y+ +  +R++       IEL  +  ++T+
Sbjct: 236 GRKFVGIEINTEYVKMGLRRLSIGSHFSEIELAKVKKRKTK 276


>gi|209757524|gb|ACI77074.1| putative methyltransferase [Escherichia coli]
          Length = 296

 Score =  132 bits (333), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 97/283 (34%), Positives = 142/283 (50%), Gaps = 45/283 (15%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II GN+++ L+KLP +SVDLIFADPPYN+  N           D + ++W +       D
Sbjct: 19  IIHGNALAELKKLPTESVDLIFADPPYNIGKN----------FDGLIEAWKE-------D 61

Query: 83  AFTRAWLLA----CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WLL     C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 62  LFI-DWLLEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 119

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
             + + + + +E ++       AK YTFN DA+    +    R+  LI       +  N 
Sbjct: 120 QAK-KHYGSMYEPILMMVKD--AKNYTFNGDAILVEAKTGSQRA--LIDYRKNPPQPYNH 174

Query: 199 -----------------DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVA 241
                            D  + HPTQKPEALL RI+++S+ PGDI+LDPF GS T+GAVA
Sbjct: 175 QKVPGNVWDFPRVRYLMDEYENHPTQKPEALLKRIILASSNPGDIVLDPFAGSFTTGAVA 234

Query: 242 KKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRT 284
               R FIGIE+  +YI +  +R+         EL  +  ++T
Sbjct: 235 IASGRKFIGIEINSEYIKMGLRRLDVASHYSAEELAKVKKRKT 277


>gi|331649063|ref|ZP_08350151.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli M605]
 gi|331042810|gb|EGI14952.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli M605]
          Length = 296

 Score =  132 bits (333), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 97/287 (33%), Positives = 144/287 (50%), Gaps = 53/287 (18%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II+G++++ L+KLPA+SVDLIFADPPYN+  N           D + ++W +       D
Sbjct: 19  IIQGDALTELKKLPAESVDLIFADPPYNIGKN----------FDGLIEAWKE-------D 61

Query: 83  AFTRAWLLA----CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WL      C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 62  LFID-WLFEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 119

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRS---------------- 182
             + + + + +E ++       AK YTFN DA+    +    R+                
Sbjct: 120 QAK-KHYGSMYEPILMMVKD--AKNYTFNGDAILVEAKTGSQRALINYRKNPPQPYNHQK 176

Query: 183 ----DWLIPICSGSERLRN-KDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTS 237
                W  P      R+R   D  + HPTQKPEALL RI+++S+ PGDI+LDPF GS T+
Sbjct: 177 VPGNVWDFP------RVRYLMDEYENHPTQKPEALLKRIILASSNPGDIVLDPFAGSFTT 230

Query: 238 GAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRT 284
           GAVA    R FIGIE+  +YI +  +R+         EL  +  ++T
Sbjct: 231 GAVAVASGRKFIGIELNSEYIKMGLRRLDVASHYSAEELAKVKKRKT 277


>gi|330909313|gb|EGH37827.1| adenine-specific methyltransferase [Escherichia coli AA86]
          Length = 294

 Score =  132 bits (333), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 97/287 (33%), Positives = 144/287 (50%), Gaps = 53/287 (18%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II+G++++ L+KLPA+SVDLIFADPPYN+  N           D + ++W +       D
Sbjct: 17  IIQGDALTELKKLPAESVDLIFADPPYNIGKN----------FDGLIEAWKE-------D 59

Query: 83  AFTRAWLLA----CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WL      C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 60  LFID-WLFEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 117

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRS---------------- 182
             + + + + +E ++       AK YTFN DA+    +    R+                
Sbjct: 118 QAK-KHYGSMYEPILMMVKD--AKNYTFNGDAILVEAKTGSQRALINYRKNPPQPYNHQK 174

Query: 183 ----DWLIPICSGSERLRN-KDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTS 237
                W  P      R+R   D  + HPTQKPEALL RI+++S+ PGDI+LDPF GS T+
Sbjct: 175 VPGNVWDFP------RVRYLMDEYENHPTQKPEALLKRIILASSNPGDIVLDPFAGSFTT 228

Query: 238 GAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRT 284
           GAVA    R FIGIE+  +YI +  +R+         EL  +  ++T
Sbjct: 229 GAVAVASGRKFIGIELNSEYIKMGLRRLDVASHYSAEELAKVKKRKT 275


>gi|331674779|ref|ZP_08375538.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli TA280]
 gi|331068218|gb|EGI39614.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli TA280]
          Length = 296

 Score =  132 bits (332), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 95/283 (33%), Positives = 143/283 (50%), Gaps = 45/283 (15%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II+G++++ L+K+PA+SVDLIFADPPYN+  N           D + ++W +       D
Sbjct: 19  IIQGDALTELKKIPAESVDLIFADPPYNIGKN----------FDGLIEAWKE-------D 61

Query: 83  AFTRAWLLA----CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WL      C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 62  LFID-WLFEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 119

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
             + + + + +E ++       AK YTFN DA+    +    R+  LI       +  N 
Sbjct: 120 QAK-KHYGSMYEPILMMVKD--AKNYTFNGDAILVEAKTGSQRA--LIDYRKNPPQPYNH 174

Query: 199 -----------------DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVA 241
                            D  + HPTQKPEALL RI+++S+ PGDI+LDPF GS T+GAVA
Sbjct: 175 QKVPGNVWDFPRVRYLMDEYENHPTQKPEALLKRIILASSNPGDIVLDPFAGSFTTGAVA 234

Query: 242 KKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRT 284
               R FIGIE+  +YI +  +R+         EL  +  ++T
Sbjct: 235 AASGRKFIGIEINSEYIKMGLRRLDVASHYSAEELAKVKKRKT 277


>gi|237705980|ref|ZP_04536461.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|26110282|gb|AAN82468.1|AE016767_228 Hypothetical adenine-specific methylase yhdJ [Escherichia coli
           CFT073]
 gi|91074267|gb|ABE09148.1| hypothetical adenine-specific methylase YhdJ [Escherichia coli
           UTI89]
 gi|226899020|gb|EEH85279.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
          Length = 296

 Score =  132 bits (332), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 97/287 (33%), Positives = 144/287 (50%), Gaps = 53/287 (18%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II+G++++ L+KLPA+SVDLIFADPPYN+  N           D + ++W +       D
Sbjct: 19  IIQGDALTELKKLPAESVDLIFADPPYNIGKN----------FDGLIEAWKE-------D 61

Query: 83  AFTRAWLLA----CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WL      C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 62  LFID-WLFEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 119

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRS---------------- 182
             + + + + +E ++       AK YTFN DA+    +    R+                
Sbjct: 120 QAK-KHYGSMYEPILMMVKD--AKNYTFNGDAILVEAKTGSQRALINYRKNPPQPYNHQK 176

Query: 183 ----DWLIPICSGSERLRN-KDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTS 237
                W  P      R+R   D  + HPTQKPEALL RI+++S+ PGDI+LDPF GS T+
Sbjct: 177 VPGNVWDFP------RVRYLMDEYENHPTQKPEALLKRIILASSNPGDIVLDPFAGSFTT 230

Query: 238 GAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRT 284
           GAVA    R FIGIE+  +YI +  +R+         EL  +  ++T
Sbjct: 231 GAVAVASGRKFIGIEINSEYIKMGLRRLDVASHYSAEELAKVKKRKT 277


>gi|110643506|ref|YP_671236.1| putative methyltransferase [Escherichia coli 536]
 gi|191173825|ref|ZP_03035346.1| DNA methylase, N4/N6-methyltransferase family [Escherichia coli
           F11]
 gi|300979712|ref|ZP_07174662.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 200-1]
 gi|110345098|gb|ABG71335.1| hypothetical adenine-specific methylase YhdJ [Escherichia coli 536]
 gi|190905875|gb|EDV65493.1| DNA methylase, N4/N6-methyltransferase family [Escherichia coli
           F11]
 gi|300307930|gb|EFJ62450.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 200-1]
 gi|315300926|gb|EFU60146.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 16-3]
 gi|324015871|gb|EGB85090.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 60-1]
          Length = 294

 Score =  132 bits (332), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 96/283 (33%), Positives = 143/283 (50%), Gaps = 45/283 (15%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II+G++++ L+KLPA+SVDLIFADPPYN+  N           D + ++W +       D
Sbjct: 17  IIQGDALTELKKLPAESVDLIFADPPYNIGKN----------FDGLIEAWKE-------D 59

Query: 83  AFTRAWLLA----CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WL      C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 60  LFI-DWLFEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 117

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
             + + + + +E ++       AK YTFN DA+    +    R+  LI       +  N 
Sbjct: 118 QAK-KHYGSMYEPILMMVKD--AKNYTFNGDAILVEAKTGSQRA--LIDYRKNPPQPYNH 172

Query: 199 -----------------DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVA 241
                            D  + HPTQKPEALL RI+++S+ PGDI+LDPF GS T+GAVA
Sbjct: 173 QKVPGNVWDFPRVRYLMDEYENHPTQKPEALLKRIILASSNPGDIVLDPFAGSFTTGAVA 232

Query: 242 KKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRT 284
               R FIGIE+  +YI +  +R+         EL  +  ++T
Sbjct: 233 VASGRKFIGIEINSEYIKMGLRRLDVASHYSAEELAKVKKRKT 275


>gi|117625553|ref|YP_858876.1| putative methyltransferase [Escherichia coli APEC O1]
 gi|161486097|ref|NP_755894.2| putative methyltransferase [Escherichia coli CFT073]
 gi|162138359|ref|YP_542679.2| putative methyltransferase [Escherichia coli UTI89]
 gi|218560331|ref|YP_002393244.1| methyltransferase [Escherichia coli S88]
 gi|218691553|ref|YP_002399765.1| putative methyltransferase [Escherichia coli ED1a]
 gi|227887988|ref|ZP_04005793.1| site-specific DNA-methyltransferase (adenine-specific) [Escherichia
           coli 83972]
 gi|300991060|ref|ZP_07179481.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 45-1]
 gi|301047882|ref|ZP_07194929.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 185-1]
 gi|306816395|ref|ZP_07450527.1| putative methyltransferase [Escherichia coli NC101]
 gi|331659551|ref|ZP_08360493.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli TA206]
 gi|115514677|gb|ABJ02752.1| putative adenine-specific methylase YhdJ [Escherichia coli APEC O1]
 gi|218367100|emb|CAR04873.1| methyltransferase [Escherichia coli S88]
 gi|218429117|emb|CAR09924.1| methyltransferase [Escherichia coli ED1a]
 gi|222034978|emb|CAP77721.1| Uncharacterized adenine-specific methylase yhdJ [Escherichia coli
           LF82]
 gi|227835384|gb|EEJ45850.1| site-specific DNA-methyltransferase (adenine-specific) [Escherichia
           coli 83972]
 gi|281180304|dbj|BAI56634.1| putative methyltransferase [Escherichia coli SE15]
 gi|294489786|gb|ADE88542.1| DNA methylase, N4/N6-methyltransferase family [Escherichia coli
           IHE3034]
 gi|300300225|gb|EFJ56610.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 185-1]
 gi|300406981|gb|EFJ90519.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 45-1]
 gi|305849960|gb|EFM50419.1| putative methyltransferase [Escherichia coli NC101]
 gi|307555356|gb|ADN48131.1| DNA methylase [Escherichia coli ABU 83972]
 gi|307625138|gb|ADN69442.1| putative methyltransferase [Escherichia coli UM146]
 gi|312947819|gb|ADR28646.1| putative methyltransferase [Escherichia coli O83:H1 str. NRG 857C]
 gi|315294813|gb|EFU54156.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 153-1]
 gi|323951218|gb|EGB47093.1| DNA methylase [Escherichia coli H252]
 gi|323957590|gb|EGB53304.1| DNA methylase [Escherichia coli H263]
 gi|324009091|gb|EGB78310.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 57-2]
 gi|331054133|gb|EGI26162.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli TA206]
          Length = 294

 Score =  132 bits (332), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 97/287 (33%), Positives = 144/287 (50%), Gaps = 53/287 (18%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II+G++++ L+KLPA+SVDLIFADPPYN+  N           D + ++W +       D
Sbjct: 17  IIQGDALTELKKLPAESVDLIFADPPYNIGKN----------FDGLIEAWKE-------D 59

Query: 83  AFTRAWLLA----CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WL      C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 60  LFID-WLFEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 117

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRS---------------- 182
             + + + + +E ++       AK YTFN DA+    +    R+                
Sbjct: 118 QAK-KHYGSMYEPILMMVKD--AKNYTFNGDAILVEAKTGSQRALINYRKNPPQPYNHQK 174

Query: 183 ----DWLIPICSGSERLRN-KDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTS 237
                W  P      R+R   D  + HPTQKPEALL RI+++S+ PGDI+LDPF GS T+
Sbjct: 175 VPGNVWDFP------RVRYLMDEYENHPTQKPEALLKRIILASSNPGDIVLDPFAGSFTT 228

Query: 238 GAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRT 284
           GAVA    R FIGIE+  +YI +  +R+         EL  +  ++T
Sbjct: 229 GAVAVASGRKFIGIEINSEYIKMGLRRLDVASHYSAEELAKVKKRKT 275


>gi|320194748|gb|EFW69378.1| Adenine-specific methyltransferase [Escherichia coli WV_060327]
          Length = 294

 Score =  132 bits (332), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 96/283 (33%), Positives = 143/283 (50%), Gaps = 45/283 (15%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II+G++++ L+KLPA+SVDLIFADPPYN+  N           D + ++W +       D
Sbjct: 17  IIQGDALTELKKLPAESVDLIFADPPYNIGKN----------FDGLIEAWKE-------D 59

Query: 83  AFTRAWLLA----CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WL      C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 60  LFI-DWLFEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 117

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
             + + + + +E ++       AK YTFN DA+    +    R+  LI       +  N 
Sbjct: 118 QAK-KHYGSMYEPILMMVKD--AKNYTFNGDAILVEAKTGSQRA--LIDYRKNPPQPYNH 172

Query: 199 -----------------DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVA 241
                            D  + HPTQKPEALL RI+++S+ PGDI+LDPF GS T+GAVA
Sbjct: 173 QKVPGNVWDFPRVRYLMDEYENHPTQKPEALLKRIILASSNPGDIVLDPFAGSFTTGAVA 232

Query: 242 KKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRT 284
               R FIGIE+  +YI +  +R+         EL  +  ++T
Sbjct: 233 IASGRKFIGIEINSEYIKMGLRRLDVASHYSAEELAKVKKRKT 275


>gi|323966440|gb|EGB61874.1| DNA methylase [Escherichia coli M863]
 gi|327251356|gb|EGE63045.1| hypothetical protein ECSTEC7V_3896 [Escherichia coli STEC_7v]
          Length = 294

 Score =  132 bits (331), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 95/283 (33%), Positives = 143/283 (50%), Gaps = 45/283 (15%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II+G++++ L+K+PA+SVDLIFADPPYN+  N           D + ++W +       D
Sbjct: 17  IIQGDALTELKKIPAESVDLIFADPPYNIGKN----------FDGLIEAWKE-------D 59

Query: 83  AFTRAWLLA----CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WL      C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 60  LFI-DWLFEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 117

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
             + + + + +E ++       AK YTFN DA+    +    R+  LI       +  N 
Sbjct: 118 QAK-KHYGSMYEPILMMVKD--AKNYTFNGDAILVEAKTGSQRA--LIDYRKNPPQPYNH 172

Query: 199 -----------------DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVA 241
                            D  + HPTQKPEALL RI+++S+ PGDI+LDPF GS T+GAVA
Sbjct: 173 QKVPGNVWDFPRVRYLMDEYENHPTQKPEALLKRIILASSNPGDIVLDPFAGSFTTGAVA 232

Query: 242 KKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRT 284
               R FIGIE+  +YI +  +R+         EL  +  ++T
Sbjct: 233 AASGRKFIGIEINSEYIKMGLRRLDVTSHYSAEELAKVKKRKT 275


>gi|218702035|ref|YP_002409664.1| putative methyltransferase [Escherichia coli IAI39]
 gi|300937389|ref|ZP_07152224.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 21-1]
 gi|218372021|emb|CAR19877.1| methyltransferase [Escherichia coli IAI39]
 gi|300457563|gb|EFK21056.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 21-1]
 gi|323189126|gb|EFZ74410.1| hypothetical protein ECRN5871_2725 [Escherichia coli RN587/1]
 gi|323979019|gb|EGB74097.1| DNA methylase [Escherichia coli TW10509]
          Length = 294

 Score =  132 bits (331), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 95/283 (33%), Positives = 143/283 (50%), Gaps = 45/283 (15%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II+G++++ L+K+PA+SVDLIFADPPYN+  N           D + ++W +       D
Sbjct: 17  IIQGDALTELKKIPAESVDLIFADPPYNIGKN----------FDGLIEAWKE-------D 59

Query: 83  AFTRAWLLA----CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WL      C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 60  LFID-WLFEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 117

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
             + + + + +E ++       AK YTFN DA+    +    R+  LI       +  N 
Sbjct: 118 QAK-KHYGSMYEPILMMVKD--AKNYTFNGDAILVEAKTGSQRA--LIDYRKNPPQPYNH 172

Query: 199 -----------------DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVA 241
                            D  + HPTQKPEALL RI+++S+ PGDI+LDPF GS T+GAVA
Sbjct: 173 QKVPGNVWDFPRVRYLMDEYENHPTQKPEALLKRIILASSNPGDIVLDPFAGSFTTGAVA 232

Query: 242 KKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRT 284
               R FIGIE+  +YI +  +R+         EL  +  ++T
Sbjct: 233 AASGRKFIGIEINSEYIKMGLRRLDVASHYSAEELAKVKKRKT 275


>gi|331664871|ref|ZP_08365776.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli TA143]
 gi|284923276|emb|CBG36370.1| putative DNA methylase [Escherichia coli 042]
 gi|331058119|gb|EGI30101.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli TA143]
          Length = 285

 Score =  132 bits (331), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 96/286 (33%), Positives = 144/286 (50%), Gaps = 45/286 (15%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II+G++++ L+K+PA+SVDLIFADPPYN+  N           D + ++W +       D
Sbjct: 17  IIQGDALTELKKIPAESVDLIFADPPYNIGKN----------FDGLIEAWKE-------D 59

Query: 83  AFTRAWLLA----CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WL      C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 60  LFI-DWLFEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 117

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
             + + + + +E ++       AK YTFN DA+    +    R+  LI       +  N 
Sbjct: 118 QAK-KHYGSMYEPILMMVKD--AKNYTFNGDAILVEAKTGSQRA--LIDYRKNPPQPYNH 172

Query: 199 -----------------DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVA 241
                            D  + HPTQKPEALL RI+++S+ PGDI+LDPF GS T+GAVA
Sbjct: 173 QKVPGNVWDFPRVRYLMDEYENHPTQKPEALLKRIILASSNPGDIVLDPFAGSFTTGAVA 232

Query: 242 KKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRTEPR 287
               R FIGIE+  +YI +  +R+         EL  +  ++T  R
Sbjct: 233 VASGRKFIGIEINSEYIKMGLRRLDVTSHYSAEELAKVKKRKTGNR 278


>gi|218706876|ref|YP_002414395.1| putative methyltransferase [Escherichia coli UMN026]
 gi|293406864|ref|ZP_06650790.1| methyltransferase [Escherichia coli FVEC1412]
 gi|298382605|ref|ZP_06992202.1| adenine-specific DNA-methyltransferase [Escherichia coli FVEC1302]
 gi|300898034|ref|ZP_07116405.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 198-1]
 gi|218433973|emb|CAR14890.1| methyltransferase [Escherichia coli UMN026]
 gi|291426870|gb|EFE99902.1| methyltransferase [Escherichia coli FVEC1412]
 gi|298277745|gb|EFI19261.1| adenine-specific DNA-methyltransferase [Escherichia coli FVEC1302]
 gi|300358253|gb|EFJ74123.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 198-1]
          Length = 294

 Score =  131 bits (330), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 96/283 (33%), Positives = 142/283 (50%), Gaps = 45/283 (15%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II+G++++ L+KLPA+SVDLIFADPPYN+  N           D + ++W +       D
Sbjct: 17  IIQGDALTELKKLPAESVDLIFADPPYNIGKN----------FDGLIEAWKE-------D 59

Query: 83  AFTRAWLLA----CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WL      C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 60  LFI-DWLFEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 117

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
             + + + + +E ++       AK YTFN DA+    +    R+  LI       +  N 
Sbjct: 118 QAK-KHYGSMYEPILMMVKD--AKNYTFNGDAILVEAKTGSQRA--LIDYRKNPPQPYNH 172

Query: 199 -----------------DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVA 241
                            D  + HPTQKPEALL RI++ S+ PGDI+LDPF GS T+GAVA
Sbjct: 173 QKVPGNVWDFPRVRYLMDEYENHPTQKPEALLKRIILGSSNPGDIVLDPFAGSFTTGAVA 232

Query: 242 KKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRT 284
               R FIGIE+  +YI +  +R+         EL  +  ++T
Sbjct: 233 VASGRKFIGIEINSEYIKMGLRRLDVASHYSAEELAKVKKRKT 275


>gi|293416687|ref|ZP_06659326.1| adenine-specific DNA-methyltransferase [Escherichia coli B185]
 gi|331654860|ref|ZP_08355860.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli M718]
 gi|291432043|gb|EFF05026.1| adenine-specific DNA-methyltransferase [Escherichia coli B185]
 gi|331048242|gb|EGI20319.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli M718]
          Length = 296

 Score =  131 bits (330), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 96/283 (33%), Positives = 142/283 (50%), Gaps = 45/283 (15%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II G++++ L+KLP +SVDLIFADPPYN+  N           D + ++W +       D
Sbjct: 19  IIHGDALAELKKLPTESVDLIFADPPYNIGKN----------FDGLIEAWKE-------D 61

Query: 83  AFTRAWLLA----CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WLL     C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 62  LFI-DWLLEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 119

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
             + + + + +E ++       AK YTFN DA+    +    R+  LI       +  N 
Sbjct: 120 QAK-KHYGSMYEPILMMVKD--AKNYTFNGDAILVEAKTGSQRA--LIDYRKNPPQPYNH 174

Query: 199 -----------------DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVA 241
                            D  + HPTQKPEALL RI+++S+ PGDI+LDPF GS T+GAVA
Sbjct: 175 QKVPGNVWDFPRVRYLMDEYENHPTQKPEALLKRIILASSNPGDIVLDPFAGSFTTGAVA 234

Query: 242 KKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRT 284
               R FIGIE+  +YI +  +R+         EL  +  ++T
Sbjct: 235 VSSGRKFIGIEINSEYIKMGLRRLDVASHYSAEELAKVKKRKT 277


>gi|293412630|ref|ZP_06655353.1| adenine-specific methylase yhdJ [Escherichia coli B354]
 gi|291469401|gb|EFF11892.1| adenine-specific methylase yhdJ [Escherichia coli B354]
          Length = 296

 Score =  131 bits (330), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 96/286 (33%), Positives = 144/286 (50%), Gaps = 45/286 (15%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II+G++++ L+K+PA+SVDLIFADPPYN+  N           D + ++W +       D
Sbjct: 19  IIQGDALTELKKIPAESVDLIFADPPYNIGKN----------FDGLIEAWKE-------D 61

Query: 83  AFTRAWLLA----CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WL      C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 62  LFI-DWLFEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 119

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
             + + + + +E ++       AK YTFN DA+    +    R+  LI       +  N 
Sbjct: 120 QAK-KHYGSMYEPILMMVKD--AKNYTFNGDAILVEAKTGSQRA--LIDYRKNPPQPYNH 174

Query: 199 -----------------DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVA 241
                            D  + HPTQKPEALL RI+++S+ PGDI+LDPF GS T+GAVA
Sbjct: 175 QKVPGNVWDFPRVRYLMDEYENHPTQKPEALLKRIILASSNPGDIVLDPFAGSFTTGAVA 234

Query: 242 KKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRTEPR 287
               R FIGIE+  +YI +  +R+         EL  +  ++T  R
Sbjct: 235 VASGRKFIGIEINSEYIKMGLRRLDVASHYSAEELAKVKKRKTGNR 280


>gi|215488569|ref|YP_002331000.1| putative methyltransferase [Escherichia coli O127:H6 str. E2348/69]
 gi|312968407|ref|ZP_07782616.1| uncharacterized adenine-specific methylase yhdJ [Escherichia coli
           2362-75]
 gi|215266641|emb|CAS11080.1| predicted methyltransferase [Escherichia coli O127:H6 str.
           E2348/69]
 gi|312286625|gb|EFR14536.1| uncharacterized adenine-specific methylase yhdJ [Escherichia coli
           2362-75]
          Length = 294

 Score =  131 bits (330), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 95/283 (33%), Positives = 143/283 (50%), Gaps = 45/283 (15%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II+G++++ L+K+PA+SVDLIFADPPYN+  N           D + ++W +       D
Sbjct: 17  IIQGDALTELKKIPAESVDLIFADPPYNIGKN----------FDGLIEAWKE-------D 59

Query: 83  AFTRAWLLA----CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WL      C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 60  LFI-DWLFEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 117

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
             + + + + +E ++       AK YTFN DA+    +    R+  LI       +  N 
Sbjct: 118 QAK-KHYGSMYEPILMMVKD--AKNYTFNGDAILVEAKTGSQRA--LIDYRKNPPQPYNH 172

Query: 199 -----------------DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVA 241
                            D  + HPTQKPEALL RI+++S+ PGDI+LDPF GS T+GAVA
Sbjct: 173 QKVPGNVWDFPRVRYLMDEYENHPTQKPEALLKRIILASSNPGDIVLDPFAGSFTTGAVA 232

Query: 242 KKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRT 284
               R FIGIE+  +YI +  +R+         EL  +  ++T
Sbjct: 233 VASGRKFIGIEINSEYIKMGLRRLDVASHYSAEELAKVKKRKT 275


>gi|170680849|ref|YP_001745533.1| putative methyltransferase [Escherichia coli SMS-3-5]
 gi|170518567|gb|ACB16745.1| DNA methylase, N4/N6-methyltransferase family [Escherichia coli
           SMS-3-5]
          Length = 294

 Score =  131 bits (330), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 95/283 (33%), Positives = 142/283 (50%), Gaps = 45/283 (15%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II+G++++ L+K+PA SVDLIFADPPYN+  N           D + ++W +       D
Sbjct: 17  IIQGDALTELKKIPADSVDLIFADPPYNIGKN----------FDGLIEAWKE-------D 59

Query: 83  AFTRAWLLA----CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WL      C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 60  LFID-WLFEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 117

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
             + + + + +E ++       AK YTFN DA+    +    R+  LI       +  N 
Sbjct: 118 QAK-KHYGSMYEPILMMVKD--AKNYTFNGDAILVEAKTGSQRA--LIDYRKNPPQPYNH 172

Query: 199 -----------------DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVA 241
                            D  + HPTQKPEALL RI+++S+ PGDI+LDPF GS T+GAVA
Sbjct: 173 QKVPGNVWDFPRVRYLMDEYENHPTQKPEALLKRIILASSNPGDIVLDPFAGSFTTGAVA 232

Query: 242 KKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRT 284
               R FIGIE+  +YI +  +R+         EL  +  ++T
Sbjct: 233 AASGRKFIGIEINSEYIKMGLRRLDVASHYSAEELAKVKKRKT 275


>gi|331684902|ref|ZP_08385494.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli H299]
 gi|331078517|gb|EGI49723.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli H299]
          Length = 294

 Score =  131 bits (329), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 95/283 (33%), Positives = 143/283 (50%), Gaps = 45/283 (15%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II+G++++ L+K+PA+SVDLIFADPPYN+  N           D + ++W +       D
Sbjct: 17  IIQGDALTELKKIPAESVDLIFADPPYNIGKN----------FDGLIEAWKE-------D 59

Query: 83  AFTRAWLLA----CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WL      C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 60  LFI-DWLFEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 117

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
             + + + + +E ++       AK YTFN DA+    +    R+  LI       +  N 
Sbjct: 118 QAK-KHYGSMYEPILMMVKD--AKNYTFNGDAILVEAKTGSQRA--LIDYRKNPPQPYNH 172

Query: 199 -----------------DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVA 241
                            D  + HPTQKPEALL RI+++S+ PGDI+LDPF GS T+GAVA
Sbjct: 173 QKVPGNVWDFPRVRYLMDEYENHPTQKPEALLKRIILASSNPGDIVLDPFAGSFTTGAVA 232

Query: 242 KKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRT 284
               R FIGIE+  +YI +  +R+         EL  +  ++T
Sbjct: 233 VASGRKFIGIEINSEYIKMGLRRLDVASHYSAEELAKVKKRKT 275


>gi|12517892|gb|AAG58390.1|AE005554_1 putative methyltransferase [Escherichia coli O157:H7 str. EDL933]
 gi|13363607|dbj|BAB37557.1| putative methyltransferase [Escherichia coli O157:H7 str. Sakai]
 gi|209757518|gb|ACI77071.1| putative methyltransferase [Escherichia coli]
 gi|209757520|gb|ACI77072.1| putative methyltransferase [Escherichia coli]
 gi|209757522|gb|ACI77073.1| putative methyltransferase [Escherichia coli]
 gi|209757526|gb|ACI77075.1| putative methyltransferase [Escherichia coli]
          Length = 296

 Score =  131 bits (329), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 96/283 (33%), Positives = 142/283 (50%), Gaps = 45/283 (15%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II G++++ L+KLP +SVDLIFADPPYN+  N           D + ++W +       D
Sbjct: 19  IIHGDALAELKKLPTESVDLIFADPPYNIGKN----------FDGLIEAWKE-------D 61

Query: 83  AFTRAWLLA----CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WLL     C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 62  LFI-DWLLEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 119

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
             + + + + +E ++       AK YTFN DA+    +    R+  LI       +  N 
Sbjct: 120 QAK-KHYGSMYEPILMMVKD--AKNYTFNGDAILVEAKTGSQRA--LIDYRKNPPQPYNH 174

Query: 199 -----------------DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVA 241
                            D  + HPTQKPEALL RI+++S+ PGDI+LDPF GS T+GAVA
Sbjct: 175 QKVPGNVWDFPRVRYLMDEYENHPTQKPEALLKRIILASSNPGDIVLDPFAGSFTTGAVA 234

Query: 242 KKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRT 284
               R FIGIE+  +YI +  +R+         EL  +  ++T
Sbjct: 235 IASGRKFIGIEINSEYIKMGLRRLDVASHYSAEELAKVKKRKT 277


>gi|38704155|ref|NP_312161.2| methyltransferase [Escherichia coli O157:H7 str. Sakai]
 gi|161367510|ref|NP_289830.2| putative methyltransferase [Escherichia coli O157:H7 EDL933]
 gi|168752562|ref|ZP_02777584.1| DNA methylase, N4/N6-methyltransferase family [Escherichia coli
           O157:H7 str. EC4113]
 gi|168764877|ref|ZP_02789884.1| DNA methylase, N4/N6-methyltransferase family [Escherichia coli
           O157:H7 str. EC4501]
 gi|168769125|ref|ZP_02794132.1| DNA methylase, N4/N6-methyltransferase family [Escherichia coli
           O157:H7 str. EC4486]
 gi|168777678|ref|ZP_02802685.1| DNA methylase, N4/N6-methyltransferase family [Escherichia coli
           O157:H7 str. EC4196]
 gi|168783831|ref|ZP_02808838.1| DNA methylase, N4/N6-methyltransferase family [Escherichia coli
           O157:H7 str. EC4076]
 gi|168786155|ref|ZP_02811162.1| DNA methylase, N4/N6-methyltransferase family [Escherichia coli
           O157:H7 str. EC869]
 gi|168802604|ref|ZP_02827611.1| DNA methylase, N4/N6-methyltransferase family [Escherichia coli
           O157:H7 str. EC508]
 gi|195940006|ref|ZP_03085388.1| putative methyltransferase [Escherichia coli O157:H7 str. EC4024]
 gi|208807568|ref|ZP_03249905.1| DNA methylase, N4/N6-methyltransferase family [Escherichia coli
           O157:H7 str. EC4206]
 gi|208812864|ref|ZP_03254193.1| DNA methylase, N4/N6-methyltransferase family [Escherichia coli
           O157:H7 str. EC4045]
 gi|208819259|ref|ZP_03259579.1| DNA methylase, N4/N6-methyltransferase family [Escherichia coli
           O157:H7 str. EC4042]
 gi|209400072|ref|YP_002272724.1| DNA methylase, N4/N6-methyltransferase family [Escherichia coli
           O157:H7 str. EC4115]
 gi|217327970|ref|ZP_03444053.1| DNA methylase, N4/N6-methyltransferase family [Escherichia coli
           O157:H7 str. TW14588]
 gi|254795205|ref|YP_003080042.1| putative methyltransferase [Escherichia coli O157:H7 str. TW14359]
 gi|261228267|ref|ZP_05942548.1| predicted methyltransferase [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261255123|ref|ZP_05947656.1| predicted methyltransferase [Escherichia coli O157:H7 str. FRIK966]
 gi|291284629|ref|YP_003501447.1| DNA methylase, N4/N6-methyltransferase family [Escherichia coli
           O55:H7 str. CB9615]
 gi|187767137|gb|EDU30981.1| DNA methylase, N4/N6-methyltransferase family [Escherichia coli
           O157:H7 str. EC4196]
 gi|188013624|gb|EDU51746.1| DNA methylase, N4/N6-methyltransferase family [Escherichia coli
           O157:H7 str. EC4113]
 gi|188998858|gb|EDU67844.1| DNA methylase, N4/N6-methyltransferase family [Escherichia coli
           O157:H7 str. EC4076]
 gi|189361843|gb|EDU80262.1| DNA methylase, N4/N6-methyltransferase family [Escherichia coli
           O157:H7 str. EC4486]
 gi|189365192|gb|EDU83608.1| DNA methylase, N4/N6-methyltransferase family [Escherichia coli
           O157:H7 str. EC4501]
 gi|189373855|gb|EDU92271.1| DNA methylase, N4/N6-methyltransferase family [Escherichia coli
           O157:H7 str. EC869]
 gi|189375426|gb|EDU93842.1| DNA methylase, N4/N6-methyltransferase family [Escherichia coli
           O157:H7 str. EC508]
 gi|208727369|gb|EDZ76970.1| DNA methylase, N4/N6-methyltransferase family [Escherichia coli
           O157:H7 str. EC4206]
 gi|208734141|gb|EDZ82828.1| DNA methylase, N4/N6-methyltransferase family [Escherichia coli
           O157:H7 str. EC4045]
 gi|208739382|gb|EDZ87064.1| DNA methylase, N4/N6-methyltransferase family [Escherichia coli
           O157:H7 str. EC4042]
 gi|209161472|gb|ACI38905.1| DNA methylase, N4/N6-methyltransferase family [Escherichia coli
           O157:H7 str. EC4115]
 gi|217320337|gb|EEC28762.1| DNA methylase, N4/N6-methyltransferase family [Escherichia coli
           O157:H7 str. TW14588]
 gi|254594605|gb|ACT73966.1| predicted methyltransferase [Escherichia coli O157:H7 str. TW14359]
 gi|290764502|gb|ADD58463.1| DNA methylase, N4/N6-methyltransferase family [Escherichia coli
           O55:H7 str. CB9615]
 gi|320189609|gb|EFW64268.1| Adenine-specific methyltransferase [Escherichia coli O157:H7 str.
           EC1212]
 gi|320645624|gb|EFX14633.1| putative methyltransferase [Escherichia coli O157:H- str. 493-89]
 gi|320650934|gb|EFX19391.1| putative methyltransferase [Escherichia coli O157:H- str. H 2687]
 gi|320656315|gb|EFX24227.1| putative methyltransferase [Escherichia coli O55:H7 str. 3256-97 TW
           07815]
 gi|320662005|gb|EFX29413.1| putative methyltransferase [Escherichia coli O55:H7 str. USDA 5905]
 gi|326337957|gb|EGD61791.1| Adenine-specific methyltransferase [Escherichia coli O157:H7 str.
           1125]
 gi|326347526|gb|EGD71251.1| Adenine-specific methyltransferase [Escherichia coli O157:H7 str.
           1044]
          Length = 294

 Score =  131 bits (329), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 96/283 (33%), Positives = 142/283 (50%), Gaps = 45/283 (15%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II G++++ L+KLP +SVDLIFADPPYN+  N           D + ++W +       D
Sbjct: 17  IIHGDALAELKKLPTESVDLIFADPPYNIGKN----------FDGLIEAWKE-------D 59

Query: 83  AFTRAWLLA----CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WLL     C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 60  LFI-DWLLEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 117

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
             + + + + +E ++       AK YTFN DA+    +    R+  LI       +  N 
Sbjct: 118 QAK-KHYGSMYEPILMMVKD--AKNYTFNGDAILVEAKTGSQRA--LIDYRKNPPQPYNH 172

Query: 199 -----------------DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVA 241
                            D  + HPTQKPEALL RI+++S+ PGDI+LDPF GS T+GAVA
Sbjct: 173 QKVPGNVWDFPRVRYLMDEYENHPTQKPEALLKRIILASSNPGDIVLDPFAGSFTTGAVA 232

Query: 242 KKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRT 284
               R FIGIE+  +YI +  +R+         EL  +  ++T
Sbjct: 233 IASGRKFIGIEINSEYIKMGLRRLDVASHYSAEELAKVKKRKT 275


>gi|331679335|ref|ZP_08380007.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli H591]
 gi|332279906|ref|ZP_08392319.1| conserved hypothetical protein [Shigella sp. D9]
 gi|331073400|gb|EGI44723.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli H591]
 gi|332102258|gb|EGJ05604.1| conserved hypothetical protein [Shigella sp. D9]
          Length = 296

 Score =  130 bits (328), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 95/283 (33%), Positives = 142/283 (50%), Gaps = 45/283 (15%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II G++++ L+K+PA+SVDLIFADPPYN+  N           D + ++W +       D
Sbjct: 19  IIHGDALAELKKIPAESVDLIFADPPYNIGKN----------FDGLIEAWKE-------D 61

Query: 83  AFTRAWLLA----CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WL      C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 62  LFID-WLFEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 119

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
             + + + + +E ++       AK YTFN DA+    +    R+  LI       +  N 
Sbjct: 120 QAK-KHYGSMYEPILMMVKD--AKNYTFNGDAILVEAKTGSQRA--LIDYRKNPPQPYNH 174

Query: 199 -----------------DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVA 241
                            D  + HPTQKPEALL RI+++S+ PGDI+LDPF GS T+GAVA
Sbjct: 175 QKVPGNVWDFPRVRYLMDEYENHPTQKPEALLKRIILASSNPGDIVLDPFAGSFTTGAVA 234

Query: 242 KKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRT 284
               R FIGIE+  +YI +  +R+         EL  +  ++T
Sbjct: 235 VSSGRKFIGIEINSEYIKMGLRRLDVASHYSAEELAKVKKRKT 277


>gi|193066458|ref|ZP_03047503.1| DNA methylase, N4/N6-methyltransferase family [Escherichia coli
           E22]
 gi|192925887|gb|EDV80536.1| DNA methylase, N4/N6-methyltransferase family [Escherichia coli
           E22]
          Length = 294

 Score =  130 bits (328), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 95/283 (33%), Positives = 142/283 (50%), Gaps = 45/283 (15%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II G++++ L+K+PA+SVDLIFADPPYN+  N           D + ++W +       D
Sbjct: 17  IIHGDALAELKKIPAESVDLIFADPPYNIGKN----------FDGLIEAWKE-------D 59

Query: 83  AFTRAWLLA----CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WL      C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 60  LFID-WLFEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 117

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
             + + + + +E ++       AK YTFN DA+    +    R+  LI       +  N 
Sbjct: 118 QAK-KHYGSMYEPILMMVKD--AKNYTFNGDAILVEAKTGSQRA--LIDYRKNPPQPYNH 172

Query: 199 -----------------DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVA 241
                            D  + HPTQKPEALL RI+++S+ PGDI+LDPF GS T+GAVA
Sbjct: 173 QKVPGNVWDFPRVRYLMDEYENHPTQKPEALLKRIILASSTPGDIVLDPFAGSFTTGAVA 232

Query: 242 KKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRT 284
               R FIGIE+  +YI +  +R+         EL  +  ++T
Sbjct: 233 VSSGRKFIGIEINSEYIKMGLRRLDVASHYSAEELAKVKKRKT 275


>gi|161506057|ref|YP_001573169.1| putative methyltransferase [Salmonella enterica subsp. arizonae
           serovar 62:z4,z23:-- str. RSK2980]
 gi|160867404|gb|ABX24027.1| hypothetical protein SARI_04244 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 294

 Score =  130 bits (328), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 96/291 (32%), Positives = 147/291 (50%), Gaps = 53/291 (18%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           KII G++++ L+KLP++S+DLIFADPPYN+  +           D + +SWD+ S     
Sbjct: 16  KIILGDALTELKKLPSESIDLIFADPPYNIGKD----------FDGMVESWDEASFL--- 62

Query: 82  DAFTRAWLLAC----RRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPM 137
                AWL  C     RVLK +GT++++ S  N+  I    + L F I + IVW   +  
Sbjct: 63  -----AWLYECVDECYRVLKKHGTMYIMNSTENMPYIDLKCRTL-FTIKSRIVWSYDSSG 116

Query: 138 PNFRGRRFQNAHETLIWASPSPKAKGYTFNYDAL------KAANEDVQMRSD-------- 183
              + + F + +E ++       +K YTFN DA+       A    +  R +        
Sbjct: 117 VQAK-KYFGSMYEPILMMVKD--SKTYTFNRDAILVETTTGAKRALIDYRKNPPQPYNQK 173

Query: 184 ------WLIPICSGSERLRN-KDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGT 236
                 W  P      R+R   D  + HPTQKP ALL RI+++S+  GD +LDPF GS T
Sbjct: 174 KVPGNVWSFP------RVRYLMDEYENHPTQKPSALLKRIILASSNLGDTVLDPFAGSFT 227

Query: 237 SGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRTEPR 287
           +GAVA    R FIGIE+  +Y+ I  +R++        +L  +  ++T+ R
Sbjct: 228 TGAVAAASGRKFIGIEINNEYVKIGLRRLSVTSHYSENDLAKVKKRKTKNR 278


>gi|191169151|ref|ZP_03030909.1| DNA methylase, N4/N6-methyltransferase family [Escherichia coli
           B7A]
 gi|209920734|ref|YP_002294818.1| putative methyltransferase [Escherichia coli SE11]
 gi|256018824|ref|ZP_05432689.1| putative methyltransferase [Shigella sp. D9]
 gi|260846067|ref|YP_003223845.1| putative methyltransferase [Escherichia coli O103:H2 str. 12009]
 gi|260857389|ref|YP_003231280.1| putative methyltransferase [Escherichia coli O26:H11 str. 11368]
 gi|260870013|ref|YP_003236415.1| putative methyltransferase [Escherichia coli O111:H- str. 11128]
 gi|300824974|ref|ZP_07105073.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 119-7]
 gi|307314981|ref|ZP_07594569.1| DNA methylase N-4/N-6 domain protein [Escherichia coli W]
 gi|309793841|ref|ZP_07688267.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 145-7]
 gi|331670086|ref|ZP_08370931.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli TA271]
 gi|190900793|gb|EDV60584.1| DNA methylase, N4/N6-methyltransferase family [Escherichia coli
           B7A]
 gi|209913993|dbj|BAG79067.1| putative methyltransferase [Escherichia coli SE11]
 gi|257756038|dbj|BAI27540.1| predicted methyltransferase [Escherichia coli O26:H11 str. 11368]
 gi|257761214|dbj|BAI32711.1| predicted methyltransferase [Escherichia coli O103:H2 str. 12009]
 gi|257766369|dbj|BAI37864.1| predicted methyltransferase [Escherichia coli O111:H- str. 11128]
 gi|300522540|gb|EFK43609.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 119-7]
 gi|306905564|gb|EFN36096.1| DNA methylase N-4/N-6 domain protein [Escherichia coli W]
 gi|308122798|gb|EFO60060.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 145-7]
 gi|315062561|gb|ADT76888.1| predicted methyltransferase [Escherichia coli W]
 gi|320181533|gb|EFW56451.1| Adenine-specific methyltransferase [Shigella boydii ATCC 9905]
 gi|323154481|gb|EFZ40682.1| hypothetical protein ECEPECA14_3785 [Escherichia coli EPECa14]
 gi|323183021|gb|EFZ68420.1| hypothetical protein ECOK1357_3629 [Escherichia coli 1357]
 gi|323376852|gb|ADX49120.1| DNA methylase N-4/N-6 domain protein [Escherichia coli KO11]
 gi|324020744|gb|EGB89963.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 117-3]
 gi|324119442|gb|EGC13325.1| DNA methylase [Escherichia coli E1167]
 gi|331062999|gb|EGI34913.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli TA271]
          Length = 294

 Score =  130 bits (328), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 95/283 (33%), Positives = 142/283 (50%), Gaps = 45/283 (15%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II G++++ L+K+PA+SVDLIFADPPYN+  N           D + ++W +       D
Sbjct: 17  IIHGDALAELKKIPAESVDLIFADPPYNIGKN----------FDGLIEAWKE-------D 59

Query: 83  AFTRAWLLA----CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WL      C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 60  LFID-WLFEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 117

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
             + + + + +E ++       AK YTFN DA+    +    R+  LI       +  N 
Sbjct: 118 QAK-KHYGSMYEPILMMVKD--AKNYTFNGDAILVEAKTGSQRA--LIDYRKNPPQPYNH 172

Query: 199 -----------------DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVA 241
                            D  + HPTQKPEALL RI+++S+ PGDI+LDPF GS T+GAVA
Sbjct: 173 QKVPGNVWDFPRVRYLMDEYENHPTQKPEALLKRIILASSNPGDIVLDPFAGSFTTGAVA 232

Query: 242 KKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRT 284
               R FIGIE+  +YI +  +R+         EL  +  ++T
Sbjct: 233 VSSGRKFIGIEINSEYIKMGLRRLDVASHYSAEELAKVKKRKT 275


>gi|218696961|ref|YP_002404628.1| putative methyltransferase [Escherichia coli 55989]
 gi|218353693|emb|CAU99950.1| methyltransferase [Escherichia coli 55989]
 gi|320202171|gb|EFW76746.1| Adenine-specific methyltransferase [Escherichia coli EC4100B]
          Length = 294

 Score =  130 bits (328), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 96/286 (33%), Positives = 143/286 (50%), Gaps = 45/286 (15%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II G++++ L+K+PA+SVDLIFADPPYN+  N           D + ++W +       D
Sbjct: 17  IIHGDALAELKKIPAESVDLIFADPPYNIGKN----------FDGLIEAWKE-------D 59

Query: 83  AFTRAWLLA----CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WL      C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 60  LFI-DWLFEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 117

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
             + + + + +E ++       AK YTFN DA+    +    R+  LI       +  N 
Sbjct: 118 QAK-KHYGSMYEPILMMVKD--AKNYTFNGDAILVEAKTGSQRA--LIDYRKNPPQPYNH 172

Query: 199 -----------------DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVA 241
                            D  + HPTQKPEALL RI+++S+ PGDI+LDPF GS T+GAVA
Sbjct: 173 QKVPGNVWDFPRVRYLMDEYENHPTQKPEALLKRIILASSNPGDIVLDPFAGSFTTGAVA 232

Query: 242 KKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRTEPR 287
               R FIGIE+  +YI +  +R+         EL  +  ++T  R
Sbjct: 233 VASGRKFIGIEINSEYIKMGLRRLDVASHYSAEELAKVKKRKTGNR 278


>gi|300958256|ref|ZP_07170403.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 175-1]
 gi|300315074|gb|EFJ64858.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 175-1]
          Length = 294

 Score =  130 bits (327), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 96/287 (33%), Positives = 143/287 (49%), Gaps = 53/287 (18%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II G++++ L+K+PA+SVDLIFADPPYN+  N           D + ++W +       D
Sbjct: 17  IIHGDALAELKKIPAESVDLIFADPPYNIGKN----------FDGLIEAWKE-------D 59

Query: 83  AFTRAWLLA----CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WL      C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 60  LFID-WLFEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 117

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRS---------------- 182
             + + + + +E ++       AK YTFN DA+    +    R+                
Sbjct: 118 QAK-KHYGSMYEPILMMVKD--AKNYTFNGDAILVEAKTGSQRALIDYRKNPPQPYNHQK 174

Query: 183 ----DWLIPICSGSERLRN-KDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTS 237
                W  P      R+R   D  + HPTQKPEALL RI+++S+ PGDI+LDPF GS T+
Sbjct: 175 VPGNVWDFP------RMRYLMDEYENHPTQKPEALLKRIILASSNPGDIVLDPFAGSFTT 228

Query: 238 GAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRT 284
           GAVA    R FIGIE+  +YI +  +R+         EL  +  ++T
Sbjct: 229 GAVAIASGRKFIGIEINSEYIKMGLRRLDVASHYSAEELAKVKKRKT 275


>gi|331643962|ref|ZP_08345093.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli H736]
 gi|606203|gb|AAA58066.1| ORF_o296 [Escherichia coli str. K-12 substr. MG1655]
 gi|331037433|gb|EGI09657.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli H736]
          Length = 296

 Score =  130 bits (327), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 95/283 (33%), Positives = 142/283 (50%), Gaps = 45/283 (15%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II G++++ L+K+PA+SVDLIFADPPYN+  N           D + ++W +       D
Sbjct: 19  IIHGDALAELKKIPAESVDLIFADPPYNIGKN----------FDGLIEAWKE-------D 61

Query: 83  AFTRAWLLA----CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WL      C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 62  LFID-WLFEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 119

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
             + + + + +E ++       AK YTFN DA+    +    R+  LI       +  N 
Sbjct: 120 QAK-KHYGSMYEPILMMVKD--AKNYTFNGDAILVEAKTGSQRA--LIDYRKNPPQPYNH 174

Query: 199 -----------------DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVA 241
                            D  + HPTQKPEALL RI+++S+ PGDI+LDPF GS T+GAVA
Sbjct: 175 QKVPGNVWDFPRVRYLMDEYENHPTQKPEALLKRIILASSNPGDIVLDPFAGSFTTGAVA 234

Query: 242 KKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRT 284
               R FIGIE+  +YI +  +R+         EL  +  ++T
Sbjct: 235 IASGRKFIGIEINSEYIKMGLRRLDVASHYSAEELAKVKKRKT 277


>gi|323178558|gb|EFZ64134.1| hypothetical protein ECOK1180_2289 [Escherichia coli 1180]
          Length = 283

 Score =  130 bits (327), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 95/282 (33%), Positives = 141/282 (50%), Gaps = 45/282 (15%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II G++++ L+K+PA+SVDLIFADPPYN+  N           D + ++W +       D
Sbjct: 17  IIHGDALAELKKIPAESVDLIFADPPYNIGKN----------FDGLIEAWKE-------D 59

Query: 83  AFTRAWLLA----CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WL      C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 60  LFID-WLFEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 117

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
             + + + + +E ++       AK YTFN DA+    +    R+  LI       +  N 
Sbjct: 118 QAK-KHYGSMYEPILMMVKD--AKNYTFNGDAILVEAKTGSQRA--LIDYRKNPPQPYNH 172

Query: 199 -----------------DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVA 241
                            D  + HPTQKPEALL RI+++S+ PGDI+LDPF GS T+GAVA
Sbjct: 173 QKVPGNVWDFPRVRYLMDEYENHPTQKPEALLKRIILASSNPGDIVLDPFAGSFTTGAVA 232

Query: 242 KKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKR 283
               R FIGIE+  +YI +  +R+         EL  +  +R
Sbjct: 233 VSSGRKFIGIEINSEYIKMGLRRLDVASHYSAEELAKVKKER 274


>gi|266582|sp|P29538|MTH1_HAEPA RecName: Full=Modification methylase HpaI; Short=M.HpaI; AltName:
           Full=Adenine-specific methyltransferase HpaI
 gi|216715|dbj|BAA01519.1| HpaI methyltransferase [Haemophilus parainfluenzae]
          Length = 314

 Score =  130 bits (327), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 86/251 (34%), Positives = 130/251 (51%), Gaps = 23/251 (9%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           ++I  N+I  L+ L   S+DLI  DPPYNL   G+ Y            + D   +F  Y
Sbjct: 4   RLICSNAIKALKNLEENSIDLIITDPPYNL---GKDY-----------GTTDDNLNFNKY 49

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTML-QNLNFWILNDIVWRKSNPMPNF 140
             F+  WL  C RVLKP+GT+++      I  I  +L Q+L  +  + I W  +  +   
Sbjct: 50  LEFSHEWLEECYRVLKPHGTIYIFMGMKYISYIYKILEQDLGMYFNSWITWYYTQGIGKT 109

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQ----MRSDWLIPICSGSERLR 196
           RG  +   H+ ++  +  PK   +TFN D ++   +  +    MR      +   S    
Sbjct: 110 RG--YSPRHDDILMFTKHPKK--FTFNLDRIRVPQKYYRSVNNMRGANPSNVWEFSHVHY 165

Query: 197 NKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQD 256
                K HPTQKPEAL  R++++S+  GDI+LDPF GSGT   V K L RS IGI++ ++
Sbjct: 166 CNKNRKPHPTQKPEALYERMILASSNEGDIVLDPFVGSGTLNFVCKHLNRSGIGIDINKE 225

Query: 257 YIDIATKRIAS 267
           YI++A +R+ S
Sbjct: 226 YIEMAKERLDS 236


>gi|89110022|ref|AP_003802.1| predicted methyltransferase [Escherichia coli str. K-12 substr.
           W3110]
 gi|90111566|ref|NP_417728.4| DNA adenine methyltransferase, SAM-dependent [Escherichia coli str.
           K-12 substr. MG1655]
 gi|170082790|ref|YP_001732110.1| methyltransferase [Escherichia coli str. K-12 substr. DH10B]
 gi|238902361|ref|YP_002928157.1| putative methyltransferase [Escherichia coli BW2952]
 gi|256024164|ref|ZP_05438029.1| putative methyltransferase [Escherichia sp. 4_1_40B]
 gi|300948348|ref|ZP_07162456.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 116-1]
 gi|301028293|ref|ZP_07191553.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 196-1]
 gi|301647038|ref|ZP_07246870.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 146-1]
 gi|307139950|ref|ZP_07499306.1| putative methyltransferase [Escherichia coli H736]
 gi|3915983|sp|P28638|YHDJ_ECOLI RecName: Full=DNA adenine methyltransferase YhdJ
 gi|85676053|dbj|BAE77303.1| predicted methyltransferase [Escherichia coli str. K12 substr.
           W3110]
 gi|87082238|gb|AAC76294.2| DNA adenine methyltransferase, SAM-dependent [Escherichia coli str.
           K-12 substr. MG1655]
 gi|169890625|gb|ACB04332.1| predicted methyltransferase [Escherichia coli str. K-12 substr.
           DH10B]
 gi|238862670|gb|ACR64668.1| predicted methyltransferase [Escherichia coli BW2952]
 gi|260447711|gb|ACX38133.1| DNA methylase N-4/N-6 domain protein [Escherichia coli DH1]
 gi|299878636|gb|EFI86847.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 196-1]
 gi|300452137|gb|EFK15757.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 116-1]
 gi|301074788|gb|EFK89594.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 146-1]
 gi|309703681|emb|CBJ03022.1| putative DNA methylase [Escherichia coli ETEC H10407]
 gi|315137845|dbj|BAJ45004.1| putative methyltransferase [Escherichia coli DH1]
 gi|315617071|gb|EFU97681.1| uncharacterized adenine-specific methylase yhdJ [Escherichia coli
           3431]
 gi|323936255|gb|EGB32547.1| DNA methylase [Escherichia coli E1520]
          Length = 294

 Score =  130 bits (327), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 95/283 (33%), Positives = 142/283 (50%), Gaps = 45/283 (15%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II G++++ L+K+PA+SVDLIFADPPYN+  N           D + ++W +       D
Sbjct: 17  IIHGDALAELKKIPAESVDLIFADPPYNIGKN----------FDGLIEAWKE-------D 59

Query: 83  AFTRAWLLA----CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WL      C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 60  LFID-WLFEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 117

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
             + + + + +E ++       AK YTFN DA+    +    R+  LI       +  N 
Sbjct: 118 QAK-KHYGSMYEPILMMVKD--AKNYTFNGDAILVEAKTGSQRA--LIDYRKNPPQPYNH 172

Query: 199 -----------------DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVA 241
                            D  + HPTQKPEALL RI+++S+ PGDI+LDPF GS T+GAVA
Sbjct: 173 QKVPGNVWDFPRVRYLMDEYENHPTQKPEALLKRIILASSNPGDIVLDPFAGSFTTGAVA 232

Query: 242 KKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRT 284
               R FIGIE+  +YI +  +R+         EL  +  ++T
Sbjct: 233 IASGRKFIGIEINSEYIKMGLRRLDVASHYSAEELAKVKKRKT 275


>gi|300925993|ref|ZP_07141816.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 182-1]
 gi|301326296|ref|ZP_07219669.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 78-1]
 gi|300417937|gb|EFK01248.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 182-1]
 gi|300846997|gb|EFK74757.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 78-1]
          Length = 294

 Score =  130 bits (327), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 96/286 (33%), Positives = 142/286 (49%), Gaps = 45/286 (15%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II G++++ L+KLP +SVDLIFADPPYN+  N           D + ++W +       D
Sbjct: 17  IIHGDALAELKKLPTESVDLIFADPPYNIGKN----------FDGLIEAWKE-------D 59

Query: 83  AFTRAWLLA----CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WL      C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 60  LFI-DWLFEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 117

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
             + + + + +E ++       AK YTFN DA+    +    R+  LI       +  N 
Sbjct: 118 QAK-KHYGSMYEPILMMVKD--AKNYTFNGDAILVEAKTGSQRA--LIDYRKNPPQPYNH 172

Query: 199 -----------------DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVA 241
                            D  + HPTQKPEALL RI+++S+ PGDI+LDPF GS T+GAVA
Sbjct: 173 QKVPGNVWDFPRVRYLMDEYENHPTQKPEALLKRIILASSNPGDIVLDPFAGSFTTGAVA 232

Query: 242 KKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRTEPR 287
               R FIGIE+  +YI +  +R+         EL  +  ++T  R
Sbjct: 233 VSSGRKFIGIEINSEYIKMGLRRLDVASHYSAEELAKVKKRKTGNR 278


>gi|218555826|ref|YP_002388739.1| putative methyltransferase [Escherichia coli IAI1]
 gi|218362594|emb|CAR00219.1| methyltransferase [Escherichia coli IAI1]
          Length = 294

 Score =  130 bits (327), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 95/283 (33%), Positives = 141/283 (49%), Gaps = 45/283 (15%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II G++++ L+K+PA+SVDLIFADPPYN+  N           D + + W +       D
Sbjct: 17  IIHGDALAELKKIPAESVDLIFADPPYNIGKN----------FDGLIEDWKE-------D 59

Query: 83  AFTRAWLLA----CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WL      C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 60  LFI-DWLFEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 117

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
             + + + + +E ++       AK YTFN DA+    +    R+  LI       +  N 
Sbjct: 118 QAK-KHYGSMYEPILMMVKD--AKNYTFNGDAILVEAKTGSQRA--LIDYRKNPPQPYNH 172

Query: 199 -----------------DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVA 241
                            D  + HPTQKPEALL RI+++S+ PGDI+LDPF GS T+GAVA
Sbjct: 173 QKVPGNVWDFPRVRYLMDEYENHPTQKPEALLKRIILASSNPGDIVLDPFAGSFTTGAVA 232

Query: 242 KKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRT 284
               R FIGIE+  +YI +  +R+         EL  +  ++T
Sbjct: 233 VSSGRKFIGIEINSEYIKMGLRRLDVASHYSAEELAKVKKRKT 275


>gi|293449585|ref|ZP_06664006.1| adenine-specific DNA-methyltransferase [Escherichia coli B088]
 gi|291322675|gb|EFE62104.1| adenine-specific DNA-methyltransferase [Escherichia coli B088]
          Length = 296

 Score =  130 bits (327), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 95/283 (33%), Positives = 141/283 (49%), Gaps = 45/283 (15%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II G++++ L+KLP +SVDLIFADPPYN+  N           D + ++W +       D
Sbjct: 19  IIHGDALAELKKLPTESVDLIFADPPYNIGKN----------FDGLIEAWKE-------D 61

Query: 83  AFTRAWLLA----CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WL      C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 62  LFI-DWLFEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 119

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
             + + + + +E ++       AK YTFN DA+    +    R+  LI       +  N 
Sbjct: 120 QAK-KHYGSMYEPILMMVKD--AKNYTFNGDAILVEAKTGSQRA--LIDYRKNPPQPYNH 174

Query: 199 -----------------DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVA 241
                            D  + HPTQKPEALL RI+++S+ PGDI+LDPF GS T+GAVA
Sbjct: 175 QKVPGNVWDFPRVRYLMDEYENHPTQKPEALLKRIILASSNPGDIVLDPFAGSFTTGAVA 234

Query: 242 KKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRT 284
               R FIGIE+  +YI +  +R+         EL  +  ++T
Sbjct: 235 VSSGRKFIGIEINSEYIKMGLRRLDVASHYSAEELAKVKKRKT 277


>gi|315289031|gb|EFU48429.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 110-3]
          Length = 294

 Score =  130 bits (326), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 96/287 (33%), Positives = 143/287 (49%), Gaps = 53/287 (18%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II+G++++ L+ LPA+SVDLIFADPPYN+  N           D + ++W +       D
Sbjct: 17  IIQGDALTELKNLPAESVDLIFADPPYNIGKN----------FDGLIEAWKE-------D 59

Query: 83  AFTRAWLLA----CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WL      C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 60  LFID-WLFEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 117

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRS---------------- 182
             + + + + +E ++       AK YTFN DA+    +    R+                
Sbjct: 118 QAK-KHYGSMYEPILMMVKD--AKNYTFNGDAILVEAKTGSQRALINYRKNPPQPYNHQK 174

Query: 183 ----DWLIPICSGSERLRN-KDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTS 237
                W  P      R+R   D  + HPTQKPEALL RI+++S+ PGDI+LDPF GS T+
Sbjct: 175 VPGNVWDFP------RVRYLMDEYENHPTQKPEALLKRIILASSNPGDIVLDPFAGSFTT 228

Query: 238 GAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRT 284
           GAVA    R FIGIE+  +YI +  +R+         EL  +  ++T
Sbjct: 229 GAVAVASGRKFIGIEINSEYIKMGLRRLDVASHYSAEELAKVKKRKT 275


>gi|134096223|ref|YP_001101298.1| putative DNA-methyltransferase [Herminiimonas arsenicoxydans]
 gi|133740126|emb|CAL63177.1| Putative DNA methylase [Herminiimonas arsenicoxydans]
          Length = 269

 Score =  130 bits (326), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 83/273 (30%), Positives = 141/273 (51%), Gaps = 33/273 (12%)

Query: 18  EWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSS 77
           +W++++   ++++ L ++P  +VDLI ADPPY L   G+ Y  D           DK ++
Sbjct: 3   DWRNRVFCEDALAGLARIPDAAVDLIIADPPYGL---GKDYGNDS----------DKLAA 49

Query: 78  FEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPM 137
            EAY  +   W+ A    LKPNG+L++  ++     +  ML+     ++N+I+W +  P 
Sbjct: 50  -EAYLQWMEQWIDAALPKLKPNGSLYIFLTWRYSPEVFVMLKK-RMTMINEIIWDRRVPS 107

Query: 138 PNFRGRRFQNAHETLIWASPSPKAKGYTFNYDAL---------KAANEDVQMRSDWL--- 185
                RRF + H+T+ + +    AK Y F+ DA+         KA +  + + + WL   
Sbjct: 108 MGGSTRRFSSVHDTVGFFA---GAKDYYFDLDAIRVPYDAVTKKARSRSIFVGAKWLELG 164

Query: 186 ---IPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAK 242
                + S S   R       HPTQKP  ++ R+L +S  P  ++LDPF GSGT+   AK
Sbjct: 165 YNPKDVWSVSRLHREHRERADHPTQKPLEIIERMLKASCPPDGVVLDPFMGSGTTAVAAK 224

Query: 243 KLRRSFIGIEMKQDYIDIATKRIASVQPLGNIE 275
           +  R F+G E+  +Y  +  KR+A++ PL  ++
Sbjct: 225 RCGRHFVGFELNAEYCALIEKRLAALVPLETVD 257


>gi|193071526|ref|ZP_03052436.1| DNA methylase, N4/N6-methyltransferase family [Escherichia coli
           E110019]
 gi|192955163|gb|EDV85656.1| DNA methylase, N4/N6-methyltransferase family [Escherichia coli
           E110019]
          Length = 294

 Score =  130 bits (326), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 96/286 (33%), Positives = 142/286 (49%), Gaps = 45/286 (15%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II G++++ L+KLP +SVDLIFADPPYN+  N           D + ++W +       D
Sbjct: 17  IIHGDALAELKKLPTESVDLIFADPPYNIGKN----------FDGLIEAWKE-------D 59

Query: 83  AFTRAWLLA----CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WL      C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 60  LFI-DWLFEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 117

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
             + + + + +E ++       AK YTFN DA+    +    R+  LI       +  N 
Sbjct: 118 QAK-KHYGSMYEPILMMVKD--AKNYTFNGDAILVEAKTGSQRA--LIDYRKNPPQPYNH 172

Query: 199 -----------------DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVA 241
                            D  + HPTQKPEALL RI+++S+ PGDI+LDPF GS T+GAVA
Sbjct: 173 QKVPGNVWDFPRVRYLMDEYENHPTQKPEALLKRIILASSNPGDIVLDPFAGSFTTGAVA 232

Query: 242 KKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRTEPR 287
               R FIGIE+  +YI +  +R+         EL  +  ++T  R
Sbjct: 233 VASGRKFIGIEINSEYIKMGLRRLDVASHYSAEELAKVKKRKTGNR 278


>gi|323162947|gb|EFZ48782.1| hypothetical protein ECE128010_0909 [Escherichia coli E128010]
          Length = 294

 Score =  130 bits (326), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 94/283 (33%), Positives = 141/283 (49%), Gaps = 45/283 (15%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II G++++ L+K+PA+SVDLIFADPPYN+  N           D + ++W +       D
Sbjct: 17  IIHGDALAELKKIPAESVDLIFADPPYNIGKN----------FDGLIEAWKE-------D 59

Query: 83  AFTRAWLLA----CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WL      C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 60  LFI-DWLFEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 117

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
             + + + + +E ++       AK YTFN DA+    +    R+  LI       +  N 
Sbjct: 118 QAK-KHYGSMYEPILMMVKD--AKNYTFNGDAILVEAKTGSQRA--LIDYRKNPPQPYNH 172

Query: 199 -----------------DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVA 241
                            D  + HPTQKPE LL RI+++S+ PGDI+LDPF GS T+GAVA
Sbjct: 173 QKVPGNVWDFPRVRYLMDEYENHPTQKPEVLLKRIILASSNPGDIVLDPFAGSFTTGAVA 232

Query: 242 KKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRT 284
               R FIGIE+  +YI +  +R+         EL  +  ++T
Sbjct: 233 VSCGRKFIGIEINSEYIKMGLRRLDVASHYSAEELAKVKKRKT 275


>gi|81247044|gb|ABB67752.1| putative methyltransferase [Shigella boydii Sb227]
          Length = 296

 Score =  130 bits (326), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 95/283 (33%), Positives = 142/283 (50%), Gaps = 45/283 (15%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II G++++ L+K+PA+SVDLIFADPPYN+  N           D + ++W +       D
Sbjct: 19  IIHGDALAELKKIPAESVDLIFADPPYNIGKN----------FDGLIEAWKE-------D 61

Query: 83  AFTRAWLLA----CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WL      C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 62  LFID-WLFEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 119

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
             + + + + ++ ++       AK YTFN DA+    +    R+  LI       +  N 
Sbjct: 120 QAK-KHYGSMYDPILMMVKD--AKNYTFNGDAILVEAKTGSQRA--LIDYRKNPPQPYNH 174

Query: 199 -----------------DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVA 241
                            D  + HPTQKPEALL RI+++S+ PGDIILDPF GS T+GAVA
Sbjct: 175 QKVPGNVWDFPRVRYLMDEYENHPTQKPEALLKRIILASSNPGDIILDPFAGSFTTGAVA 234

Query: 242 KKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRT 284
               R FIGIE+  +YI +  +R+         EL  +  ++T
Sbjct: 235 VSSGRKFIGIEINSEYIKMGLRRLDVASHYSAEELAKVKKRKT 277


>gi|73857268|gb|AAZ89975.1| putative methyltransferase [Shigella sonnei Ss046]
          Length = 296

 Score =  130 bits (326), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 95/283 (33%), Positives = 142/283 (50%), Gaps = 45/283 (15%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II G++++ L+KLP +SVDLIFADPPYN+  N           D + ++W +       D
Sbjct: 19  IIHGDALAELKKLPTESVDLIFADPPYNIGKN----------FDGLIEAWKE-------D 61

Query: 83  AFTRAWL----LACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WL    + C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 62  LFI-DWLFEVIVECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 119

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
             + + + + +E ++       AK YTFN DA+    +    R+  LI       +  N 
Sbjct: 120 QAK-KHYGSMYEPILMMVKD--AKNYTFNGDAILVEAKTGSQRA--LIDYRKNPPQPYNH 174

Query: 199 -----------------DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVA 241
                            D  + HPTQKPEALL RI+++S+ PGDI+LDPF GS T+GAVA
Sbjct: 175 QKVPGNVWDFPRVRYLMDEYENHPTQKPEALLKRIILASSNPGDIVLDPFAGSFTTGAVA 234

Query: 242 KKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRT 284
               R FIGIE+  +YI +  +R+         EL  +  ++T
Sbjct: 235 IASGRKFIGIEINSEYIKMGLRRLDVASHYSAEELAKVKKRKT 277


>gi|157162743|ref|YP_001460061.1| putative methyltransferase [Escherichia coli HS]
 gi|157068423|gb|ABV07678.1| DNA methylase, N4/N6-methyltransferase family [Escherichia coli HS]
          Length = 294

 Score =  130 bits (326), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 96/286 (33%), Positives = 142/286 (49%), Gaps = 45/286 (15%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II G++++ L+KLP +SVDLIFADPPYN+  N           D + ++W +       D
Sbjct: 17  IIHGDALAELKKLPTESVDLIFADPPYNIGKN----------FDGLIEAWKE-------D 59

Query: 83  AFTRAWLLA----CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WL      C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 60  LFID-WLFEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 117

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
             + + + + +E ++       AK YTFN DA+    +    R+  LI       +  N 
Sbjct: 118 QAK-KHYGSMYEPILMMVKD--AKNYTFNGDAILVEAKTGSQRA--LIDYRKNPPQPYNH 172

Query: 199 -----------------DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVA 241
                            D  + HPTQKPEALL RI+++S+ PGDI+LDPF GS T+GAVA
Sbjct: 173 QKVPGNVWDFPRVRYLMDEYENHPTQKPEALLKRIILASSNPGDIVLDPFAGSFTTGAVA 232

Query: 242 KKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRTEPR 287
               R FIGIE+  +YI +  +R+         EL  +  ++T  R
Sbjct: 233 IASGRKFIGIEINSEYIKMGLRRLDVASHYSAEELAKVKKRKTGNR 278


>gi|161986434|ref|YP_312210.2| putative methyltransferase [Shigella sonnei Ss046]
 gi|323165223|gb|EFZ51013.1| hypothetical protein SS53G_4688 [Shigella sonnei 53G]
          Length = 294

 Score =  130 bits (326), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 95/283 (33%), Positives = 142/283 (50%), Gaps = 45/283 (15%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II G++++ L+KLP +SVDLIFADPPYN+  N           D + ++W +       D
Sbjct: 17  IIHGDALAELKKLPTESVDLIFADPPYNIGKN----------FDGLIEAWKE-------D 59

Query: 83  AFTRAWL----LACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WL    + C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 60  LFI-DWLFEVIVECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 117

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
             + + + + +E ++       AK YTFN DA+    +    R+  LI       +  N 
Sbjct: 118 QAK-KHYGSMYEPILMMVKD--AKNYTFNGDAILVEAKTGSQRA--LIDYRKNPPQPYNH 172

Query: 199 -----------------DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVA 241
                            D  + HPTQKPEALL RI+++S+ PGDI+LDPF GS T+GAVA
Sbjct: 173 QKVPGNVWDFPRVRYLMDEYENHPTQKPEALLKRIILASSNPGDIVLDPFAGSFTTGAVA 232

Query: 242 KKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRT 284
               R FIGIE+  +YI +  +R+         EL  +  ++T
Sbjct: 233 IASGRKFIGIEINSEYIKMGLRRLDVASHYSAEELAKVKKRKT 275


>gi|161984845|ref|YP_409580.2| methyltransferase [Shigella boydii Sb227]
          Length = 294

 Score =  129 bits (325), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 95/283 (33%), Positives = 142/283 (50%), Gaps = 45/283 (15%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II G++++ L+K+PA+SVDLIFADPPYN+  N           D + ++W +       D
Sbjct: 17  IIHGDALAELKKIPAESVDLIFADPPYNIGKN----------FDGLIEAWKE-------D 59

Query: 83  AFTRAWLLA----CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WL      C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 60  LFI-DWLFEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 117

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
             + + + + ++ ++       AK YTFN DA+    +    R+  LI       +  N 
Sbjct: 118 QAK-KHYGSMYDPILMMVKD--AKNYTFNGDAILVEAKTGSQRA--LIDYRKNPPQPYNH 172

Query: 199 -----------------DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVA 241
                            D  + HPTQKPEALL RI+++S+ PGDIILDPF GS T+GAVA
Sbjct: 173 QKVPGNVWDFPRVRYLMDEYENHPTQKPEALLKRIILASSNPGDIILDPFAGSFTTGAVA 232

Query: 242 KKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRT 284
               R FIGIE+  +YI +  +R+         EL  +  ++T
Sbjct: 233 VSSGRKFIGIEINSEYIKMGLRRLDVASHYSAEELAKVKKRKT 275


>gi|323173479|gb|EFZ59108.1| hypothetical protein ECLT68_1794 [Escherichia coli LT-68]
          Length = 315

 Score =  129 bits (325), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 96/286 (33%), Positives = 142/286 (49%), Gaps = 53/286 (18%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II G++++ L+K+PA+SVDLIFADPPYN+  N           D + ++W +       D
Sbjct: 17  IIHGDALAELKKIPAESVDLIFADPPYNIGKN----------FDGLIEAWKE-------D 59

Query: 83  AFTRAWLLA----CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WL      C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 60  LFID-WLFEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 117

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRS---------------- 182
             + + + + +E ++       AK YTFN DA+    +    R+                
Sbjct: 118 QAK-KHYGSMYEPILMMVKD--AKNYTFNGDAILVEAKTGSQRALIDYRKNPPQPYNHQK 174

Query: 183 ----DWLIPICSGSERLRN-KDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTS 237
                W  P      R+R   D  + HPTQKPEALL RI+++S+ PGDI+LDPF GS T+
Sbjct: 175 VPGNVWDFP------RVRYLMDEYENHPTQKPEALLKRIILASSNPGDIVLDPFAGSFTT 228

Query: 238 GAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKR 283
           GAVA    R FIGIE+  +YI +  +R+         EL  +  +R
Sbjct: 229 GAVAVASGRKFIGIEINSEYIKMGLRRLDVASHYSAEELAKVKKER 274


>gi|170018495|ref|YP_001723449.1| putative methyltransferase [Escherichia coli ATCC 8739]
 gi|188492784|ref|ZP_03000054.1| DNA methylase, N4/N6-methyltransferase family [Escherichia coli
           53638]
 gi|194440031|ref|ZP_03072088.1| DNA methylase, N4/N6-methyltransferase family [Escherichia coli
           101-1]
 gi|253771908|ref|YP_003034739.1| methyltransferase [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|254163197|ref|YP_003046305.1| putative methyltransferase [Escherichia coli B str. REL606]
 gi|300904456|ref|ZP_07122302.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 84-1]
 gi|300928703|ref|ZP_07144221.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 187-1]
 gi|301304271|ref|ZP_07210385.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 124-1]
 gi|312972469|ref|ZP_07786643.1| uncharacterized adenine-specific methylase yhdJ [Escherichia coli
           1827-70]
 gi|169753423|gb|ACA76122.1| DNA methylase N-4/N-6 domain protein [Escherichia coli ATCC 8739]
 gi|188487983|gb|EDU63086.1| DNA methylase, N4/N6-methyltransferase family [Escherichia coli
           53638]
 gi|194421035|gb|EDX37065.1| DNA methylase, N4/N6-methyltransferase family [Escherichia coli
           101-1]
 gi|242378796|emb|CAQ33588.1| DNA adenine methyltransferase [Escherichia coli BL21(DE3)]
 gi|253322952|gb|ACT27554.1| DNA methylase N-4/N-6 domain protein [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253975098|gb|ACT40769.1| predicted methyltransferase [Escherichia coli B str. REL606]
 gi|253979254|gb|ACT44924.1| predicted methyltransferase [Escherichia coli BL21(DE3)]
 gi|300403618|gb|EFJ87156.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 84-1]
 gi|300463292|gb|EFK26785.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 187-1]
 gi|300840397|gb|EFK68157.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 124-1]
 gi|310334846|gb|EFQ01051.1| uncharacterized adenine-specific methylase yhdJ [Escherichia coli
           1827-70]
 gi|315257188|gb|EFU37156.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 85-1]
 gi|323941645|gb|EGB37824.1| DNA methylase [Escherichia coli E482]
 gi|323961090|gb|EGB56704.1| DNA methylase [Escherichia coli H489]
 gi|323970323|gb|EGB65593.1| DNA methylase [Escherichia coli TA007]
 gi|332345217|gb|AEE58551.1| adenine-specific methylase YhdJ [Escherichia coli UMNK88]
          Length = 294

 Score =  129 bits (325), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 96/286 (33%), Positives = 142/286 (49%), Gaps = 45/286 (15%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II G++++ L+KLP +SVDLIFADPPYN+  N           D + ++W +       D
Sbjct: 17  IIHGDALAELKKLPTESVDLIFADPPYNIGKN----------FDGLIEAWKE-------D 59

Query: 83  AFTRAWLLA----CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WL      C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 60  LFI-DWLFEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 117

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
             + + + + +E ++       AK YTFN DA+    +    R+  LI       +  N 
Sbjct: 118 QAK-KHYGSMYEPILMMVKD--AKNYTFNGDAILVEAKTGSQRA--LIDYRKNPPQPYNH 172

Query: 199 -----------------DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVA 241
                            D  + HPTQKPEALL RI+++S+ PGDI+LDPF GS T+GAVA
Sbjct: 173 QKVPGNVWDFPRVRYLMDEYENHPTQKPEALLKRIILASSNPGDIVLDPFAGSFTTGAVA 232

Query: 242 KKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRTEPR 287
               R FIGIE+  +YI +  +R+         EL  +  ++T  R
Sbjct: 233 IASGRKFIGIEINSEYIKMGLRRLDVASHYSAEELAKVKKRKTGNR 278


>gi|332087253|gb|EGI92386.1| hypothetical protein SB521682_3384 [Shigella boydii 5216-82]
          Length = 294

 Score =  129 bits (325), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 95/283 (33%), Positives = 141/283 (49%), Gaps = 45/283 (15%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II G++++ L+K+PA+SVDLIFADPPYN+  N           D + ++W +       D
Sbjct: 17  IIHGDALAELKKIPAESVDLIFADPPYNIGKN----------FDGLIEAWKE-------D 59

Query: 83  AFTRAWLLA----CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WL      C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 60  LFID-WLFEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 117

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
             + + + + +E ++       AK YTFN DA+    +    R+  LI       +  N 
Sbjct: 118 QAK-KHYGSMYEPILMMVKD--AKNYTFNGDAILVEAKTGSQRA--LIDYRKNPPQPYNH 172

Query: 199 -----------------DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVA 241
                            D  + HPTQKPEALL RI+++S+ PGDI+LDPF GS T+GAVA
Sbjct: 173 QKVPGNVWDFPRVRYLMDEYENHPTQKPEALLKRIILASSNPGDIVLDPFAGSFTTGAVA 232

Query: 242 KKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRT 284
               R FIGIE   +YI +  +R+         EL  +  ++T
Sbjct: 233 VSSGRKFIGIESNSEYIKMGLRRLDVASHYSAEELAKVKKRKT 275


>gi|332098818|gb|EGJ03775.1| hypothetical protein SB359474_0136 [Shigella boydii 3594-74]
          Length = 283

 Score =  129 bits (324), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 95/282 (33%), Positives = 141/282 (50%), Gaps = 45/282 (15%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II G++++ L+K+PA+SVDLIFADPPYN+  N           D + ++W +       D
Sbjct: 17  IIHGDALAELKKIPAESVDLIFADPPYNIGKN----------FDGLIEAWKE-------D 59

Query: 83  AFTRAWLLA----CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WL      C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 60  LFID-WLFEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 117

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
             + + + + ++ ++       AK YTFN DA+    +    R+  LI       +  N 
Sbjct: 118 QAK-KHYGSMYDPILMMVKD--AKNYTFNGDAILVEAKTGSQRA--LIDYRKNPPQPYNH 172

Query: 199 -----------------DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVA 241
                            D  + HPTQKPEALL RI+++S+ PGDIILDPF GS T+GAVA
Sbjct: 173 QKVPGNVWDFPRVRYLMDEYENHPTQKPEALLKRIILASSNPGDIILDPFAGSFTTGAVA 232

Query: 242 KKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKR 283
               R FIGIE+  +YI +  +R+         EL  +  +R
Sbjct: 233 VSSGRKFIGIEINSEYIKMGLRRLDVASHYSAEELAKVKKER 274


>gi|187732784|ref|YP_001881954.1| putative methyltransferase [Shigella boydii CDC 3083-94]
 gi|187429776|gb|ACD09050.1| DNA methylase, N4/N6-methyltransferase family [Shigella boydii CDC
           3083-94]
 gi|320177101|gb|EFW52117.1| Adenine-specific methyltransferase [Shigella dysenteriae CDC
           74-1112]
 gi|320184070|gb|EFW58890.1| Adenine-specific methyltransferase [Shigella flexneri CDC 796-83]
          Length = 294

 Score =  129 bits (324), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 94/283 (33%), Positives = 142/283 (50%), Gaps = 45/283 (15%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II G++++ L+K+PA+SVDLIFADPPYN+  N           D + ++W +       D
Sbjct: 17  IIHGDALAELKKIPAESVDLIFADPPYNIGKN----------FDGLIEAWKE-------D 59

Query: 83  AFTRAWLLA----CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WL      C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 60  LFID-WLFEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 117

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
             + + + + ++ ++       AK YTFN DA+    +    R+  LI       +  N 
Sbjct: 118 QAK-KHYGSMYDPILMMVKD--AKNYTFNGDAILVEAKTGSQRA--LIDYRKNPPQPYNH 172

Query: 199 -----------------DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVA 241
                            D  + HPTQKPEALL RI+++S+ PGDI+LDPF GS T+GAVA
Sbjct: 173 QKVPGNVWDFPRVRYLMDEYENHPTQKPEALLKRIILASSNPGDIVLDPFAGSFTTGAVA 232

Query: 242 KKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRT 284
               R FIGIE+  +YI +  +R+         EL  +  ++T
Sbjct: 233 VSSGRKFIGIEINSEYIKMGLRRLDVASHYSAEELAKVKKRKT 275


>gi|194430238|ref|ZP_03062735.1| DNA methylase, N4/N6-methyltransferase family [Escherichia coli
           B171]
 gi|194411709|gb|EDX28034.1| DNA methylase, N4/N6-methyltransferase family [Escherichia coli
           B171]
          Length = 294

 Score =  129 bits (324), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 94/283 (33%), Positives = 141/283 (49%), Gaps = 45/283 (15%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II G++++ L+K+PA+SVDLIFADPPYN+  N           D + ++W +       D
Sbjct: 17  IIHGDALAELKKIPAESVDLIFADPPYNIGKN----------FDGLIEAWKE-------D 59

Query: 83  AFTRAWLLA----CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WL      C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 60  LFI-DWLFEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 117

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
             + + + + +E ++       AK YTFN DA+    +    R+  LI       +  N 
Sbjct: 118 QAK-KHYGSMYEPILMMVKD--AKNYTFNGDAILVEAKTGSQRA--LIDYRKNPPQPYNH 172

Query: 199 -----------------DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVA 241
                            D  + HPTQKPE LL RI+++S+ PGDI+LDPF GS T+GAVA
Sbjct: 173 QKVPGNVWDFPRVRYLMDEYENHPTQKPEVLLKRIILASSNPGDIVLDPFAGSFTTGAVA 232

Query: 242 KKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRT 284
               R FIGIE+  +YI +  +R+         EL  +  ++T
Sbjct: 233 VSSGRKFIGIEINSEYIKMGLRRLDVASHYSAEELAKVKKRKT 275


>gi|323946891|gb|EGB42907.1| DNA methylase [Escherichia coli H120]
          Length = 294

 Score =  128 bits (322), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 94/283 (33%), Positives = 141/283 (49%), Gaps = 45/283 (15%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II G++++ L+K+PA+SVDLIFADPPYN+  N           D + ++W +       D
Sbjct: 17  IIHGDALAELKKIPAESVDLIFADPPYNIGKN----------FDGLIEAWKE-------D 59

Query: 83  AFTRAWLLA----CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WL      C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 60  LFI-DWLFEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 117

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
             + + + + +E ++       AK YTFN DA+    +    R+  LI       +  N 
Sbjct: 118 QAK-KHYGSMYEPILMMVKD--AKNYTFNGDAILVEAKTGSQRA--LIDYRKNPPQPYNH 172

Query: 199 -----------------DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVA 241
                            D  + HPTQKPEALL RI+++S+ P DI+LDPF GS T+GAVA
Sbjct: 173 QKVPGNVWDFPRVRYLMDEYENHPTQKPEALLKRIILASSNPSDIVLDPFAGSFTTGAVA 232

Query: 242 KKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRT 284
               R FIGIE+  +YI +  +R+         EL  +  ++T
Sbjct: 233 VSSGRKFIGIEINSEYIKMGLRRLDVASHYSAEELAKVKKRKT 275


>gi|283836189|ref|ZP_06355930.1| DNA (cytosine-5-)-methyltransferase [Citrobacter youngae ATCC
           29220]
 gi|291067540|gb|EFE05649.1| DNA (cytosine-5-)-methyltransferase [Citrobacter youngae ATCC
           29220]
          Length = 294

 Score =  128 bits (322), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 86/282 (30%), Positives = 146/282 (51%), Gaps = 39/282 (13%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           KII G++++ L+KLP++SVDLIFADPPYN+  +           D + + W++    E +
Sbjct: 16  KIILGDALTELKKLPSESVDLIFADPPYNIGKD----------FDGMVERWNE----ETF 61

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNP---MP 138
            A+    +  C R+LKP+GT++++ S  N+  I    + + F I + IVW   +      
Sbjct: 62  LAWLFECIDECHRILKPHGTMYIMNSTENMPYIDLKCRQI-FTIKSRIVWSYDSSGVQAK 120

Query: 139 NFRGRRFQ--------------NAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDW 184
           N+ G  ++              N  + L+ A    K     +  +  +  N+     + W
Sbjct: 121 NYFGSMYEPILMMVKDQKNYTFNRDDVLVEAKTGAKRALIDYRKNPPQPYNQKKVPGNVW 180

Query: 185 LIPICSGSERLRN-KDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKK 243
             P      R+R   D  + HPTQKP+ALL RI+++S+ P D +LDPF GS T+GA A +
Sbjct: 181 DFP------RVRYLMDEYENHPTQKPKALLERIILASSNPDDKVLDPFAGSFTTGATAVE 234

Query: 244 LRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRTE 285
           L R F+GIE+  +Y+ +  +R++       +EL  +  ++T+
Sbjct: 235 LGRQFVGIEINAEYVKMGLRRLSIGSHFSEVELAKVKKRKTK 276


>gi|254038426|ref|ZP_04872484.1| conserved hypothetical protein [Escherichia sp. 1_1_43]
 gi|226840050|gb|EEH72071.1| conserved hypothetical protein [Escherichia sp. 1_1_43]
          Length = 294

 Score =  128 bits (322), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 94/283 (33%), Positives = 141/283 (49%), Gaps = 45/283 (15%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II G++++ L+K+PA+SVDLIFADPPYN+  N           D + ++W +       D
Sbjct: 17  IIHGDALAELKKIPAESVDLIFADPPYNIGKN----------FDGLIEAWKE-------D 59

Query: 83  AFTRAWLLA----CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WL      C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 60  LFID-WLFEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 117

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
             + + + + +E ++       AK YTFN DA+    +    R+  LI       +  N 
Sbjct: 118 QAK-KHYGSMYEPILMMVKD--AKNYTFNGDAILVEAKTGSQRA--LIDYRKNPPQPYNH 172

Query: 199 -----------------DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVA 241
                            D  + HPTQKPEALL RI+++S+ P DI+LDPF GS T+GAVA
Sbjct: 173 QKVPGNVWDFPRVRYLMDEYENHPTQKPEALLKRIILASSNPADIVLDPFAGSFTTGAVA 232

Query: 242 KKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRT 284
               R FIGIE+  +YI +  +R+         EL  +  ++T
Sbjct: 233 IASGRKFIGIEINSEYIKMGLRRLDVASHYSAEELAKVKKRKT 275


>gi|157157471|ref|YP_001464736.1| putative methyltransferase [Escherichia coli E24377A]
 gi|157079501|gb|ABV19209.1| DNA methylase, N4/N6-methyltransferase family [Escherichia coli
           E24377A]
          Length = 294

 Score =  128 bits (322), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 95/286 (33%), Positives = 142/286 (49%), Gaps = 45/286 (15%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II G++++ L+KLP +SVDLIFADPPYN+  N           D + ++W +       D
Sbjct: 17  IIHGDALAELKKLPTESVDLIFADPPYNIGKN----------FDGLIEAWKE-------D 59

Query: 83  AFTRAWLLA----CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WL      C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 60  LFI-DWLFEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 117

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
             + + + + +E ++       AK YTFN DA+    +    R+  LI       +  N 
Sbjct: 118 QAK-KHYGSMYEPILMMVKD--AKNYTFNGDAILVEAKTGSQRA--LIDYRKNPPQPYNH 172

Query: 199 -----------------DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVA 241
                            D  + HPT+KPEALL RI+++S+ PGDI+LDPF GS T+GAVA
Sbjct: 173 QKVPGNVWDFPRVRYLMDEYENHPTRKPEALLKRIILASSNPGDIVLDPFAGSFTTGAVA 232

Query: 242 KKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRTEPR 287
               R FIGIE+  +YI +  +R+         EL  +  ++T  R
Sbjct: 233 VSSGRKFIGIEINSEYIKMGLRRLDVASHYSAEELAKVKKRKTGNR 278


>gi|300817483|ref|ZP_07097699.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 107-1]
 gi|300529781|gb|EFK50843.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 107-1]
          Length = 294

 Score =  128 bits (321), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 94/283 (33%), Positives = 141/283 (49%), Gaps = 45/283 (15%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II G++++ L+K+PA+S DLIFADPPYN+  N           D + ++W +       D
Sbjct: 17  IIHGDALAELKKIPAESDDLIFADPPYNIGKN----------FDGLIEAWKE-------D 59

Query: 83  AFTRAWLLA----CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WL      C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 60  LFI-DWLFEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 117

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
             + + + + +E ++       AK YTFN DA+    +    R+  LI       +  N 
Sbjct: 118 QAK-KHYGSMYEPILMMVKD--AKNYTFNGDAILVEAKTGSQRA--LIDYRKNPPQPYNH 172

Query: 199 -----------------DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVA 241
                            D  + HPTQKPEALL RI+++S+ PGDI+LDPF GS T+GAVA
Sbjct: 173 QKVPGNVWDFPRVRYLMDEYENHPTQKPEALLKRIILASSNPGDIVLDPFAGSFTTGAVA 232

Query: 242 KKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRT 284
               R FIGIE+  +YI +  +R+         EL  +  ++T
Sbjct: 233 VSSGRKFIGIEINSEYIKMGLRRLDVASHYSAEELAKVKKRKT 275


>gi|283788096|ref|YP_003367961.1| DNA methylase [Citrobacter rodentium ICC168]
 gi|282951550|emb|CBG91249.1| putative DNA methylase [Citrobacter rodentium ICC168]
          Length = 291

 Score =  128 bits (321), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 95/281 (33%), Positives = 144/281 (51%), Gaps = 41/281 (14%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II G++++ L+KLPA+SVDLIFADPPYN+  +           D + +SWD+       +
Sbjct: 17  IILGDALNELKKLPAESVDLIFADPPYNIGKD----------FDGMIESWDE-------N 59

Query: 83  AFTRAWLLAC----RRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WL AC     RVLK  GT++++ S  N+  I    + L F I + IVW   +   
Sbjct: 60  VFL-TWLFACIDECHRVLKKQGTMYIMNSTENMPHIDLKCRGL-FTIKSRIVWSYDSSGV 117

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDAL------KAANEDVQMRSDWLIPICSGS 192
             + + F + +E ++       AK YTFN +++       A    +  R +   P  +  
Sbjct: 118 QAK-KFFGSMYEPILMMVKD--AKHYTFNRESILVETKTGAKRALIDYRKNPPQPYNTQK 174

Query: 193 --------ERLRN-KDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKK 243
                    R+R   D  + HPTQKP ALL RI+++S+ PGD +LDPF GS T+GAVA  
Sbjct: 175 VPGNVWEFPRVRYLMDEYENHPTQKPMALLQRIVLASSNPGDTVLDPFAGSFTTGAVAVA 234

Query: 244 LRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRT 284
             R FIGIE+  +Y+ +  +R+         EL  +  ++T
Sbjct: 235 AGRKFIGIEINTEYVKMGLRRMRVSSHFTTDELAKVKKRKT 275


>gi|300313354|ref|YP_003777446.1| DNA-methyltransferase [Herbaspirillum seropedicae SmR1]
 gi|300076139|gb|ADJ65538.1| DNA-methyltransferase (DNA-modification methylase) protein
           [Herbaspirillum seropedicae SmR1]
          Length = 276

 Score =  127 bits (320), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 83/270 (30%), Positives = 137/270 (50%), Gaps = 36/270 (13%)

Query: 19  WKDKIIKGNSISV---LEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKF 75
           W D++   +++S    L ++P  SVDL+ ADPPY L   G+ Y  D   +D         
Sbjct: 13  WLDRVFCEDALSAVGGLARIPDGSVDLMIADPPYGL---GKDYGNDSDKLDTA------- 62

Query: 76  SSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSN 135
               AY A+T  W+ A    LKPNG+L++  ++ N   I  ML+     ++N+I+W +  
Sbjct: 63  ----AYLAWTEQWVDAALPKLKPNGSLYIFLTWRNSPEIFVMLKQ-RMTMINEIIWDRRV 117

Query: 136 PMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDAL---------KAANEDVQMRSDWL- 185
           P      RR+ + H+T+ + +   +AK Y F+ DA+         KA +  + + + WL 
Sbjct: 118 PSMGGSTRRYSSVHDTIGFFA---RAKDYFFDLDAIRIPYDAQTKKARSRSIFVGAKWLE 174

Query: 186 -----IPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAV 240
                  + S S   R       HPTQKP  ++ R++ +S  PG ++LDPF GSGT+   
Sbjct: 175 MGYNPKDVWSVSRLHREHKERADHPTQKPLEVVERMVKASCPPGGVVLDPFMGSGTTAVA 234

Query: 241 AKKLRRSFIGIEMKQDYIDIATKRIASVQP 270
           A++  R F G E+  DY ++  +R+ ++ P
Sbjct: 235 ARRCGRHFTGFELNPDYCELIRQRLDALAP 264


>gi|300917417|ref|ZP_07134082.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 115-1]
 gi|300415327|gb|EFJ98637.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 115-1]
          Length = 294

 Score =  127 bits (320), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 95/286 (33%), Positives = 141/286 (49%), Gaps = 45/286 (15%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II G++++ L+KLP +SVDLIFADPPYN+  N           D + ++W +       D
Sbjct: 17  IIHGDALAELKKLPTESVDLIFADPPYNIGKN----------FDGLIEAWKE-------D 59

Query: 83  AFTRAWLLA----CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WL      C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 60  LFI-DWLFEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 117

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
             + + + + +E ++       AK YTFN DA+    +    R+  LI       +  N 
Sbjct: 118 QAK-KHYGSMYEPILMMVKD--AKNYTFNGDAILVEAKTGSQRA--LIDYRKNPPQPYNH 172

Query: 199 -----------------DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVA 241
                            D  + HP QKPEALL RI+++S+ PGDI+LDPF GS T+GAVA
Sbjct: 173 QKVPGNVWDFPRVRYLMDEYENHPKQKPEALLKRIILASSNPGDIVLDPFAGSFTTGAVA 232

Query: 242 KKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRTEPR 287
               R FIGIE+  +YI +  +R+         EL  +  ++T  R
Sbjct: 233 IASGRKFIGIEINSEYIKMGLRRLDVASHYSAEELAKVKKRKTGNR 278


>gi|303242614|ref|ZP_07329089.1| DNA methylase N-4/N-6 domain protein [Acetivibrio cellulolyticus
           CD2]
 gi|302589822|gb|EFL59595.1| DNA methylase N-4/N-6 domain protein [Acetivibrio cellulolyticus
           CD2]
          Length = 266

 Score =  127 bits (320), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 90/258 (34%), Positives = 140/258 (54%), Gaps = 31/258 (12%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           +I G+ +SVL  L  K++DLIFADPPYNL   G+ +  D       +D+W   S    Y 
Sbjct: 20  VINGDCMSVLPYLKEKTIDLIFADPPYNL---GKDFGND-------SDNWKNKSE---YL 66

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            +  AW+  C RVLK NGT++++ S  NI  I   L+   + ++N+IVW   +     + 
Sbjct: 67  HWCYAWIDECFRVLKDNGTIYIMNSTQNISYIDVYLRE-KYNVINNIVWYYDSSGVQSK- 124

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDALK------AANEDVQMRSDWLIPICSGS---- 192
            ++ + +E +I A+ S KA+ YTFN++ +K      A  + +  R     P  +      
Sbjct: 125 YKYGSLYEPVIMANKSAKAR-YTFNWENIKVEARTGAVRKLIDYRKTPPQPYNNEKVPGN 183

Query: 193 ----ERLRNKDGE-KLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRS 247
                R+R +  E + HP+QKPE LL RI+ +S+ P +I+LDPF G+ T+  VA +L R 
Sbjct: 184 VWEFSRVRYRMSEYENHPSQKPEILLERIVKASSNPDEIVLDPFSGTFTTAVVANRLGRK 243

Query: 248 FIGIEMKQDYIDIATKRI 265
            IGIE+   Y  I  +R+
Sbjct: 244 SIGIELNDCYYGIGLRRV 261


>gi|320535756|ref|ZP_08035839.1| DNA (cytosine-5-)-methyltransferase [Treponema phagedenis F0421]
 gi|320147387|gb|EFW38920.1| DNA (cytosine-5-)-methyltransferase [Treponema phagedenis F0421]
          Length = 252

 Score =  127 bits (319), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 86/262 (32%), Positives = 126/262 (48%), Gaps = 43/262 (16%)

Query: 20  KDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQ--LNGQLYRPDHSLVDAVTDSWD--KF 75
           K  +I G+    ++++P  S+DLI  DPPYNL     G +     + ++     WD   F
Sbjct: 9   KALLIHGDCFQKMKEIPDTSIDLILCDPPYNLAEYSTGNMKFDWRAEINNDVAEWDLITF 68

Query: 76  SSFEAYDAFTRAWLLACRRVLKPNGTLWV------IGSYHNIFRIGTMLQNLNFWILNDI 129
              +  + FTR        +LKP G +++      IG YH IF       N  F     +
Sbjct: 69  DPQKLVEDFTR--------ILKPKGNIFIFTSYNLIGKYHEIF-------NPIFDTFQFM 113

Query: 130 VWRKSNPMPNFRGRRFQNAHETLI--WASPSPKAKGYTFNYDALKAANEDVQMRSDWLIP 187
           VW K+NP+PN R   F N+ E ++  W       KG+T+N+          QM +    P
Sbjct: 114 VWHKTNPIPNVRKSSFLNSCELIVCLWN------KGHTWNFSTQN------QMHNFIETP 161

Query: 188 ICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRS 247
           IC G ER++N      HPTQKP A+L  I+  ++   DI+ DPF G G++G  A  L R 
Sbjct: 162 ICMGKERIKNPK----HPTQKPLAVLEHIIKIASNENDIVFDPFMGVGSTGHAALNLNRR 217

Query: 248 FIGIEMKQDYIDIATKRIASVQ 269
           F+GIE+ + Y   A  R+   Q
Sbjct: 218 FLGIEIDKKYFAAACDRLTIFQ 239


>gi|332999339|gb|EGK18925.1| hypothetical protein SFK272_4070 [Shigella flexneri K-272]
          Length = 294

 Score =  127 bits (318), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 93/283 (32%), Positives = 141/283 (49%), Gaps = 45/283 (15%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II G++++ L+KLP +SVDL+FADPPYN+  N           D + ++W +       D
Sbjct: 17  IIHGDALAELKKLPTESVDLLFADPPYNIGKN----------FDGLIEAWKE-------D 59

Query: 83  AFTRAWLLA----CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WL      C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 60  LFI-DWLFEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 117

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
             + + + + +E ++       AK YTFN DA+    +    R+  LI       +  N 
Sbjct: 118 QAK-KHYGSMYEPILMMVKD--AKNYTFNGDAILVEAKTGSQRA--LIDYRKNPPQPYNH 172

Query: 199 -----------------DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVA 241
                            D  + HPTQKP+ALL RI+++S+ PGDI+LDPF GS T+GAVA
Sbjct: 173 QKVPGNVWDFPRVRYLMDEYENHPTQKPKALLKRIILASSNPGDIVLDPFAGSFTTGAVA 232

Query: 242 KKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRT 284
               R FIGIE+  +YI +  +R+         EL  +  ++T
Sbjct: 233 IASGRKFIGIEINSEYIKMGLRRLDVASHYSAEELAKVKKRKT 275


>gi|332998382|gb|EGK17981.1| hypothetical protein SFVA6_4185 [Shigella flexneri VA-6]
          Length = 294

 Score =  127 bits (318), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 94/287 (32%), Positives = 142/287 (49%), Gaps = 53/287 (18%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II G++++ L+KLP +SVDL+FADPPYN+  N           D + ++W +       D
Sbjct: 17  IIHGDALAELKKLPTESVDLLFADPPYNIGKN----------FDGLIEAWKE-------D 59

Query: 83  AFTRAWLLA----CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WL      C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 60  LFI-DWLFEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 117

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRS---------------- 182
             + + + + +E ++       AK YTFN DA+    +    R+                
Sbjct: 118 QAK-KHYGSMYEPILMMVKD--AKNYTFNGDAILVEAKTGSQRALIYYRKNPPQPYNHQK 174

Query: 183 ----DWLIPICSGSERLRN-KDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTS 237
                W  P      R+R   D  + HPTQKP+ALL RI+++S+ PGDI+LDPF GS T+
Sbjct: 175 VPGNVWDFP------RVRYLMDEYENHPTQKPKALLKRIILASSNPGDIVLDPFAGSFTT 228

Query: 238 GAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRT 284
           GAVA    R FIGIE+  +YI +  +R+         EL  +  ++T
Sbjct: 229 GAVAIASGRKFIGIEINSEYIKMGLRRLDVASHYSAEELAKVKKRKT 275


>gi|320666839|gb|EFX33818.1| putative methyltransferase [Escherichia coli O157:H7 str. LSU-61]
          Length = 294

 Score =  126 bits (317), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 96/286 (33%), Positives = 141/286 (49%), Gaps = 51/286 (17%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II G++++ L+KLP +SVDLIFADPPYN+  N           D + ++W +       D
Sbjct: 17  IIHGDALAELKKLPTESVDLIFADPPYNIGKN----------FDGLIEAWKE-------D 59

Query: 83  AFTRAWLLA----CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WLL     C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 60  LFI-DWLLEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 117

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRS---------------- 182
             + + + + +E ++       AK YTFN DA+    +    R+                
Sbjct: 118 QAK-KHYGSMYEPILMMVKD--AKNYTFNGDAILVEAKTGSQRALIDYRKNPPQPYNHQK 174

Query: 183 ----DWLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSG 238
                W  P      R    + E L PTQKPEALL RI+++S+ PGDI+LDPF GS T+G
Sbjct: 175 VPGNVWDFPRV----RYLMDEYENL-PTQKPEALLKRIILASSNPGDIVLDPFAGSFTTG 229

Query: 239 AVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRT 284
           AVA    R FIGIE+  +YI +  +R+         EL  +  ++T
Sbjct: 230 AVAIASGRKFIGIEINSEYIKMGLRRLDVASHYSAEELAKVKKRKT 275


>gi|30064593|ref|NP_838764.1| putative methyltransferase [Shigella flexneri 2a str. 2457T]
 gi|56480302|ref|NP_709057.2| putative methyltransferase [Shigella flexneri 2a str. 301]
 gi|110807122|ref|YP_690642.1| putative methyltransferase [Shigella flexneri 5 str. 8401]
 gi|30042852|gb|AAP18575.1| putative methyltransferase [Shigella flexneri 2a str. 2457T]
 gi|56383853|gb|AAN44764.2| putative methyltransferase [Shigella flexneri 2a str. 301]
 gi|110616670|gb|ABF05337.1| putative methyltransferase [Shigella flexneri 5 str. 8401]
 gi|281602639|gb|ADA75623.1| putative methyltransferase [Shigella flexneri 2002017]
 gi|313648496|gb|EFS12938.1| uncharacterized adenine-specific methylase yhdJ [Shigella flexneri
           2a str. 2457T]
 gi|332752424|gb|EGJ82814.1| hypothetical protein SF434370_3499 [Shigella flexneri 4343-70]
 gi|332754622|gb|EGJ84988.1| hypothetical protein SF274771_3895 [Shigella flexneri 2747-71]
 gi|332765261|gb|EGJ95488.1| methyltransferase DNA adenine methyltransferase [Shigella flexneri
           2930-71]
 gi|332999897|gb|EGK19480.1| hypothetical protein SFK218_4295 [Shigella flexneri K-218]
 gi|333014545|gb|EGK33892.1| hypothetical protein SFK304_4117 [Shigella flexneri K-304]
          Length = 294

 Score =  126 bits (317), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 93/283 (32%), Positives = 140/283 (49%), Gaps = 45/283 (15%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II G++ + L+KLP +SVDL+FADPPYN+  N           D + ++W +       D
Sbjct: 17  IIHGDAFAELKKLPTESVDLLFADPPYNIGKN----------FDGLIEAWKE-------D 59

Query: 83  AFTRAWLLA----CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WL      C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 60  LFI-DWLFEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 117

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
             + + + + +E ++       AK YTFN DA+    +    R+  LI       +  N 
Sbjct: 118 QAK-KHYGSMYEPILMMVKD--AKNYTFNGDAILVEAKTGSQRA--LIDYRKNPPQPYNH 172

Query: 199 -----------------DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVA 241
                            D  + HPTQKP+ALL RI+++S+ PGDI+LDPF GS T+GAVA
Sbjct: 173 QKVPGNVWDFPRVRYLMDEYENHPTQKPKALLKRIILASSNPGDIVLDPFAGSFTTGAVA 232

Query: 242 KKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRT 284
               R FIGIE+  +YI +  +R+         EL  +  ++T
Sbjct: 233 IASGRKFIGIEINSEYIKMGLRRLDVASHYSAEELAKVKKRKT 275


>gi|333014708|gb|EGK34054.1| hypothetical protein SFK227_3919 [Shigella flexneri K-227]
          Length = 283

 Score =  126 bits (316), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 93/282 (32%), Positives = 140/282 (49%), Gaps = 45/282 (15%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II G++++ L+KLP +SVDL+FADPPYN+  N           D + ++W +       D
Sbjct: 17  IIHGDALAELKKLPTESVDLLFADPPYNIGKN----------FDGLIEAWKE-------D 59

Query: 83  AFTRAWLLA----CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WL      C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 60  LFID-WLFEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 117

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
             + + + + +E ++       AK YTFN DA+    +    R+  LI       +  N 
Sbjct: 118 QAK-KHYGSMYEPILMMVKD--AKNYTFNGDAILVEAKTGSQRA--LIDYRKNPPQPYNH 172

Query: 199 -----------------DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVA 241
                            D  + HPTQKP+ALL RI+++S+ PGDI+LDPF GS T+GAVA
Sbjct: 173 QKVPGNVWDFPRVRYLMDEYENHPTQKPKALLKRIILASSNPGDIVLDPFAGSFTTGAVA 232

Query: 242 KKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKR 283
               R FIGIE+  +YI +  +R+         EL  +  +R
Sbjct: 233 IASGRKFIGIEINSEYIKMGLRRLDVASHYSAEELAKVKKER 274


>gi|313202777|ref|YP_004041434.1| DNA methylase N-4/N-6 domain protein [Paludibacter propionicigenes
           WB4]
 gi|312442093|gb|ADQ78449.1| DNA methylase N-4/N-6 domain protein [Paludibacter propionicigenes
           WB4]
          Length = 235

 Score =  126 bits (316), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 85/248 (34%), Positives = 127/248 (51%), Gaps = 25/248 (10%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTD-SWDKFSSFEAY 81
           I   + +  L++LP + VDLIF DPPY  Q   Q  +   +  D VT+  +D F S + Y
Sbjct: 6   IYNQSCLDGLKQLPDECVDLIFTDPPY-YQHRAQNVQGLKNHKDVVTEFDFDGFKSEDEY 64

Query: 82  DAFTRAWLLACRRVLKP--NGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPN 139
             F    L+ C RV KP  +G LW    +  +  I  M++   F     I W K+NP P 
Sbjct: 65  LQFLEDVLMECFRVCKPGASGYLWCGDDF--VSFINRMVERTGFQFRKVIHWHKTNPFPA 122

Query: 140 FRGRR-FQNAHETLI-WASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRN 197
              R+ + N+ E L+ ++  SPK    T+N+  +   +  +Q       PIC G ER + 
Sbjct: 123 MYTRKMYANSMELLVHFSKGSPK----TWNHKPVNDMHNFIQ------APICMGKERTK- 171

Query: 198 KDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDY 257
                 H TQKP  +    +  S+  GD++LDPF GSG++   AKKL+R+FIG E+  +Y
Sbjct: 172 ------HKTQKPLKVCMPFIEISSNEGDLVLDPFMGSGSTAVAAKKLKRNFIGYELSTEY 225

Query: 258 IDIATKRI 265
            +IA  R+
Sbjct: 226 CNIANSRL 233


>gi|332752465|gb|EGJ82854.1| hypothetical protein SFK671_3912 [Shigella flexneri K-671]
          Length = 283

 Score =  125 bits (315), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 93/282 (32%), Positives = 139/282 (49%), Gaps = 45/282 (15%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           II G++ + L+KLP +SVDL+FADPPYN+  N           D + ++W +       D
Sbjct: 17  IIHGDAFAELKKLPTESVDLLFADPPYNIGKN----------FDGLIEAWKE-------D 59

Query: 83  AFTRAWLLA----CRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            F   WL      C RVLK  G+++++ S  N+  I    + L F I + IVW   +   
Sbjct: 60  LFID-WLFEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKL-FTIKSRIVWSYDSSGV 117

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
             + + + + +E ++       AK YTFN DA+    +    R+  LI       +  N 
Sbjct: 118 QAK-KHYGSMYEPILMMVKD--AKNYTFNGDAILVEAKTGSQRA--LIDYRKNPPQPYNH 172

Query: 199 -----------------DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVA 241
                            D  + HPTQKP+ALL RI+++S+ PGDI+LDPF GS T+GAVA
Sbjct: 173 QKVPGNVWDFPRVRYLMDEYENHPTQKPKALLKRIILASSNPGDIVLDPFAGSFTTGAVA 232

Query: 242 KKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKR 283
               R FIGIE+  +YI +  +R+         EL  +  +R
Sbjct: 233 IASGRKFIGIEINSEYIKMGLRRLDVASHYSAEELAKVKKER 274


>gi|311070542|ref|YP_003975465.1| DNA methylase N-4/N-6 domain-containing protein [Bacillus
           atrophaeus 1942]
 gi|310871059|gb|ADP34534.1| DNA methylase N-4/N-6 domain-containing protein [Bacillus
           atrophaeus 1942]
          Length = 360

 Score =  124 bits (310), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 89/313 (28%), Positives = 148/313 (47%), Gaps = 54/313 (17%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           +KI  G+++++L  +P  SVDL+   PPYN+       RP                  E 
Sbjct: 36  NKIYNGDTMNMLLDIPDNSVDLVVTSPPYNINKFKNDRRP-----------------LEE 78

Query: 81  YDAFTRAWLLACRRVLKPNGTL-WVIGSYHN--------IFRIGTMLQNLNFWILNDIVW 131
           Y  +    +  C RVLKP+G++ W +G+Y N          R   + ++L  +  N IVW
Sbjct: 79  YLKWQTEIIEQCHRVLKPSGSIFWQVGTYVNDSGAHIPLDIRFFPIFESLGMFPRNRIVW 138

Query: 132 RKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKA-----------ANEDVQM 180
            + + +     ++F   HET++W + +P+   Y F  D ++             ++  ++
Sbjct: 139 VRPHGL--HANKKFAGRHETILWFTKTPE---YKFFLDPIRVPQKYANKKHYKGDKKGEL 193

Query: 181 RSDWLIP----ICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGT 236
             D L      + +      N + + +HPTQ PE ++ RI++S+T+P DI+LDPF G GT
Sbjct: 194 SGDPLGKNPGDVWAFRNVRHNHEEDTIHPTQYPEDMIERIVLSTTEPNDIVLDPFIGMGT 253

Query: 237 SGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVER 296
           + +VAK L R F G E++++Y+DIA + I S +P  N     L   R           + 
Sbjct: 254 TASVAKNLNRYFCGAEIEKEYVDIAYQ-ILSGEPDENNNFPNLKTLR-------QYCEKN 305

Query: 297 GLIQPGQILTNAQ 309
           G+I P Q     Q
Sbjct: 306 GIIDPSQYTFTRQ 318


>gi|20177971|sp|Q45489|MTB2_BACSU RecName: Full=Modification methylase BglII; Short=M.BglII; AltName:
           Full=N(4)- cytosine-specific methyltransferase BglII
 gi|1293620|gb|AAC45061.1| BglII modification methylase [Bacillus subtilis]
          Length = 360

 Score =  123 bits (309), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 89/313 (28%), Positives = 148/313 (47%), Gaps = 54/313 (17%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           +KI  G+++++L  +P  SVDL+   PPYN+       RP                  E 
Sbjct: 36  NKIYNGDTMNMLLDIPDNSVDLVVTSPPYNINKFKNDRRP-----------------LEE 78

Query: 81  YDAFTRAWLLACRRVLKPNGTL-WVIGSYHN--------IFRIGTMLQNLNFWILNDIVW 131
           Y  +    +  C RVLKP+G++ W +G+Y N          R   + ++L  +  N IVW
Sbjct: 79  YLKWQTEIIEQCHRVLKPSGSIFWQVGTYVNDSGAHIPLDIRFFPIFESLGMFPRNRIVW 138

Query: 132 RKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKA-----------ANEDVQM 180
            + + +     ++F   HET++W + +P+   Y F  D ++             ++  ++
Sbjct: 139 VRPHGL--HANKKFAGRHETILWFTKTPE---YKFFLDPIRVPQKYANKKHYKGDKKGEL 193

Query: 181 RSDWLIP----ICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGT 236
             D L      + +      N + + +HPTQ PE ++ RI++S+T+P DI+LDPF G GT
Sbjct: 194 SGDPLGKNPGDVWAFRNVRHNHEEDTIHPTQYPEDMIERIVLSTTEPNDIVLDPFIGMGT 253

Query: 237 SGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVER 296
           + +VAK L R F G E++++Y+DIA + I S +P  N     L   R           + 
Sbjct: 254 TASVAKNLNRYFYGAEIEKEYVDIAYQ-ILSGEPDENNNFPNLKTLR-------QYCEKN 305

Query: 297 GLIQPGQILTNAQ 309
           G+I P Q     Q
Sbjct: 306 GIIDPSQYTFTRQ 318


>gi|283783020|ref|YP_003373774.1| DNA (cytosine-5-)-methyltransferase [Gardnerella vaginalis 409-05]
 gi|298253560|ref|ZP_06977350.1| DNA modification methylase [Gardnerella vaginalis 5-1]
 gi|283442049|gb|ADB14515.1| DNA (cytosine-5-)-methyltransferase [Gardnerella vaginalis 409-05]
 gi|297532327|gb|EFH71215.1| DNA modification methylase [Gardnerella vaginalis 5-1]
          Length = 239

 Score =  123 bits (309), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 83/253 (32%), Positives = 123/253 (48%), Gaps = 26/253 (10%)

Query: 20  KDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDS------WD 73
           K ++   + I  ++ L AKS+DLI  DPPYNL   G   +   + +  + D+      WD
Sbjct: 3   KIELYNDDCIVAMDNLRAKSIDLIVTDPPYNL---GSFMKTRDTNLKKMRDNFFAAAGWD 59

Query: 74  KFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRK 133
               FE +     ++     RV+K  G++ V  +   +  I  + +   F+     +W K
Sbjct: 60  DMG-FEEWKKSMESFFELSSRVMKKGGSMIVFMAIIKVETIIKLAEEYGFYYKTTGIWHK 118

Query: 134 SNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWL-IPICSGS 192
           +NPMP      F N+ E   W   + K K  TFN            M  D++   +   S
Sbjct: 119 TNPMPRNMNLHFVNSTEA--WVYFTYKTKTGTFNNGG--------AMFHDFIETSVTPNS 168

Query: 193 ERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIE 252
           ER   K     HPTQKPE+L+   +   + PGD ILDPF GSGT+G V+K+  R+FIGIE
Sbjct: 169 ERKYGK-----HPTQKPESLMQHFVEILSNPGDNILDPFMGSGTTGVVSKRAGRNFIGIE 223

Query: 253 MKQDYIDIATKRI 265
           +  +Y +IA  RI
Sbjct: 224 LNSEYYNIAKSRI 236


>gi|172036749|ref|YP_001803250.1| putative methyltransferase [Cyanothece sp. ATCC 51142]
 gi|171698203|gb|ACB51184.1| probable DNA-methyltransferase [Cyanothece sp. ATCC 51142]
          Length = 284

 Score =  123 bits (309), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 89/261 (34%), Positives = 141/261 (54%), Gaps = 35/261 (13%)

Query: 23  IIKGNSISVLEK-LPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           I+ G+SI +L++ +  +S+ LIF DPPYN+   G+ Y           +  DK+ + E Y
Sbjct: 12  ILFGDSIKLLDQEIQDESIHLIFVDPPYNI---GKKY----------ANFIDKWPTEENY 58

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFR 141
             +  +WL  C + L P G+++++ S   I  +   L+  +  IL+ I+W   +     +
Sbjct: 59  LLWCYSWLELCFKKLHPEGSIYLMASTQTIPYLDIYLRK-HIHILSRIIWHYDSSGVQAK 117

Query: 142 GRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRS--DW--LIPICSGSE---- 193
              F + +E +I+   +PK+  YTFN D +K   +    R   D+   IP    S     
Sbjct: 118 NY-FGSLYEPIIYGVKNPKS--YTFNRDDIKVEAKTGSKRKLIDYRKAIPKVYNSHKVPG 174

Query: 194 --------RLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLR 245
                   R R ++ EK HPTQKPEALL RI+++S+  GD ILDPF G+ T+ AVA+K+ 
Sbjct: 175 NVWYFPRVRYRMEEYEK-HPTQKPEALLKRIILASSNVGDTILDPFAGTFTTSAVAQKVG 233

Query: 246 RSFIGIEMKQDYIDIATKRIA 266
           R  IGIE+++DYI I  +R+ 
Sbjct: 234 RKSIGIEIEEDYIKIGLRRLG 254


>gi|218459652|ref|ZP_03499743.1| site-specific DNA-methyltransferase (adenine-specific) protein
           [Rhizobium etli Kim 5]
          Length = 101

 Score =  122 bits (307), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 57/97 (58%), Positives = 73/97 (75%)

Query: 276 LTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTLISGTELGSIHRVG 335
           +TV+TGK+ E RVAFN+LVE GLI+PGQ+LT+A+   SA V ADGT+ SG E GSIHR+G
Sbjct: 1   MTVMTGKKAEVRVAFNVLVESGLIKPGQVLTDAKRRYSAIVRADGTVASGGEAGSIHRLG 60

Query: 336 AKVSGSETCNGWNFWYFEKLGELHSINTLRILVRKEL 372
           AKV G + CNGW FW+FE    L  I+ LR ++R +L
Sbjct: 61  AKVQGLDACNGWTFWHFEDGQSLRPIDDLRSVIRSDL 97


>gi|218440461|ref|YP_002378790.1| methyltransferase [Cyanothece sp. PCC 7424]
 gi|218173189|gb|ACK71922.1| Site-specific DNA-methyltransferase (adenine-specific) [Cyanothece
           sp. PCC 7424]
          Length = 283

 Score =  122 bits (307), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 88/263 (33%), Positives = 141/263 (53%), Gaps = 33/263 (12%)

Query: 23  IIKGNSISVL-EKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           I  G++++VL E++ ++S++LIF DPPYN+   G+ +           D +DK+ S E Y
Sbjct: 12  IFHGDALTVLLEEIDSESIELIFLDPPYNI---GKRF----------GDFYDKWLSDEDY 58

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFR 141
             +   WL  C RVLKPNGTL+V+ S  ++      L+     IL+ I+W   +      
Sbjct: 59  VEWAYKWLDECIRVLKPNGTLYVMTSTQSMPYFDIYLRK-KLTILSRIIWHYDSSGVQ-A 116

Query: 142 GRRFQNAHETLIWASPSPKAKGYTFNYDALK------AANEDVQMRSDWLIPICSGS--- 192
            + F + +E ++        K Y FN +A+K      A  + +  R     P  +     
Sbjct: 117 SKYFGSMYEPILHCVKD--KKNYIFNSEAIKIEAKTGAKRKLIDYRKTIPTPYNTNKIPG 174

Query: 193 -----ERLRNKDGE-KLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRR 246
                 R+R +  E + HP+QKPE+LL RI+++S+   D+ILDPF G+ T+ AVAK+LRR
Sbjct: 175 NVWYFSRVRYRMEEYENHPSQKPESLLERIILASSNEKDLILDPFAGTFTAAAVAKRLRR 234

Query: 247 SFIGIEMKQDYIDIATKRIASVQ 269
           + I IE +++Y+ I  +RI   Q
Sbjct: 235 NSISIESQEEYLKIGLRRILDWQ 257


>gi|225870198|ref|YP_002746145.1| DNA methylase [Streptococcus equi subsp. equi 4047]
 gi|225699602|emb|CAW93244.1| putative DNA methylase [Streptococcus equi subsp. equi 4047]
          Length = 236

 Score =  121 bits (303), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 76/247 (30%), Positives = 114/247 (46%), Gaps = 24/247 (9%)

Query: 26  GNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFT 85
           GN + +L +L   S+D++  DPPYN+ +         + +D     WDK +         
Sbjct: 13  GNCLELLTELTDGSIDMVITDPPYNISVKNNFATMGRTGIDF--GDWDKGADL------- 63

Query: 86  RAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRF 145
            +W+    R L  NG + +   + N+  I    +     + +   W K NPMP  R RR+
Sbjct: 64  LSWIDIASRKLTKNGGMVIFNDWKNLGDIARHCEKTGLAVKDIFRWVKDNPMPRNRDRRY 123

Query: 146 QNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHP 205
               E  IW     K   + FN  + K        R ++  PI SG+E+ +       HP
Sbjct: 124 ITDSEYGIWVVR--KNSKWVFNRKSEKYD------RPEYRYPIVSGAEKTQ-------HP 168

Query: 206 TQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRI 265
           TQKP AL+  I+   T    ++LDPF GSG++G       R FIG E+ +DY +IA KRI
Sbjct: 169 TQKPVALMRDIITRHTTKRAVVLDPFMGSGSTGVACLLTERDFIGYELNKDYFNIANKRI 228

Query: 266 ASVQPLG 272
           A +   G
Sbjct: 229 AELTGNG 235


>gi|261838927|gb|ACX98692.1| adenine specific DNA methyltransferase (dpnA) [Helicobacter pylori
           52]
          Length = 232

 Score =  121 bits (303), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 82/229 (35%), Positives = 113/229 (49%), Gaps = 23/229 (10%)

Query: 39  SVDLIFADPPYNLQLNGQLYRPDHSLVDAVT-DSWDK-FSSFEAYDAFTRAWLLACRRVL 96
            VD I  DPPYN+ +        ++    +    WDK F   E        W+     ++
Sbjct: 22  KVDAIITDPPYNISVKNNFSTLKNAKRQGIDFGEWDKNFKLLE--------WIKRYAPLV 73

Query: 97  KPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWAS 156
            PNG + +  SY  I  I   L+   F + + I W K+NPMP    RR+    E  +WA 
Sbjct: 74  NPNGCMVIFCSYRFISYIADFLEENGFVVKDFIQWVKNNPMPRNINRRYVQDTEFALWAV 133

Query: 157 PSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRI 216
              KAK + FN    K  NE          P+ SG ER++       HPTQK  AL+ +I
Sbjct: 134 KK-KAK-WVFN----KPKNEKYLRPLILKSPVVSGLERVK-------HPTQKSLALMEKI 180

Query: 217 LVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRI 265
           +   T P DI+LDPF GSGT+G   K+L R+FIGIE +++Y  IA KR+
Sbjct: 181 ISIHTNPNDIVLDPFMGSGTTGLACKRLERNFIGIESEKEYFQIAKKRL 229


>gi|17546701|ref|NP_520103.1| DNA-methyltransferase (DNA-modification methylase) protein
           [Ralstonia solanacearum GMI1000]
 gi|17429000|emb|CAD15684.1| probable dna-methyltransferase (dna-modification methylase) protein
           [Ralstonia solanacearum GMI1000]
          Length = 270

 Score =  121 bits (303), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 86/267 (32%), Positives = 137/267 (51%), Gaps = 33/267 (12%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           D I   + I+ + +L   SVDL+ ADPPY L   G+ Y  D           DK S  EA
Sbjct: 7   DGIFNEDCIAGVGRLADGSVDLVIADPPYGL---GKDYGNDS----------DKLSG-EA 52

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           Y A++  W+ A    L  NG+L++  ++     +  ML+     ++N+I+W +  P    
Sbjct: 53  YLAWSERWIEAVLPKLARNGSLYLFCTWQYAPELFVMLKR-RLSMINEIIWDRRVPSMGG 111

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAA--NEDVQMRS-------DWLIPICSG 191
             R+F + H+ + + + S   + Y F+ DA++     E  + RS        WL    + 
Sbjct: 112 STRKFSSVHDNIGFFAAS---RDYYFDVDAVRIPYDAETKKARSRKRFEGKKWLEVGYNP 168

Query: 192 SE-----RLRNKDGEKL-HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLR 245
            +     RL  +D E+  HPTQKP  L+ R++++S  PG ++LDPF GSGT+ A   +L 
Sbjct: 169 KDVWSVSRLHRQDPERAEHPTQKPLELVERMVLASCPPGGLVLDPFLGSGTTAAACARLG 228

Query: 246 RSFIGIEMKQDYIDIATKRIASVQPLG 272
           R F G E+  +Y  +A +R+A+V PLG
Sbjct: 229 RRFAGFEINAEYCRVARERVAAVTPLG 255


>gi|71911257|ref|YP_282807.1| adenine-specific methyltransferase [Streptococcus pyogenes
           MGAS5005]
 gi|94989076|ref|YP_597177.1| adenine-specific methyltransferase [Streptococcus pyogenes
           MGAS9429]
 gi|94992967|ref|YP_601066.1| adenine-specific methyltransferase [Streptococcus pyogenes
           MGAS2096]
 gi|71854039|gb|AAZ52062.1| adenine-specific methyltransferase [Streptococcus pyogenes
           MGAS5005]
 gi|94542584|gb|ABF32633.1| adenine-specific methyltransferase [Streptococcus pyogenes
           MGAS9429]
 gi|94546475|gb|ABF36522.1| Adenine-specific methyltransferase [Streptococcus pyogenes
           MGAS2096]
          Length = 283

 Score =  120 bits (302), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 77/259 (29%), Positives = 124/259 (47%), Gaps = 26/259 (10%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           +I  GN + +L +L    +D++  DPPYN+ +         + +D     WDK      +
Sbjct: 2   EIKCGNCLELLAELTDGLIDMVITDPPYNISVKNNFATMGRTGIDF--GDWDK-----GF 54

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIV-WRKSNPMPNF 140
           D  +  W+    + L  NG + +   + N+  I    +  N  ++ DI  W K NPMP  
Sbjct: 55  DLLS--WIDIASQKLTKNGGMIIFNDWKNLGDIARHCEK-NGLVVKDIFRWVKDNPMPRN 111

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
           R RR+    E  +W     K   + FN  + K        R ++  P+ +G+E+ +    
Sbjct: 112 RDRRYITDSEYGVWVVR--KKSKWVFNRKSEKYD------RPEYRYPVVAGAEKTQ---- 159

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
              HPTQKP AL+  I+   T  G ++LDPF GSG++G       R FIG E+ +DY +I
Sbjct: 160 ---HPTQKPVALMKDIITRHTTKGAVVLDPFMGSGSTGVACLLTGRDFIGYELNKDYFNI 216

Query: 261 ATKRIASVQPLGNIELTVL 279
           A KRIA +   G + + ++
Sbjct: 217 ANKRIAELTGNGGVGMNII 235


>gi|317179559|dbj|BAJ57347.1| adenine specific DNA methyltransferase [Helicobacter pylori F30]
          Length = 232

 Score =  120 bits (302), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 81/228 (35%), Positives = 113/228 (49%), Gaps = 23/228 (10%)

Query: 40  VDLIFADPPYNLQLNGQLYRPDHSLVDAVT-DSWDK-FSSFEAYDAFTRAWLLACRRVLK 97
           VD I  DPPYN+ +         +    +    WDK F   E        W+     ++ 
Sbjct: 23  VDAIITDPPYNISVKNNFSTLKSAKRQGIDFGEWDKNFRLLE--------WIKRYASLVN 74

Query: 98  PNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASP 157
           PNG + +  SY  I  I   L+   F + + I W K+NPMP    RR+    E  +WA  
Sbjct: 75  PNGCMVIFCSYRFISYIADFLEENGFVVKDFIQWVKTNPMPRNIHRRYVQDTEFALWAVK 134

Query: 158 SPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRIL 217
             KAK + FN    K  NE          P+ SG ER++       HPTQK  AL+ +I+
Sbjct: 135 K-KAK-WVFN----KPKNEKYLRPLILKSPVVSGIERVK-------HPTQKSLALMEKII 181

Query: 218 VSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRI 265
              T P DI+LDPF GSGT+G   K+L+R+FIGIE +++Y  I+ KR+
Sbjct: 182 SIHTNPNDIVLDPFMGSGTTGLACKRLKRNFIGIESEKEYFQISKKRL 229


>gi|308061349|gb|ADO03237.1| adenine specific DNA methyltransferase (dpnA) [Helicobacter pylori
           Cuz20]
          Length = 232

 Score =  120 bits (302), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 82/247 (33%), Positives = 119/247 (48%), Gaps = 23/247 (9%)

Query: 22  KIIKGNSISVLEKLPAKS--VDLIFADPPYNLQLNGQLYRPDHSLVDAVT-DSWDKFSSF 78
           +I   N+  +++    ++  VD I  DPPYN+ +         +    +    WDK   F
Sbjct: 3   QIYHANAFEIIKDFYQQNLKVDAIITDPPYNISVKNNFSTLKSATRQGIDFGEWDKNFKF 62

Query: 79  EAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
                    W+     ++ PNG + +  SY  I  I   L+   F + + I W K+NPMP
Sbjct: 63  -------LEWIKRYAPLVNPNGCMVIFCSYRFISYIADFLEENGFVVKDFIQWVKNNPMP 115

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
               RR+    E  +WA    KAK + FN    K  NE          P+  G ER++  
Sbjct: 116 RNINRRYVQDTEFALWAVKK-KAK-WVFN----KPKNEKYLRPLILKSPVVGGLERVK-- 167

Query: 199 DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYI 258
                HPTQK  AL+ +I+   T P DI+LDPF GSGT+G   K+L R+FIGIE +++Y 
Sbjct: 168 -----HPTQKSLALMEKIISIHTNPNDIVLDPFMGSGTTGLACKRLERNFIGIESEKEYF 222

Query: 259 DIATKRI 265
            IA KR+
Sbjct: 223 QIAKKRL 229


>gi|229826749|ref|ZP_04452818.1| hypothetical protein GCWU000182_02125 [Abiotrophia defectiva ATCC
           49176]
 gi|229789619|gb|EEP25733.1| hypothetical protein GCWU000182_02125 [Abiotrophia defectiva ATCC
           49176]
          Length = 312

 Score =  120 bits (302), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 87/273 (31%), Positives = 135/273 (49%), Gaps = 56/273 (20%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQ--LNGQLYRPDHSLVDAVTDSWDKFSSF 78
           DK I GN++ +L  LP  SVDL+  DPPYNL    +G  +               K +S 
Sbjct: 37  DKTILGNTLEILSLLPENSVDLLIVDPPYNLDKDFHGNKF---------------KRTSG 81

Query: 79  EAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
           E Y+ +T +W+   + +LK N T++V   + +  +I  +L+   F + N I W++     
Sbjct: 82  EIYEEYTESWIKLVKPLLKKNATIYVCCDWLSSSQIFMVLKEY-FHVQNRITWQRE---- 136

Query: 139 NFRGR----RFQNAHETLIWASPSPKAKGYTFNYDALK------AANEDVQMRSDWLIPI 188
             +GR     ++N  E + +A+ S K   YTFN +A+K      A  ++     DW    
Sbjct: 137 --KGRGALTNWKNGMEDIWFATNSNK---YTFNVEAVKVRRSVIAPYKEDGKPKDWEE-- 189

Query: 189 CSGSERLRNKDGEKL----------------HPTQKPEALLSRILVSSTKPGDIILDPFF 232
            +   R RN                      HPTQKPE LL++++++S+  GD++LDPF 
Sbjct: 190 -TKEGRFRNTYPSNFWDDISIPYWSMPENTAHPTQKPEKLLAKLILASSNEGDVVLDPFL 248

Query: 233 GSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRI 265
           GSG++   AKKL R +IGIE  + Y   A KR+
Sbjct: 249 GSGSTSVTAKKLGRHYIGIEQNEQYCVWAEKRL 281


>gi|320101941|ref|YP_004177532.1| DNA methylase N-4/N-6 domain-containing protein [Isosphaera pallida
           ATCC 43644]
 gi|319749223|gb|ADV60983.1| DNA methylase N-4/N-6 domain protein [Isosphaera pallida ATCC
           43644]
          Length = 336

 Score =  120 bits (301), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 89/284 (31%), Positives = 133/284 (46%), Gaps = 54/284 (19%)

Query: 19  WKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSF 78
           W   I  G+ I+ + +L  KSVDLIFADPP+N+   G  Y       D   D  D     
Sbjct: 39  WDQVIHVGDCIAGMNQLEDKSVDLIFADPPFNI---GYTY-------DVYNDRCDD---- 84

Query: 79  EAYDAFTRAWLLACRRVLKPNGTLWV-IGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPM 137
           + Y A++R W+ A  RVL P GT W+ IG          M + L       I+W  +  +
Sbjct: 85  QEYLAWSRRWIEAAVRVLSPTGTFWLAIGDDFAAELKVLMHRELGLTFRGWIIWYYTFGV 144

Query: 138 PNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSD-------------- 183
                R+F  +H  L++ +  P+   +TFN DA++  +   ++ +D              
Sbjct: 145 --HCKRKFTRSHTHLLYFTRHPR--DFTFNADAIRVPSARQRVYNDKRAHPLGRVPDDTW 200

Query: 184 -----------------WLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDI 226
                            W +P   G+ R R    +  H  Q PE +L RI+ + + PGD+
Sbjct: 201 ILRPQDFPGGFGPDQSVWHVPRVCGTFRER----QGWHGCQMPERILGRIMSACSNPGDL 256

Query: 227 ILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQP 270
           +LDPF GSGT+ AVA+KL R  +G E+  DY   A +R+ SV+P
Sbjct: 257 VLDPFVGSGTTLAVARKLHRRGVGFELSADYAMNACQRLESVRP 300


>gi|15611114|ref|NP_222765.1| putative type II DNA modification enzyme (methyltransferase)
           [Helicobacter pylori J99]
 gi|4154542|gb|AAD05620.1| putative TYPE II DNA MODIFICATION ENZYME (METHYLTRANSFERASE)
           [Helicobacter pylori J99]
          Length = 230

 Score =  120 bits (301), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 82/249 (32%), Positives = 121/249 (48%), Gaps = 25/249 (10%)

Query: 22  KIIKGNSISVLEKLPAKS--VDLIFADPPYNLQLNGQLYRPDHSLVDAVT-DSWDK-FSS 77
           +I   N+  +++    ++  VD I  DPPYN+ +         +    +    WDK F  
Sbjct: 3   QIHHANAFEIIKDFHQQNLKVDAIITDPPYNISVKNNFSTLKSAKRQGIDFGEWDKNFKL 62

Query: 78  FEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPM 137
            E        W+     ++ PNG + +  SY  I  I   L+   F + + I W K+NPM
Sbjct: 63  LE--------WIARYASLINPNGCMVIFCSYRFISYIADFLEENGFVVKDFIQWVKNNPM 114

Query: 138 PNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRN 197
           P    RR+    E  +WA    KAK + FN    K  NE          P+ SG ER++ 
Sbjct: 115 PRNIHRRYVQDTEFALWAVKK-KAK-WVFN----KPKNEKYLRPLILKSPVVSGIERVK- 167

Query: 198 KDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDY 257
                 HPTQK   L+ +I+ + T P D +LDPF GSGT+G   K L+R+FIGIE +++Y
Sbjct: 168 ------HPTQKSLTLMEKIISTHTNPNDTVLDPFMGSGTTGLACKNLKRNFIGIESEKEY 221

Query: 258 IDIATKRIA 266
             IA KR++
Sbjct: 222 FQIAQKRLS 230


>gi|317013473|gb|ADU80909.1| putative type II DNA modification enzyme (methyltransferase)
           [Helicobacter pylori Gambia94/24]
          Length = 230

 Score =  120 bits (300), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 83/249 (33%), Positives = 121/249 (48%), Gaps = 25/249 (10%)

Query: 22  KIIKGNSISVLEKLPAKS--VDLIFADPPYNLQLNGQLYRPDHSLVDAVT-DSWDK-FSS 77
           +I   N+  +++    ++  VD I  DPPYN+ +         +    +    WDK F  
Sbjct: 3   QIHHANAFEIIKDFHQQNLKVDAIITDPPYNISVQNNFSTLKSAKRQGIDFGEWDKNFKL 62

Query: 78  FEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPM 137
            E        W+     ++ PNG + +  SY  I  I   L+   F + + I W K+NPM
Sbjct: 63  LE--------WITRYAPLINPNGCMVIFCSYRFISYIADFLEENGFVVKDFIQWVKNNPM 114

Query: 138 PNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRN 197
           P    RR+    E  +WA    KAK + FN    K  NE          P+ SG ER++ 
Sbjct: 115 PRNIHRRYVQDTEFALWAVKK-KAK-WVFN----KPENEKYLRPLILKSPVVSGIERVK- 167

Query: 198 KDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDY 257
                 HPTQK   L+ +I+   T P DI+LDPF GSGT+G   K L+R+FIGIE +++Y
Sbjct: 168 ------HPTQKSLVLMEKIISIHTNPNDIVLDPFMGSGTTGLACKNLKRNFIGIESEKEY 221

Query: 258 IDIATKRIA 266
             IA KR++
Sbjct: 222 FQIAQKRLS 230


>gi|329914377|ref|ZP_08276110.1| putative DNA-methyltransferase (DNA-modification methylase)
           [Oxalobacteraceae bacterium IMCC9480]
 gi|327545139|gb|EGF30424.1| putative DNA-methyltransferase (DNA-modification methylase)
           [Oxalobacteraceae bacterium IMCC9480]
          Length = 258

 Score =  120 bits (300), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 80/266 (30%), Positives = 136/266 (51%), Gaps = 33/266 (12%)

Query: 18  EWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSS 77
           +W++++   ++++ L ++P   +DLI ADPPY L   G+ Y  D           DK ++
Sbjct: 3   DWQNQVFCEDALAGLARIPDGVIDLILADPPYGL---GKDYGNDS----------DKLAT 49

Query: 78  FEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPM 137
            E Y A+   W+ A    LKPNG+L++  ++     I  +L+     ++N+IVW +  P 
Sbjct: 50  AE-YLAWMERWIDAALPKLKPNGSLYIFLTWRYSPEIFVLLKQ-RMTMVNEIVWDRRVPS 107

Query: 138 PNFRGRRFQNAHETLIWASPSPKAKGYTFNYDAL---------KAANEDVQMRSDWL--- 185
                R++ + H+T+ + + S   K Y F+ DA+         KA +  + + + WL   
Sbjct: 108 MGGTVRKYSSVHDTIGFFANS---KDYYFDLDAIRIPYDAVTKKARSRSIFVGAKWLELG 164

Query: 186 ---IPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAK 242
                + S S   R       HPTQKP  ++ R++ +S  PG I+LDPF GSGT+   AK
Sbjct: 165 YNPKDVWSVSRLHREHRERADHPTQKPLEIIERMVKASCPPGGIVLDPFMGSGTTAVAAK 224

Query: 243 KLRRSFIGIEMKQDYIDIATKRIASV 268
           +  R F+G E+  DY  +  +R+A +
Sbjct: 225 RAGRQFVGFELNADYCAMIAQRLAQL 250


>gi|299066411|emb|CBJ37596.1| Site-specific DNA-methyltransferase (adenine-specific) [Ralstonia
           solanacearum CMR15]
          Length = 270

 Score =  120 bits (300), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 86/267 (32%), Positives = 136/267 (50%), Gaps = 33/267 (12%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           D I   + I+ +  L   SVDL+ ADPPY L   G+ Y  D           DK S  EA
Sbjct: 7   DGIFNEDCIAGVGHLADGSVDLVIADPPYGL---GKDYGNDS----------DKLSG-EA 52

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           Y A++  W+ A    L  NG+L++  ++     +  ML+     ++N+I+W +  P    
Sbjct: 53  YLAWSERWIEAVLPKLARNGSLYLFCTWQYAPELFVMLKR-RLSMINEIIWDRRVPSMGG 111

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAA--NEDVQMRS-------DWLIPICSG 191
             R+F + H+ + + + S   + Y F+ DA++     E  + RS        WL    + 
Sbjct: 112 STRKFSSVHDNIGFFAAS---RDYYFDVDAVRIPYDAETKKARSRKRFEGKKWLEVGYNP 168

Query: 192 SE-----RLRNKDGEKL-HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLR 245
            +     RL  +D E+  HPTQKP  L+ R++++S  PG ++LDPF GSGT+ A   +L 
Sbjct: 169 KDVWSVSRLHRQDPERAEHPTQKPLELVERMVLASCPPGGLVLDPFLGSGTTAAACARLG 228

Query: 246 RSFIGIEMKQDYIDIATKRIASVQPLG 272
           R F G E+  +Y  +A +R+A+V PLG
Sbjct: 229 RRFAGFEINAEYCRVARERVAAVTPLG 255


>gi|317179855|dbj|BAJ57641.1| adenine specific DNA methyltransferase [Helicobacter pylori F32]
          Length = 232

 Score =  120 bits (300), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 83/248 (33%), Positives = 121/248 (48%), Gaps = 25/248 (10%)

Query: 22  KIIKGNSISVLEKLPAKS--VDLIFADPPYNLQLNGQLYRPDHSLVDAVT-DSWDK-FSS 77
           +I   N+  +++    ++  VD I  DPPYN+ +         +    +    WDK F  
Sbjct: 3   QIYHANAFEIIKDFYQQNLKVDAIITDPPYNISVKNNFSTLKSAKRQGIDFGEWDKNFKL 62

Query: 78  FEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPM 137
            E        W+     ++ PNG + +  SY  I  I   L+   F + + I W K+NPM
Sbjct: 63  LE--------WIKRYAPLVNPNGCMVIFCSYRFISYIADFLEENGFIVKDFIQWVKNNPM 114

Query: 138 PNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRN 197
           P    RR+    E  +WA    KAK + FN    K  NE          P+ SG ER++ 
Sbjct: 115 PRNINRRYVQDTEFALWAVKK-KAK-WVFN----KPKNEKYLRPLILKSPVVSGLERVK- 167

Query: 198 KDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDY 257
                 HPTQK   L+ +I+   T P DI+LDPF GSGT+G   K+L+R+FIGIE +++Y
Sbjct: 168 ------HPTQKSLDLMEKIISIHTNPNDIVLDPFMGSGTTGLACKRLKRNFIGIESEKEY 221

Query: 258 IDIATKRI 265
             IA KR+
Sbjct: 222 FQIAKKRL 229


>gi|332672852|gb|AEE69669.1| possible site-specific DNA-methyltransferase (adenine-specific)
           [Helicobacter pylori 83]
          Length = 232

 Score =  119 bits (299), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 81/228 (35%), Positives = 112/228 (49%), Gaps = 23/228 (10%)

Query: 40  VDLIFADPPYNLQLNGQLYRPDHSLVDAVT-DSWDK-FSSFEAYDAFTRAWLLACRRVLK 97
           VD I  DPPYN+ +         +    +    WDK F   E        W+     ++ 
Sbjct: 23  VDAIITDPPYNISVKNNFSTLKSAKRQGIDFGEWDKNFRLLE--------WIKRYAPLVN 74

Query: 98  PNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASP 157
           PNG + +  SY  I  I   L+   F + + I W K+NPMP    RR+    E  +WA  
Sbjct: 75  PNGCMVIFCSYRFISYIADFLEENGFVVKDFIQWVKNNPMPRNISRRYVQDTEFALWAVK 134

Query: 158 SPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRIL 217
             KAK + FN    K  NE          P+ SG ER++       HPTQK   L+ +I+
Sbjct: 135 K-KAK-WVFN----KPKNEKYLRPLILKSPVVSGLERVK-------HPTQKSLTLMEKII 181

Query: 218 VSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRI 265
              T P DI+LDPF GSGT+G   K+L+R+FIGIE +++Y  IA KR+
Sbjct: 182 SIHTNPNDIVLDPFMGSGTTGLACKRLKRNFIGIESEKEYFQIAKKRL 229


>gi|126658932|ref|ZP_01730074.1| DNA methylase N-4/N-6 [Cyanothece sp. CCY0110]
 gi|126619730|gb|EAZ90457.1| DNA methylase N-4/N-6 [Cyanothece sp. CCY0110]
          Length = 367

 Score =  119 bits (299), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 82/273 (30%), Positives = 132/273 (48%), Gaps = 55/273 (20%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           ++I  G+ +++L +LP + VDL+ + PPYNL   G+ Y    +L              + 
Sbjct: 11  NQIFLGDCLALLSQLPNECVDLVISSPPYNL---GKEYEAKKAL--------------DN 53

Query: 81  YDAFTRAWLLACRRVLKPNGTL-WVIGSYHNI-------FRIGTMLQNLNFWILNDIVWR 132
           Y A     L  C R+LK  G++ W +G+Y N         R   +L++      N I+W 
Sbjct: 54  YLAEQTLVLQECSRILKKTGSIFWQVGAYSNQGSLIPLDIRFFPILESCGLIPRNRIIWV 113

Query: 133 KSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALK-------------------A 173
           + + +      +F   HET++W + SPK   YTFN DA++                   +
Sbjct: 114 RQHGL--HAQNKFSCRHETILWFTKSPK---YTFNLDAIRIPQKYQNKKYYKGNKKGKLS 168

Query: 174 ANEDVQMRSD-WLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFF 232
            N   +   D WL           N + + +HP Q PE L++RI++++T   DII DP+ 
Sbjct: 169 CNPKGKNPGDIWLFRNVK-----HNHEEQTIHPCQFPEDLVARIILATTNSNDIIFDPYL 223

Query: 233 GSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRI 265
           GSGT   V+K  +R FIG E+++ Y DIA +R+
Sbjct: 224 GSGTVAVVSKNYKRYFIGSEIEEKYYDIALRRL 256


>gi|188526859|ref|YP_001909546.1| adenine specific DNA methyltransferase (dpnA) [Helicobacter pylori
           Shi470]
 gi|188143099|gb|ACD47516.1| adenine specific DNA methyltransferase (dpnA) [Helicobacter pylori
           Shi470]
          Length = 232

 Score =  119 bits (298), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 81/229 (35%), Positives = 111/229 (48%), Gaps = 23/229 (10%)

Query: 39  SVDLIFADPPYNLQLNGQLYRPDHSLVDAVT-DSWDK-FSSFEAYDAFTRAWLLACRRVL 96
            VD I  DPPYN+ +         +    +    WDK F   E        W+     ++
Sbjct: 22  KVDAIITDPPYNISVKNNFSTLKSATRQGIDFGEWDKNFRLLE--------WIKRYAPLV 73

Query: 97  KPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWAS 156
            PNG + +  SY  I  I   L+   F + + I W K+NPMP    RR+    E  +WA 
Sbjct: 74  NPNGCMVIFCSYRFISYIADFLEENGFVVKDFIQWVKNNPMPRNINRRYVQDTEFALWAV 133

Query: 157 PSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRI 216
              KAK + FN    K  NE          P+  G ER++       HPTQK  AL+ +I
Sbjct: 134 KK-KAK-WVFN----KPKNEKYLRPLILKSPVVGGLERVK-------HPTQKSLALMEKI 180

Query: 217 LVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRI 265
           +   T P DI+LDPF GSGT+G   K L+R+FIGIE +++Y  IA KR+
Sbjct: 181 ISIHTNPNDIVLDPFMGSGTTGLACKHLKRNFIGIESEKEYFQIAKKRL 229


>gi|308062919|gb|ADO04806.1| adenine specific DNA methyltransferase (dpnA) [Helicobacter pylori
           Sat464]
          Length = 232

 Score =  119 bits (297), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 81/229 (35%), Positives = 111/229 (48%), Gaps = 23/229 (10%)

Query: 39  SVDLIFADPPYNLQLNGQLYRPDHSLVDAVT-DSWDK-FSSFEAYDAFTRAWLLACRRVL 96
            VD I  DPPYN+ +         +    +    WDK F   E        W+     ++
Sbjct: 22  KVDAIITDPPYNISVKNNFSTLKSAKRQGIDFGEWDKNFRLLE--------WIKRYAPLV 73

Query: 97  KPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWAS 156
            PNG + +  SY  I  I   L+   F + + I W K+NPMP    RR+    E  +WA 
Sbjct: 74  NPNGCMVIFCSYRFISYIADFLEENGFVVKDFIQWVKNNPMPRNINRRYVQDTEFALWAV 133

Query: 157 PSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRI 216
              KAK + FN    K  NE          P+  G ER++       HPTQK  AL+ +I
Sbjct: 134 KK-KAK-WVFN----KPKNEKYLRPLILKSPVVGGLERVK-------HPTQKSLALMEKI 180

Query: 217 LVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRI 265
           +   T P DI+LDPF GSGT+G   K L+R+FIGIE +++Y  IA KR+
Sbjct: 181 ISIHTNPNDIVLDPFMGSGTTGLACKHLKRNFIGIESEKEYFQIAKKRL 229


>gi|317008725|gb|ADU79305.1| adenine specific DNA methyltransferase (putative type II)
           [Helicobacter pylori India7]
          Length = 232

 Score =  118 bits (296), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 80/229 (34%), Positives = 110/229 (48%), Gaps = 23/229 (10%)

Query: 39  SVDLIFADPPYNLQLNGQLYRPDHSLVDAVT-DSWDK-FSSFEAYDAFTRAWLLACRRVL 96
            VD I  DPPYN+ +         +    +    WDK F   E        W+     ++
Sbjct: 22  KVDAIITDPPYNISVKNNFSTLKSAKRQGIDFGEWDKNFKLLE--------WIKRYAPLI 73

Query: 97  KPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWAS 156
            PNG + +  SY  I  I   L+   F + + I W K+NPMP    RR+    E  +WA 
Sbjct: 74  NPNGCIIIFCSYRFISYIADFLEENGFVVKDFIQWVKTNPMPRNLNRRYVQDTEFALWAV 133

Query: 157 PSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRI 216
              KAK + FN    K  NE          P+  G ER++       HPTQK  AL+ +I
Sbjct: 134 KK-KAK-WVFN----KPENEKYLRPLILKSPVVGGLERVK-------HPTQKSLALMEKI 180

Query: 217 LVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRI 265
           +   T P DI+LDPF GSGT+G   K L R+FIGIE++++Y   A KR+
Sbjct: 181 ISIHTNPNDIVLDPFMGSGTTGLACKNLERNFIGIELEKEYFQTAKKRL 229


>gi|208434020|ref|YP_002265686.1| adenine specific DNA methyltransferase (putative type II)
           [Helicobacter pylori G27]
 gi|208431949|gb|ACI26820.1| adenine specific DNA methyltransferase (putative type II)
           [Helicobacter pylori G27]
          Length = 232

 Score =  118 bits (296), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 81/228 (35%), Positives = 111/228 (48%), Gaps = 23/228 (10%)

Query: 40  VDLIFADPPYNLQLNGQLYRPDHSLVDAVT-DSWDK-FSSFEAYDAFTRAWLLACRRVLK 97
           VD I  DPPYN+ +         +    +    WDK F   E        W+     ++ 
Sbjct: 23  VDAIITDPPYNISVKNNFSTLKSAKRQGIDFGEWDKNFRLLE--------WIKRYAPLIN 74

Query: 98  PNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASP 157
           PNG + +  SY  I  I   L+   F + + I W K+NPMP    RR+    E  +WA  
Sbjct: 75  PNGCMVIFCSYRFISYIADFLEENGFVVKDFIQWVKTNPMPRNIHRRYVQDTEFALWAVK 134

Query: 158 SPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRIL 217
             KAK + FN    K  NE          P+ SG ER++       HPTQK  AL+ +I+
Sbjct: 135 K-KAK-WVFN----KPKNEKYLRPLILKSPVVSGLERVK-------HPTQKSLALMEKII 181

Query: 218 VSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRI 265
              T P DI+LDPF GSGT+G   K L+R+FIGIE +++Y   A KR+
Sbjct: 182 SIHTNPNDIVLDPFMGSGTTGLACKNLKRNFIGIESEKEYFQTAKKRL 229


>gi|317010332|gb|ADU84079.1| adenine specific DNA methyltransferase (putative type II)
           [Helicobacter pylori SouthAfrica7]
          Length = 232

 Score =  118 bits (296), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 78/231 (33%), Positives = 116/231 (50%), Gaps = 23/231 (9%)

Query: 40  VDLIFADPPYNLQLNGQLYRPDHSLVDAVT-DSWDK-FSSFEAYDAFTRAWLLACRRVLK 97
           VD I  DPPYN+ +         +    +    WDK F   E        W+     ++ 
Sbjct: 23  VDAIITDPPYNISVKNNFSTLKSAKRQGIDFGEWDKNFKLLE--------WIALYAPLVN 74

Query: 98  PNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASP 157
           PNG + +  SY  +  I   L+   F + + I W K+NPM     RR+    E  +WA  
Sbjct: 75  PNGCMIIFCSYRFMSYIADFLEENGFVVKDFIQWVKTNPMLRNLNRRYVQDTEFALWAVK 134

Query: 158 SPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRIL 217
             KAK + FN    +A    + ++S    P+ SG+ER++       HPTQK  AL+ +I+
Sbjct: 135 K-KAK-WVFNKPNNEAYLRPLILKS----PVVSGTERVK-------HPTQKSLALMEKII 181

Query: 218 VSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASV 268
              T P  ++LDPF GSGT+G   K L+R+FIGIE++++Y   A KR+ SV
Sbjct: 182 SIHTNPNHLVLDPFMGSGTTGLACKNLKRNFIGIELEKEYFQTAKKRLGSV 232


>gi|210134245|ref|YP_002300684.1| adenine specific DNA methyltransferase [Helicobacter pylori P12]
 gi|210132213|gb|ACJ07204.1| adenine specific DNA methyltransferase [Helicobacter pylori P12]
          Length = 230

 Score =  118 bits (295), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 81/229 (35%), Positives = 112/229 (48%), Gaps = 23/229 (10%)

Query: 40  VDLIFADPPYNLQLNGQLYRPDHSLVDAVT-DSWDK-FSSFEAYDAFTRAWLLACRRVLK 97
           VD I  DPPYN+ +         +    +    WDK F   E        W+     ++ 
Sbjct: 23  VDAIITDPPYNISVKNNFSTLKSAKRQGIDFGEWDKNFKLLE--------WIKRYAPLVN 74

Query: 98  PNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASP 157
           PNG + +  SY  I  I   L+   F + + I W K+NPMP    RR+    E  +WA  
Sbjct: 75  PNGCMVIFCSYRFISYIADFLEENGFVVKDFIQWVKNNPMPRNIHRRYVQDTEFALWAVK 134

Query: 158 SPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRIL 217
             KAK + FN    K  NE          P+ SG ER++       HPTQK  AL+ +I+
Sbjct: 135 K-KAK-WVFN----KPKNEKYLRPLILKSPVVSGLERVK-------HPTQKSLALMEKIV 181

Query: 218 VSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIA 266
              T P DI+LDPF GSGT+G   K L+R+FIGIE +++Y   A KR++
Sbjct: 182 SIHTNPNDIVLDPFMGSGTTGLACKNLQRNFIGIESEKEYFQTAQKRLS 230


>gi|261837514|gb|ACX97280.1| adenine-methyltransferase [Helicobacter pylori 51]
          Length = 232

 Score =  118 bits (295), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 81/228 (35%), Positives = 111/228 (48%), Gaps = 23/228 (10%)

Query: 40  VDLIFADPPYNLQLNGQLYRPDHSLVDAVT-DSWDK-FSSFEAYDAFTRAWLLACRRVLK 97
           VD I  DPPYN+ +         +    +    WDK F   E        W+     ++ 
Sbjct: 23  VDAIITDPPYNISVKNNFSTLKSAKRQGIDFGEWDKNFRLLE--------WIKRYAPLVN 74

Query: 98  PNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASP 157
           PNG + +  SY  I  I   L+   F I + I W K+NPMP    RR+    E  +WA  
Sbjct: 75  PNGCMVIFCSYRFISYIADFLEENGFVIKDFIQWVKTNPMPRNINRRYVQDTEFALWAVK 134

Query: 158 SPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRIL 217
             KAK + FN    K  NE          P+ SG E+++       HPTQK   L+ +I+
Sbjct: 135 K-KAK-WVFN----KPKNEKYLRPLILKSPVVSGLEKVK-------HPTQKSLDLMEKII 181

Query: 218 VSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRI 265
              T P DI+LDPF GSGT+G   K+L R+FIGIE +++Y  IA KR+
Sbjct: 182 SIHTNPNDIVLDPFMGSGTTGLACKRLERNFIGIESEKEYFQIAKKRL 229


>gi|169838492|ref|ZP_02871680.1| TYPE II DNA MODIFICATION ENZYME (METHYLTRANSFERASE) [candidate
           division TM7 single-cell isolate TM7a]
          Length = 100

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 49/95 (51%), Positives = 67/95 (70%)

Query: 51  LQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHN 110
           +Q  G+L R D +  + V D WDKF SF  YD F   WL  C+R+LK +G++ +IGS+ N
Sbjct: 1   MQTEGELLRTDGTKFNGVEDEWDKFDSFYEYDNFCNNWLKECKRILKKDGSICIIGSFQN 60

Query: 111 IFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRF 145
           IFRIG ++QNL FWI+NDI+W KSNP+PNF  + +
Sbjct: 61  IFRIGYLMQNLEFWIINDIIWNKSNPVPNFLAQDY 95


>gi|209524406|ref|ZP_03272955.1| DNA methylase N-4/N-6 domain protein [Arthrospira maxima CS-328]
 gi|79835531|gb|ABB52099.1| Mod [Arthrospira platensis]
 gi|209495197|gb|EDZ95503.1| DNA methylase N-4/N-6 domain protein [Arthrospira maxima CS-328]
          Length = 295

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 87/262 (33%), Positives = 140/262 (53%), Gaps = 33/262 (12%)

Query: 20  KDKIIKGNSISVLE-KLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSF 78
           ++ I  G++I +L  ++ A SV+LIFADPPYN+   G+ +   H          D+++S 
Sbjct: 9   RNTIFHGDAIQILSSQIAANSVNLIFADPPYNI---GKKFSKFH----------DQWNSE 55

Query: 79  EAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
           E Y  ++  WL  C RVLKPNGTL+V+ S  ++      L+     IL+ IVW   +   
Sbjct: 56  EDYINWSYQWLDECVRVLKPNGTLYVMTSTQSMPYFDIYLRQ-KMSILSRIVWHYDSSGV 114

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRS--DWLIPICS--GSE- 193
             + + F + +E ++        K Y FN   +K   +    R   D+  P+ +   SE 
Sbjct: 115 QAK-KYFGSMYEPILHCVKD--QKNYIFNSADIKVEAKTGAQRKLIDYRKPVPTQYNSEK 171

Query: 194 ---------RLRNKDGE-KLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKK 243
                    R+R +  E + HP QKPE+LL RI+++ST   D++LDPF G+ T+ AVAK+
Sbjct: 172 VPGNVWYFPRVRYRMAEYENHPAQKPESLLERIILASTNTHDLVLDPFAGTFTTAAVAKR 231

Query: 244 LRRSFIGIEMKQDYIDIATKRI 265
           L R  + IE +++Y+ I  +R+
Sbjct: 232 LGRISMSIESQEEYLKIGLRRV 253


>gi|315586054|gb|ADU40435.1| site-specific DNA-methyltransferase (adenine-specific)
           [Helicobacter pylori 35A]
          Length = 232

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 83/248 (33%), Positives = 119/248 (47%), Gaps = 25/248 (10%)

Query: 22  KIIKGNSISVLEKLPAKS--VDLIFADPPYNLQLNGQLYRPDHSLVDAVT-DSWDK-FSS 77
           +I   NS  +++    +   VD I  DPPYN+ +         +    +    WDK F  
Sbjct: 3   QIHHANSFEIIKDFYQQDLKVDAIITDPPYNISVKNNFSTLKSAKRQGIDFGEWDKNFRL 62

Query: 78  FEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPM 137
            E        W+     ++ PNG + +  SY  I  I   L+   F + + I W K+NPM
Sbjct: 63  LE--------WIKRYAPLVNPNGCMVIFCSYRFISYIADFLEENGFVVKDFIQWVKNNPM 114

Query: 138 PNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRN 197
           P    R +    E  +WA    KAK + FN    K  NE          P+ SG E+++ 
Sbjct: 115 PRNINRHYVQDTEFALWAVKK-KAK-WVFN----KPENEKYLRPLILKSPVVSGLEKVK- 167

Query: 198 KDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDY 257
                 HPTQK  AL+ +I+   T P DI+LDPF GSGT+G   K+L R+FIGIE +++Y
Sbjct: 168 ------HPTQKSLALMEKIISIHTNPNDIVLDPFMGSGTTGLACKRLERNFIGIESEKEY 221

Query: 258 IDIATKRI 265
             IA KR+
Sbjct: 222 FQIAKKRL 229


>gi|319410295|emb|CBY90637.1| putative type II restriction methyltransferase [Neisseria
           meningitidis WUE 2594]
          Length = 285

 Score =  117 bits (293), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 83/257 (32%), Positives = 132/257 (51%), Gaps = 31/257 (12%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           +I G+ + VL+ LP+ SVDLIFADPPY +  +               ++ D F+    Y 
Sbjct: 14  VILGDCLEVLKTLPSSSVDLIFADPPYGIGKD-------------FGNNKDFFADAYQYL 60

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            +  +W+  C RVLK NGT++++ S   +  +   +    ++I+N IVW   +     + 
Sbjct: 61  DWCASWIDECMRVLKDNGTMYLMSSVQYMPILDRYVDE-KYFIINRIVWSYDSSGVQAKN 119

Query: 143 RRFQNAHETLIWASPSPKAKGYTFNYDAL------KAANEDVQMRSDWLIPICSGS---- 192
           + F + +E ++  +    +K YTFN + +       A  + +  R     P  +      
Sbjct: 120 K-FGSTYEPILMFTHHKNSK-YTFNSEDILIEAKTGAERKLIDYRKTPPQPYNAKKIPSN 177

Query: 193 ----ERLRNK-DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRS 247
                R+R K D  + HPTQKPE LL RI+++S+  GD ILDPF GS T+ +VA +L+R 
Sbjct: 178 VWEFNRVRYKMDEYENHPTQKPEKLLERIILASSNKGDTILDPFSGSFTTSSVAVRLKRK 237

Query: 248 FIGIEMKQDYIDIATKR 264
            IGIE+  DY  I  +R
Sbjct: 238 AIGIEINPDYFKIGIRR 254


>gi|307636736|gb|ADN79186.1| Adenine-specific methyltransferase [Helicobacter pylori 908]
 gi|325995322|gb|ADZ50727.1| Adenine-specific methyltransferase [Helicobacter pylori 2018]
 gi|325996920|gb|ADZ49128.1| Adenine-specific methyltransferase [Helicobacter pylori 2017]
          Length = 232

 Score =  117 bits (293), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 81/248 (32%), Positives = 119/248 (47%), Gaps = 25/248 (10%)

Query: 22  KIIKGNSISVLEKLPAKS--VDLIFADPPYNLQLNGQLYRPDHSLVDAVT-DSWDK-FSS 77
           +I   N+  +++    ++  VD I  DPPYN+ +         +    +    WDK F  
Sbjct: 3   QIYHANAFEIIKDFHQQNLKVDAIITDPPYNISVQNNFSTLKSAKRQGIDFGEWDKNFKL 62

Query: 78  FEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPM 137
            E        W+     ++ PNG + +  SY  I  I   L+   F + + I W K+NPM
Sbjct: 63  LE--------WIARYAPLINPNGCMVIFCSYRFISYIADFLEENGFVVKDFIQWVKNNPM 114

Query: 138 PNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRN 197
           P    RR+    E  +WA    KAK + FN    K  NE          P+ SG ER++ 
Sbjct: 115 PRNIHRRYVQDTEFALWAVKK-KAK-WVFN----KPENEKYLRPLILKSPVVSGIERVK- 167

Query: 198 KDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDY 257
                 HPTQK  AL+ +I+   T P +++LDPF GSGT+G   K L+R FIGIE +++Y
Sbjct: 168 ------HPTQKSLALMEKIVSIHTNPNNVVLDPFMGSGTTGLACKNLKRKFIGIESEKEY 221

Query: 258 IDIATKRI 265
              A KR+
Sbjct: 222 FQTAQKRL 229


>gi|220906264|ref|YP_002481575.1| DNA methylase N-4/N-6 domain-containing protein [Cyanothece sp. PCC
           7425]
 gi|219862875|gb|ACL43214.1| DNA methylase N-4/N-6 domain protein [Cyanothece sp. PCC 7425]
          Length = 323

 Score =  117 bits (293), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 88/281 (31%), Positives = 134/281 (47%), Gaps = 62/281 (22%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           + I  +  + L+ LP +SVDL+F DPPYNL      +R     ++  TD           
Sbjct: 48  RTIHQDLFTTLDFLPHRSVDLLFIDPPYNLDKTFNTHRFKKKDLETYTD----------- 96

Query: 82  DAFTRAWLLAC----RRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPM 137
                 WL +C     R+LKP  ++++   + +   +  ++++  F I N I W +    
Sbjct: 97  ------WLASCLNGLERMLKPTASIYICSDWQSSPAVFEVIKH-RFQIRNRITWEREKG- 148

Query: 138 PNFRG--RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQ------MRSDWLIPIC 189
              RG  R ++NA E + + + S +   YTFN +A+K   + +       M  DW I   
Sbjct: 149 ---RGASRNWKNASEDIWFCTVSDR---YTFNVEAVKLKRKVMAPYTVNGMPKDWEI-TD 201

Query: 190 SGSERL------------------RNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPF 231
            G+ RL                   N D    HPTQKPE LL++I+++S+ PGD+I DPF
Sbjct: 202 QGNYRLTYPSNLWTDLTVPFWSMPENTD----HPTQKPEKLLAKIILASSNPGDVIFDPF 257

Query: 232 FGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKR--IASVQP 270
            GSGT+   AKKL R + G+EM + Y  +  KR  IA   P
Sbjct: 258 LGSGTTSVAAKKLGRQYFGVEMDELYCCLTEKRLKIAEADP 298


>gi|108562471|ref|YP_626787.1| adenine specific DNA methyltransferase [Helicobacter pylori HPAG1]
 gi|107836244|gb|ABF84113.1| adenine specific DNA methyltransferase [Helicobacter pylori HPAG1]
          Length = 230

 Score =  117 bits (292), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 80/229 (34%), Positives = 111/229 (48%), Gaps = 23/229 (10%)

Query: 40  VDLIFADPPYNLQLNGQLYRPDHSLVDAVT-DSWDK-FSSFEAYDAFTRAWLLACRRVLK 97
           VD I  DPPYN+ +         +    +    WDK F   E        W+     ++ 
Sbjct: 23  VDAIITDPPYNISVKNNFSTLKSAKRQGIDFGEWDKNFKLLE--------WIKRYAPLVN 74

Query: 98  PNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASP 157
           PNG + +  SY  I  I   L+   F + + I W K+NPMP    RR+    E  +WA  
Sbjct: 75  PNGCMVIFCSYRFISYIADFLEENGFVVKDFIQWVKTNPMPRNIHRRYVQDTEFALWAVK 134

Query: 158 SPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRIL 217
             KAK + FN    K  NE          P+ SG E+ +       HPTQK  AL+ +I+
Sbjct: 135 K-KAK-WVFN----KPKNEKYLRPLILKSPVVSGIEKTK-------HPTQKSLALMEKII 181

Query: 218 VSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIA 266
              T P DI+LDPF GSGT+G   K L+R+FIGIE +++Y   A KR++
Sbjct: 182 SIHTNPNDIVLDPFMGSGTTGLACKNLKRNFIGIESEKEYFQTAQKRLS 230


>gi|207092046|ref|ZP_03239833.1| adenine specific DNA methyltransferase (dpnA) [Helicobacter pylori
           HPKX_438_AG0C1]
          Length = 232

 Score =  117 bits (292), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 80/228 (35%), Positives = 110/228 (48%), Gaps = 23/228 (10%)

Query: 40  VDLIFADPPYNLQLNGQLYRPDHSLVDAVT-DSWDK-FSSFEAYDAFTRAWLLACRRVLK 97
           VD I  DPPYN+ +         +    +    WDK F   E        W+     ++ 
Sbjct: 23  VDAIITDPPYNISVKNNFSTLKSAKRQGIDFGEWDKNFKLLE--------WIKHYAPLVN 74

Query: 98  PNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASP 157
           PNG + +  SY  I  I   L+   F + + I W K+NPMP    RR+    E  +WA  
Sbjct: 75  PNGCMIIFCSYRFISYIADFLEENGFVVKDFIQWVKTNPMPRNIHRRYVQDTEFALWAVK 134

Query: 158 SPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRIL 217
             KAK + FN    K  NE          P+ SG E+++       HPTQK  AL+ +I+
Sbjct: 135 K-KAK-WVFN----KPKNEKYLRPLILKSPVVSGLEKVK-------HPTQKSLALMEKII 181

Query: 218 VSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRI 265
              T P DI+LDPF GSGT+G   K L R+FIGIE +++Y   A KR+
Sbjct: 182 SIHTNPNDIVLDPFMGSGTTGLACKNLERNFIGIESEKEYFQTAKKRL 229


>gi|257125924|ref|YP_003164038.1| methyltransferase [Leptotrichia buccalis C-1013-b]
 gi|257049863|gb|ACV39047.1| DNA methylase N-4/N-6 domain protein [Leptotrichia buccalis
           C-1013-b]
          Length = 297

 Score =  116 bits (291), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 83/266 (31%), Positives = 131/266 (49%), Gaps = 31/266 (11%)

Query: 26  GNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFT 85
           G+ + +L  +   SV+LIFADPPY +  N               +  D F + E Y  + 
Sbjct: 25  GDCLDILRSIEDNSVNLIFADPPYGIGKN-------------FGNDSDFFKNKEEYFDWA 71

Query: 86  RAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRF 145
           + W+  C R+LK +GT++ + S         M  + N++++N I+W   +     + + F
Sbjct: 72  KKWIDECMRILKEDGTMYFMTSTQ-FMPFLDMYVDDNYYVINRIIWTYDSSGVQAKTK-F 129

Query: 146 QNAHETLIWASPSPKAKGYTFNY-DALKAANED-----VQMRSDWLIPICSGS------- 192
            + +E ++  + S K+K YTFNY D L   N       +  R     P  +         
Sbjct: 130 GSLYEPILMVTHSKKSK-YTFNYQDILIETNTGAKRKLIDYRKTPPQPYNTKKVPGNVWD 188

Query: 193 -ERLRNKDGE-KLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIG 250
             R+R +  E + HPTQKPE LL RI+++S+   DI+LDPF GS T+ AVA+KL R  IG
Sbjct: 189 FSRVRYRMEEYENHPTQKPEELLKRIILASSNENDIVLDPFSGSFTTSAVAQKLNRKTIG 248

Query: 251 IEMKQDYIDIATKRIASVQPLGNIEL 276
           IE   +Y  I  +R+        ++L
Sbjct: 249 IETNLEYFKIGLRRLNITDEYNGVKL 274


>gi|254778782|ref|YP_003056887.1| Type II adenine methyltransferase [Helicobacter pylori B38]
 gi|254000693|emb|CAX28602.1| Type II adenine methyltransferase [Helicobacter pylori B38]
          Length = 232

 Score =  116 bits (291), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 80/228 (35%), Positives = 110/228 (48%), Gaps = 23/228 (10%)

Query: 40  VDLIFADPPYNLQLNGQLYRPDHSLVDAVT-DSWDK-FSSFEAYDAFTRAWLLACRRVLK 97
           VD I  DPPYN+ +         +    +    WDK F   E        W+     ++ 
Sbjct: 23  VDAIITDPPYNISVKNNFSTLKSAKRQGIDFGEWDKNFRLLE--------WIKRYAPLIN 74

Query: 98  PNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASP 157
           PNG + +  SY  I  I   L+   F + + I W K+NPMP    RR+    E  +WA  
Sbjct: 75  PNGCMVIFCSYRFISYIADFLEENGFVVKDFIQWVKTNPMPRNIHRRYVQDTEFALWAVK 134

Query: 158 SPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRIL 217
             KAK + FN    K  NE          P+ SG E+ +       HPTQK  AL+ +I+
Sbjct: 135 K-KAK-WVFN----KPKNEKYLRPLILKSPVVSGLEKTK-------HPTQKSLALMEKII 181

Query: 218 VSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRI 265
              T P DI+LDPF GSGT+G   K L+R+FIGIE +++Y   A KR+
Sbjct: 182 SIHTNPNDIVLDPFMGSGTTGLACKNLKRNFIGIESEKEYFQTAKKRL 229


>gi|168703324|ref|ZP_02735601.1| adenine-specific methyltransferase [Gemmata obscuriglobus UQM 2246]
          Length = 290

 Score =  116 bits (290), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 79/276 (28%), Positives = 126/276 (45%), Gaps = 48/276 (17%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           + +G+ + VL  LPA   DL+FADPP+N+     +Y    +  D +T             
Sbjct: 9   VAEGDCVQVLNTLPAGCADLVFADPPFNIGYQYDVYDDKRAKADYLT------------- 55

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            +T  WL A  RVL P+G+L++      +      L  L   + N +VW  +  +     
Sbjct: 56  -WTEKWLAAAVRVLAPHGSLFLAIGDEFVAEHKVRLDALGLTMRNWVVWHYTFGVNC--S 112

Query: 143 RRFQNAHETLIWASPSPK-------------AKGYTFNYD-------------ALKAANE 176
           ++F  +H  +++    PK             A+  T+                 L+    
Sbjct: 113 KKFNRSHAHILYYVRDPKNHQFFPDEVRVPSARMTTYADKRANPVGKLPDDTWVLRPQES 172

Query: 177 DVQMRSD---WLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFG 233
           D     D   W +P   G+   RN+ G   H  Q PEA+L R++  ++KPGD++LDPF G
Sbjct: 173 DAHFAPDSDTWHVPRICGTFHERNEAG---HKCQMPEAVLDRVIRVASKPGDLVLDPFAG 229

Query: 234 SGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQ 269
           SGT+ AVAKKL R + G+E+ + Y D   KR+  ++
Sbjct: 230 SGTTLAVAKKLGRRYFGVELSEQYADGVRKRLQMIE 265


>gi|187929215|ref|YP_001899702.1| DNA methylase N-4/N-6 domain-containing protein [Ralstonia
           pickettii 12J]
 gi|187726105|gb|ACD27270.1| DNA methylase N-4/N-6 domain protein [Ralstonia pickettii 12J]
          Length = 273

 Score =  116 bits (290), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 82/260 (31%), Positives = 132/260 (50%), Gaps = 33/260 (12%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           D I   + I+ +E L   SVDL+ ADPPY L   G+ Y  D           DK S  +A
Sbjct: 7   DGIFNEDCITGVEHLADGSVDLVIADPPYGL---GKDYGNDS----------DKLSG-DA 52

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           Y A++  W+ A R  L  NG+L++  ++     +  ML+     ++N+I+W +  P    
Sbjct: 53  YLAWSERWIDAVRPKLARNGSLYLFCTWQYAPELFVMLKR-RLTMVNEIIWDRRVPSMGG 111

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALK----AANEDVQMRS-----DWLIPICSG 191
             R+F + H+ + + + S   + Y F+ DA++    A  +  + R       WL    + 
Sbjct: 112 STRKFSSVHDNIGFFAAS---RDYYFDVDAVRIPYDAETKKARSRKRFEGKKWLEVGYNP 168

Query: 192 SE-----RLRNKDGEKL-HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLR 245
            +     RL  +D E+  HPTQKP  L+ R++++S  PG ++LDPF GSGT+ A   +L 
Sbjct: 169 KDVWSVSRLHRQDPERAEHPTQKPLELVERMILASCPPGGLVLDPFLGSGTTAAACARLG 228

Query: 246 RSFIGIEMKQDYIDIATKRI 265
           R F G E+  DY  +A +R+
Sbjct: 229 RRFAGFEINADYCRVARERV 248


>gi|308183850|ref|YP_003927983.1| adenine specific DNA methyltransferase (dpnA) [Helicobacter pylori
           SJM180]
 gi|308059770|gb|ADO01666.1| adenine specific DNA methyltransferase (dpnA) [Helicobacter pylori
           SJM180]
          Length = 232

 Score =  116 bits (290), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 80/228 (35%), Positives = 109/228 (47%), Gaps = 23/228 (10%)

Query: 40  VDLIFADPPYNLQLNGQLYRPDHSLVDAVT-DSWDK-FSSFEAYDAFTRAWLLACRRVLK 97
           VD I  DPPYN+ +         +    +    WDK F   E        W+     ++ 
Sbjct: 23  VDAIITDPPYNISVKNNFSTLKSAKRQGIDFGEWDKNFKLLE--------WITRYAPLVN 74

Query: 98  PNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASP 157
           PNG + +  SY  I  I   L+   F + + I W K+NPMP    RR+    E  +WA  
Sbjct: 75  PNGCIIIFCSYRFISYIADFLEENGFVVKDFIQWVKTNPMPRNIHRRYVQDTEFALWAVK 134

Query: 158 SPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRIL 217
             KAK + FN    K  NE          P+ SG E+ +       HPTQK  AL+ +I+
Sbjct: 135 K-KAK-WVFN----KPKNEKYLRPLILKSPVVSGLEKTK-------HPTQKSLALMEKII 181

Query: 218 VSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRI 265
              T P DI+LDPF GSGT+G   K L R+FIGIE +++Y   A KR+
Sbjct: 182 SIHTNPNDIVLDPFMGSGTTGLACKNLERNFIGIESEKEYFQTAKKRL 229


>gi|300691105|ref|YP_003752100.1| site-specific DNA-methyltransferase (adenine-specific) [Ralstonia
           solanacearum PSI07]
 gi|299078165|emb|CBJ50808.1| Site-specific DNA-methyltransferase (adenine-specific) [Ralstonia
           solanacearum PSI07]
          Length = 270

 Score =  115 bits (289), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 84/267 (31%), Positives = 134/267 (50%), Gaps = 33/267 (12%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           D I   + I+ +  L   SVDL+ ADPPY L   G+ Y  D           DK S  EA
Sbjct: 7   DGIFNEDCIAGVGHLADGSVDLVIADPPYGL---GKDYGNDS----------DKLSG-EA 52

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           Y A++  W+ A    L  NG+L++  ++     +  ML+     ++N+I+W +  P    
Sbjct: 53  YMAWSERWIEAVLPKLARNGSLYLFCTWQYAPELFVMLKR-RLQMINEIIWDRRVPSMGG 111

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAA--NEDVQMRS-------DWLIPICSG 191
             R+F + H+ + + + S   + Y F+ DA++     E  + RS        WL    + 
Sbjct: 112 STRKFSSVHDNIGFFAAS---RDYYFDVDAVRIPYDAETKKARSRKRFEGKKWLEVGYNP 168

Query: 192 SE-----RLRNKDGEKL-HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLR 245
            +     RL  +D E+  HPTQKP  L+ R++++S  PG ++LDPF GSGT+     +L 
Sbjct: 169 KDVWSVSRLHRQDPERAEHPTQKPLELVERMVLASCPPGGLVLDPFLGSGTTAVACARLG 228

Query: 246 RSFIGIEMKQDYIDIATKRIASVQPLG 272
           R F G E+  +Y  +A +R+A+V  LG
Sbjct: 229 RRFAGFEINAEYCRVARERVAAVTSLG 255


>gi|297379272|gb|ADI34159.1| Modification methylase [Helicobacter pylori v225d]
          Length = 232

 Score =  115 bits (289), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 80/229 (34%), Positives = 110/229 (48%), Gaps = 23/229 (10%)

Query: 39  SVDLIFADPPYNLQLNGQLYRPDHSLVDAVT-DSWDK-FSSFEAYDAFTRAWLLACRRVL 96
            VD I  DPPYN+ +         +    +    WDK F   E        W+     ++
Sbjct: 22  KVDAIITDPPYNISVKNNFSTLKSAKRQGIDFGEWDKNFRLLE--------WIKRYAPLV 73

Query: 97  KPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWAS 156
            PNG + +  SY  I  I   L+   F + + I W K+NPM     RR+    E  +WA 
Sbjct: 74  NPNGCMVIFCSYRFISYIADFLEENGFVVKDFIQWVKNNPMQRNINRRYVQDTEFALWAV 133

Query: 157 PSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRI 216
              KAK + FN    K  NE          P+  G ER++       HPTQK  AL+ +I
Sbjct: 134 KK-KAK-WVFN----KPENEKYLRPLILKSPVVGGLERVK-------HPTQKSLALMEKI 180

Query: 217 LVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRI 265
           +   T P DI+LDPF GSGT+G   K+L R+FIGIE +++Y  IA KR+
Sbjct: 181 ISIHTNPNDIVLDPFMGSGTTGLACKRLERNFIGIESEKEYFQIAKKRL 229


>gi|206975209|ref|ZP_03236123.1| DNA methylase [Bacillus cereus H3081.97]
 gi|206746630|gb|EDZ58023.1| DNA methylase [Bacillus cereus H3081.97]
          Length = 240

 Score =  115 bits (287), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 74/249 (29%), Positives = 118/249 (47%), Gaps = 24/249 (9%)

Query: 27  NSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAV------TDSWDKFSSFEA 80
           + I  ++K+    +DLI  DPPYNL   G   R   + +  +      T  WD    F+ 
Sbjct: 10  DCIKSMKKIETNKIDLIVTDPPYNL---GNFMRNRDTNLKKMRENFFATAGWDDME-FDE 65

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           +     ++     RV+K  G++ V  +   +  + ++ +   F+     +W K+NPMP  
Sbjct: 66  WKDSMDSFFEESARVMKKGGSMIVFMAIIKVETLISLAEKHGFYYKTTGIWHKTNPMPRN 125

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
               F N+ E   W   + K +  TFN       NE           + S +E+   K  
Sbjct: 126 MNLHFVNSTEA--WVYFTYKTRTGTFN-------NEGALFHDFIETSLTSSTEKKYGK-- 174

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
              HPTQKPE+L+   +   +   D +LDPF GSGT+G V K+L R+FIG+E+ Q+Y +I
Sbjct: 175 ---HPTQKPESLIKHFVELLSNANDWVLDPFMGSGTTGVVTKRLSRNFIGVELDQEYFNI 231

Query: 261 ATKRIASVQ 269
           A  RI  ++
Sbjct: 232 AQSRIEEIE 240


>gi|15644681|ref|NP_206851.1| adenine specific DNA methyltransferase (dpnA) [Helicobacter pylori
           26695]
 gi|2313123|gb|AAD07116.1| adenine specific DNA methyltransferase (dpnA) [Helicobacter pylori
           26695]
          Length = 232

 Score =  115 bits (287), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 80/228 (35%), Positives = 109/228 (47%), Gaps = 23/228 (10%)

Query: 40  VDLIFADPPYNLQLNGQLYRPDHSLVDAVT-DSWDK-FSSFEAYDAFTRAWLLACRRVLK 97
           VD I  DPPYN+ +         +    +    WDK F   E        W+     ++ 
Sbjct: 23  VDAIITDPPYNISVKNNFPTLKSAKRQGIDFGEWDKNFKLLE--------WIARYAPLVN 74

Query: 98  PNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASP 157
           PNG + +  SY  I  I   L+   F + + I W K+NPMP    RR+    E  +WA  
Sbjct: 75  PNGCMVIFCSYRFISYIADFLEENGFVVKDFIQWVKNNPMPRNIHRRYVQDTEFALWAVK 134

Query: 158 SPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRIL 217
             KAK + FN    K  NE          P+ SG E+ +       HPTQK  AL+ +I+
Sbjct: 135 K-KAK-WVFN----KPKNEKYLRPLILKSPVVSGLEKTK-------HPTQKSLALMEKII 181

Query: 218 VSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRI 265
              T P DI+LDPF GSGT+G   K L R+FIGIE +++Y   A KR+
Sbjct: 182 SIHTNPNDIVLDPFMGSGTTGLACKNLERNFIGIESEKEYFQTAKKRL 229


>gi|298737012|ref|YP_003729542.1| adenine-specific DNA-methyltransferase [Helicobacter pylori B8]
 gi|298356206|emb|CBI67078.1| adenine-specific DNA-methyltransferase [Helicobacter pylori B8]
          Length = 232

 Score =  115 bits (287), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 80/228 (35%), Positives = 108/228 (47%), Gaps = 23/228 (10%)

Query: 40  VDLIFADPPYNLQLNGQLYRPDHSLVDAVT-DSWDK-FSSFEAYDAFTRAWLLACRRVLK 97
           VD I  DPPYN+ +         +    +    WDK F   E        W+     ++ 
Sbjct: 23  VDAIITDPPYNISVKNNFSTLKSAKRQGIDFGEWDKNFKLLE--------WIKHYAPLVN 74

Query: 98  PNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASP 157
           PNG + +  SY  I  I   L+   F + + I W K+NPMP    RR+    E  +WA  
Sbjct: 75  PNGCMVIFCSYRFISYIADFLEENGFVVKDFIQWVKNNPMPRNIHRRYVQDTEFALWAVK 134

Query: 158 SPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRIL 217
             KAK + FN    K  NE          P+ SG E+ +       HPTQK  AL+ +I+
Sbjct: 135 K-KAK-WVFN----KPKNEKYLRPLILKSPVVSGLEKTK-------HPTQKSLALMEKII 181

Query: 218 VSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRI 265
              T P DI+LDPF GSGT+G   K L R FIGIE +++Y   A KR+
Sbjct: 182 SIHTNPNDIVLDPFMGSGTTGLACKNLERKFIGIESEKEYFQTAQKRL 229


>gi|330820900|ref|YP_004349762.1| DNA modification methylase [Burkholderia gladioli BSR3]
 gi|327372895|gb|AEA64250.1| DNA modification methylase [Burkholderia gladioli BSR3]
          Length = 286

 Score =  115 bits (287), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 82/249 (32%), Positives = 128/249 (51%), Gaps = 33/249 (13%)

Query: 35  LPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRR 94
           LP  S+DLI ADPPY L   G+ Y  D           DK    +A+ A+TR WL     
Sbjct: 50  LPDASIDLIVADPPYGL---GKDYGNDS----------DKLQG-DAHLAWTRQWLELAIP 95

Query: 95  VLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIW 154
            LKP+G+L+V  ++     I + L+     ++N+I+W +  P      RRF + H+ + +
Sbjct: 96  KLKPSGSLYVFCTWQYAPEIFSFLKT-RLTMINEIIWDRRVPSMGGTTRRFTSVHDNIGF 154

Query: 155 ASPSPKAKGYTFNYDAL---------KAANEDVQMRSDWLIPICSGSE-----RLRNKDG 200
            + S   KGY F+ D +         KA +  +   S WL    +  +     RL  +  
Sbjct: 155 FAVS---KGYYFDLDPVRIPYDAETKKARSRKLFEGSKWLEMGYNPKDVWSVSRLHRQHA 211

Query: 201 EKL-HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYID 259
           E++ HPTQKP  L+ R+++SS  PG ++LDPF GSGT+   + +  R FIG E+ + Y  
Sbjct: 212 ERVDHPTQKPLELVERMVLSSCPPGGVVLDPFMGSGTTAVASARHGRRFIGYEINESYCA 271

Query: 260 IATKRIASV 268
           IA +R+ ++
Sbjct: 272 IARERVTAL 280


>gi|167840376|ref|ZP_02467060.1| DNA modification methylase RsrI [Burkholderia thailandensis MSMB43]
          Length = 286

 Score =  114 bits (286), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 82/249 (32%), Positives = 127/249 (51%), Gaps = 33/249 (13%)

Query: 35  LPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRR 94
           LP  S+DLI ADPPY L   G+ Y  D           DK S  E + A+TR WL     
Sbjct: 47  LPDASIDLIVADPPYGL---GKDYGNDS----------DKRSGDE-HLAWTREWLELAIP 92

Query: 95  VLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIW 154
            LKP G+++V  ++     I + L+     ++N+I+W +  P      RRF + H+ + +
Sbjct: 93  KLKPTGSMYVFCTWQYAPEIFSFLKT-KLTMVNEIIWDRRVPSMGGTTRRFTSVHDNIGF 151

Query: 155 ASPSPKAKGYTFNYDAL---------KAANEDVQMRSDWLIPICSGSE-----RLRNKDG 200
            + S   KGY F+ D +         KA +  +   S WL    +  +     RL  +  
Sbjct: 152 FAVS---KGYYFDLDPVRIPYDADTKKARSRKLFEGSKWLEMGYNPKDVWSVSRLHRQHA 208

Query: 201 EKL-HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYID 259
           E++ HPTQKP  ++ R++++S  PG  +LDPF GSGT+     + RR F+G E+ + Y  
Sbjct: 209 ERVDHPTQKPLEIIERMVLASCPPGGRVLDPFMGSGTTAVACARQRRDFVGYEINESYCA 268

Query: 260 IATKRIASV 268
           IA +R+AS+
Sbjct: 269 IARERVASL 277


>gi|291571854|dbj|BAI94126.1| type II DNA modification methyltransferase [Arthrospira platensis
           NIES-39]
          Length = 295

 Score =  114 bits (286), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 85/262 (32%), Positives = 138/262 (52%), Gaps = 33/262 (12%)

Query: 20  KDKIIKGNSISVLE-KLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSF 78
           +  +  G++I +L  ++ A SV+LIF DPPYN+   G+ +   H          D+++S 
Sbjct: 9   RHTLFHGDAIQILSSQIAANSVNLIFVDPPYNI---GKKFSNFH----------DQWNSE 55

Query: 79  EAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
           E Y  ++  WL  C RVLKPNGTL+V+ S  ++      L+     IL+ IVW   +   
Sbjct: 56  EDYINWSYQWLDECVRVLKPNGTLYVMTSTQSMPYFDIYLRQ-KMSILSRIVWHYDSSGV 114

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRS--DWLIPICS--GSE- 193
             + + F + +E ++        K Y FN   +K   +    R   D+  P+ +   SE 
Sbjct: 115 QAK-KYFGSMYEPILHCVKD--QKNYIFNSADIKVEAQTGAQRKLIDYRKPVPTQYNSEK 171

Query: 194 ---------RLRNKDGE-KLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKK 243
                    R+R +  E + HP QKPE+LL RI+++ST   D++LDPF G+ T+ AVAK+
Sbjct: 172 VPGNVWYFPRVRYRMAEYENHPAQKPESLLERIILASTNKHDLVLDPFAGTFTTAAVAKR 231

Query: 244 LRRSFIGIEMKQDYIDIATKRI 265
           L R  + IE +++Y+ I  +R+
Sbjct: 232 LGRFSLSIESQEEYLKIGLRRV 253


>gi|300871833|ref|YP_003786706.1| DNA methylase N-4/N-6 domain-containing protein [Brachyspira
           pilosicoli 95/1000]
 gi|300689534|gb|ADK32205.1| DNA methylase N-4/N-6 domain protein [Brachyspira pilosicoli
           95/1000]
          Length = 321

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 94/312 (30%), Positives = 139/312 (44%), Gaps = 75/312 (24%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFE- 79
           +K I GN+  VL+K+     DL+  DPPYN+  N   Y               KF   + 
Sbjct: 46  NKTINGNTFDVLKKIEKNITDLMIVDPPYNISKNYHGY---------------KFKDRDN 90

Query: 80  -AYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            +YD +T  W+ +   +LK N T++V   + +   IG +L+   F I N I W++     
Sbjct: 91  LSYDKYTHLWVESIIPILKENATIYVCCDWKSSLVIGNVLEKY-FKIQNRITWQRE---- 145

Query: 139 NFRGR----RFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQ------MRSDWL--- 185
             +GR     ++N  E + +A+ S K   YTFN D +K   + +          DW+   
Sbjct: 146 --KGRGAKNNWKNGMEDIWFATLSNK---YTFNIDKVKIRRKVIAPYKIEGKPKDWIETE 200

Query: 186 -----------------IPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIIL 228
                            IP  S  E          HPTQKPE L+++++++S+   D + 
Sbjct: 201 NGNFRDTCPSNFWDDISIPYWSMPENT-------AHPTQKPEKLIAKLILASSNENDFVF 253

Query: 229 DPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRTEPRV 288
           DPF GSGT+  VAKKL R++ GIE    Y   A KRI S   L N E+   T        
Sbjct: 254 DPFLGSGTTSVVAKKLGRNYSGIEQNPAYCAWAEKRIESA--LQNKEIQGYTD------- 304

Query: 289 AFNLLVERGLIQ 300
             N+  ER  +Q
Sbjct: 305 --NIFWERNTMQ 314


>gi|317181350|dbj|BAJ59134.1| adenine specific DNA methyltransferase [Helicobacter pylori F57]
          Length = 232

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 79/228 (34%), Positives = 111/228 (48%), Gaps = 23/228 (10%)

Query: 40  VDLIFADPPYNLQLNGQLYRPDHSLVDAVT-DSWDK-FSSFEAYDAFTRAWLLACRRVLK 97
           VD I  DPPYN+ +         +    +    WDK F   E        W+     ++ 
Sbjct: 23  VDAIITDPPYNISVKNNFSTLKSAKRQGIDFGEWDKNFRLLE--------WIKRYAPLVN 74

Query: 98  PNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASP 157
           PNG + +  SY  I  I   L+   F + + I W K+NPMP    RR+    E  +WA  
Sbjct: 75  PNGCMVIFCSYRFISYIADFLEENGFIVKDFIQWVKNNPMPRNINRRYVQDTEFALWAVK 134

Query: 158 SPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRIL 217
             KAK + FN    K  NE          P+ SG E+++       HPTQK  AL+ +I+
Sbjct: 135 K-KAK-WVFN----KPKNEKYLRPLILKSPVVSGLEKVK-------HPTQKSLALMEKII 181

Query: 218 VSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRI 265
              T P DI+LDPF GSGT+G   K+L R+FIGIE +++   IA +R+
Sbjct: 182 SIHTNPNDIVLDPFMGSGTTGLACKRLERNFIGIESEKECFQIAKERL 229


>gi|296142046|gb|ADG95997.1| N6-adenine methyltransferase [Helicobacter pylori]
          Length = 230

 Score =  114 bits (284), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 81/248 (32%), Positives = 118/248 (47%), Gaps = 26/248 (10%)

Query: 22  KIIKGNSISVLEKLPAKS--VDLIFADPPYNLQLNGQLYRPDHSLVDAVT-DSWDK-FSS 77
           +I   N+  +++    ++  VD I  DPPYN+ +         +    +    WDK F  
Sbjct: 2   QIYHANAFEIIKDFYQQNLKVDAIITDPPYNISVKNHFSTLKSAKRQGIDFGEWDKNFKL 61

Query: 78  FEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPM 137
            E        W+     ++ PNG + +  SY  I      L+   F + + I W K+NPM
Sbjct: 62  LE--------WIKRYAPLVNPNGCMVIFCSYRFI-SYADFLEENGFMVKDLIQWVKTNPM 112

Query: 138 PNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRN 197
           P    RR+    E  +WA    KAK + FN    K  NE          P+  G ER++ 
Sbjct: 113 PRNIHRRYVQDTEFALWAVKK-KAK-WVFN----KPENEKYLRPLILKSPVVGGLERVK- 165

Query: 198 KDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDY 257
                 HPTQK  AL+ +I+   T P DI+LDPF GSGT+G   K L R+FIGIE++++Y
Sbjct: 166 ------HPTQKSLALMEKIISIHTNPNDIVLDPFMGSGTTGLACKNLERNFIGIELEKEY 219

Query: 258 IDIATKRI 265
              A KR+
Sbjct: 220 FQTAKKRL 227


>gi|332297012|ref|YP_004438934.1| DNA methylase N-4/N-6 domain protein [Treponema brennaborense DSM
           12168]
 gi|332180115|gb|AEE15803.1| DNA methylase N-4/N-6 domain protein [Treponema brennaborense DSM
           12168]
          Length = 337

 Score =  114 bits (284), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 85/268 (31%), Positives = 130/268 (48%), Gaps = 46/268 (17%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQ--LNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           +  G+   VL +LPA+  DL+  DPPYNL    +G  +        + TD          
Sbjct: 68  LFCGDLFDVLPRLPAEFADLLILDPPYNLDKTFDGMRF--------SATDH-------RQ 112

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           Y A+  +W       LKPNG+L++ G + +   +  +L+  +  ILN I+W++       
Sbjct: 113 YSAYLESWFTPLLETLKPNGSLYLCGDWKSTGSLFLLLEK-HAHILNRIIWQREKG---- 167

Query: 141 RG--RRFQNAHETLIWASPSPKAKGYTFNYDALK------AANEDVQMRSDWLIPICSGS 192
           RG  R ++N  E + +A  SP+A+ Y F+ +A+K      A   +     DW      G 
Sbjct: 168 RGALRNWKNNCEDIWFAVKSPQAE-YYFDAEAVKQKRRVIAPYRENGAPKDW-TESDGGK 225

Query: 193 ERLRNKDG--------------EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSG 238
            RL +                    HPTQKPE LL++++++S  PG ++ DPF GSGT+ 
Sbjct: 226 YRLTSAGNFWDDITVPYWSMKENTPHPTQKPEKLLAKLILASCPPGGMVFDPFAGSGTTL 285

Query: 239 AVAKKLRRSFIGIEMKQDYIDIATKRIA 266
             AKKL R F GIE  ++Y   A KR+A
Sbjct: 286 TAAKKLGRRFCGIERSEEYCLFARKRLA 313


>gi|241663406|ref|YP_002981766.1| DNA methylase N-4/N-6 domain-containing protein [Ralstonia
           pickettii 12D]
 gi|240865433|gb|ACS63094.1| DNA methylase N-4/N-6 domain protein [Ralstonia pickettii 12D]
          Length = 273

 Score =  114 bits (284), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 83/259 (32%), Positives = 131/259 (50%), Gaps = 33/259 (12%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           D I   + I+ +  L   SVDL+ ADPPY L   G+ Y  D           DK S  +A
Sbjct: 7   DGIFNEDCITGVGHLADGSVDLVIADPPYGL---GKDYGNDS----------DKLSG-DA 52

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           Y A++  W+ A R  L  NG+L++  ++     +  ML+     ++N+I+W +  P    
Sbjct: 53  YLAWSERWIDAVRPKLARNGSLYLFCTWQYAPELFVMLKQ-RLTMVNEIIWDRRVPSMGG 111

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAA--NEDVQMRS-------DWLIPICSG 191
             R+F + H+ + + + S   + Y F+ DA++     E  + RS        WL    + 
Sbjct: 112 STRKFSSVHDNIGFFAAS---RDYYFDVDAVRIPYDAETKKARSRKRFEGKKWLEVGYNP 168

Query: 192 SE-----RLRNKDGEKL-HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLR 245
            +     RL  +D E+  HPTQKP  L+ R++++S  PG ++LDPF GSGT+ AV  +L 
Sbjct: 169 KDVWSVSRLHRQDPERAEHPTQKPLELVERMILASCPPGGLVLDPFLGSGTTAAVCARLG 228

Query: 246 RSFIGIEMKQDYIDIATKR 264
           R F G E+  DY  +A +R
Sbjct: 229 RRFAGFEINADYCRVARER 247


>gi|311221492|gb|ADP76553.1| DNA methyltransferase [Helicobacter pylori]
          Length = 587

 Score =  113 bits (283), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 79/228 (34%), Positives = 108/228 (47%), Gaps = 23/228 (10%)

Query: 40  VDLIFADPPYNLQLNGQLYRPDHSLVDAVT-DSWDK-FSSFEAYDAFTRAWLLACRRVLK 97
           VD I  DPPYN+ +         +    +    WDK F   E        W+     ++ 
Sbjct: 378 VDAIITDPPYNISVKNNFPTLKSAKRQGIDFGEWDKNFKLLE--------WIARYAPLVN 429

Query: 98  PNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASP 157
           PNG + +  SY  I  I   L+   F + + I W K+NPMP    RR+    E  +WA  
Sbjct: 430 PNGCMVIFCSYRFISYIADFLEENGFVVKDFIQWVKNNPMPRNIHRRYVQDTEFALWAVK 489

Query: 158 SPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRIL 217
             KAK + FN    K  NE           + SG E+ +       HPTQK  AL+ +I+
Sbjct: 490 K-KAK-WVFN----KPKNEKYLRPLILKSTVVSGLEKTK-------HPTQKSLALMEKII 536

Query: 218 VSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRI 265
              T P DI+LDPF GSGT+G   K L R+FIGIE +++Y   A KR+
Sbjct: 537 SIHTNPNDIVLDPFMGSGTTGLACKNLERNFIGIESEKEYFQTAKKRL 584


>gi|309783469|ref|ZP_07678172.1| DNA (cytosine-5-)-methyltransferase [Ralstonia sp. 5_7_47FAA]
 gi|308917755|gb|EFP63449.1| DNA (cytosine-5-)-methyltransferase [Ralstonia sp. 5_7_47FAA]
          Length = 273

 Score =  113 bits (283), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 82/260 (31%), Positives = 131/260 (50%), Gaps = 33/260 (12%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           D I   + I+ +  L   SVDL+ ADPPY L   G+ Y  D           DK S  +A
Sbjct: 7   DGIFNEDCITGVGHLADGSVDLVIADPPYGL---GKDYGNDS----------DKLSG-DA 52

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           Y A++  W+ A R  L  NG+L++  ++     +  ML+     ++N+I+W +  P    
Sbjct: 53  YLAWSERWIDAVRPKLARNGSLYLFCTWQYAPELFVMLKQ-RLTMVNEIIWDRRVPSMGG 111

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAA--NEDVQMRS-------DWLIPICSG 191
             R+F + H+ + + + S   + Y F+ DA++     E  + RS        WL    + 
Sbjct: 112 STRKFSSVHDNIGFFAAS---RDYYFDVDAVRIPYDAETKKARSRKRFEGKKWLEVGYNP 168

Query: 192 SE-----RLRNKDGEKL-HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLR 245
            +     RL  +D E+  HPTQKP  L+ R++++S  PG ++LDPF GSGT+ A   +L 
Sbjct: 169 KDVWSVSRLHRQDPERAEHPTQKPLELVERMILASCPPGGLVLDPFLGSGTTAAACARLG 228

Query: 246 RSFIGIEMKQDYIDIATKRI 265
           R F G E+  DY  +A +R+
Sbjct: 229 RRFAGFEINADYCRVARERV 248


>gi|284052959|ref|ZP_06383169.1| putative methyltransferase [Arthrospira platensis str. Paraca]
          Length = 295

 Score =  113 bits (283), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 85/262 (32%), Positives = 138/262 (52%), Gaps = 33/262 (12%)

Query: 20  KDKIIKGNSISVLE-KLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSF 78
           +  +  G++I +L  ++ A SV+LIF DPPYN+   G+ +   H          D+++S 
Sbjct: 9   RHTLFHGDAIQILSSQIAANSVNLIFVDPPYNI---GKKFSNFH----------DQWNSE 55

Query: 79  EAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
           E Y  ++  WL  C RVLKPNGTL+V+ S  ++      L+     IL+ IVW   +   
Sbjct: 56  EDYINWSYQWLDECVRVLKPNGTLYVMTSTQSMPYFDIYLRQ-KMSILSRIVWHYDSSGV 114

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRS--DWLIPICS--GSE- 193
             + + F + +E ++        K Y FN   +K   +    R   D+  P+ +   SE 
Sbjct: 115 QAK-KYFGSMYEPILHCVKD--RKNYIFNSADIKVEAKTGAQRKLIDYRKPVPTQYNSEK 171

Query: 194 ---------RLRNKDGE-KLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKK 243
                    R+R +  E + HP QKPE+LL RI+++ST   D++LDPF G+ T+ AVAK+
Sbjct: 172 VPGNVWYFPRVRYRMAEYENHPAQKPESLLERIILASTNKHDLVLDPFAGTFTTAAVAKR 231

Query: 244 LRRSFIGIEMKQDYIDIATKRI 265
           L R  + IE +++Y+ I  +R+
Sbjct: 232 LGRFSLSIESQEEYLKIGLRRV 253


>gi|224418258|ref|ZP_03656264.1| cytosine specific DNA methyltransferase (DDEM) [Helicobacter
           canadensis MIT 98-5491]
 gi|253827583|ref|ZP_04870468.1| putative methylase [Helicobacter canadensis MIT 98-5491]
 gi|313141791|ref|ZP_07803984.1| cytosine-specific DNA methyltransferase [Helicobacter canadensis
           MIT 98-5491]
 gi|253510989|gb|EES89648.1| putative methylase [Helicobacter canadensis MIT 98-5491]
 gi|313130822|gb|EFR48439.1| cytosine-specific DNA methyltransferase [Helicobacter canadensis
           MIT 98-5491]
          Length = 589

 Score =  113 bits (283), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 74/248 (29%), Positives = 120/248 (48%), Gaps = 24/248 (9%)

Query: 23  IIKGNSISVLEKLPAK--SVDLIFADPPYNLQLNGQLYRPDHSLVDAVT-DSWDKFSSFE 79
           I   +S S++E    +   V+ I  DPPYN+  +      + +    +    WDK     
Sbjct: 361 IYNSDSYSMIETFIKQGLKVNHIITDPPYNISQDNNFSTMNSAKRQGIDFGEWDK----- 415

Query: 80  AYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPN 139
            +D F   W+ +  ++L  NG+  +  SY  +  I   L+N +  + + ++W+KSNPMP 
Sbjct: 416 KFDLFN--WIKSYSKILDINGSFIIFCSYRFVSHICDTLENSDCVVKDILIWQKSNPMPR 473

Query: 140 FRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKD 199
              RR+    E  +WA    K   + FN       N    +R+ +  P+  G ER     
Sbjct: 474 NISRRYVQDMEFAVWAVK--KGAKWVFN-----KPNNKKYLRAMYTAPVVRGFERTE--- 523

Query: 200 GEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYID 259
               HPTQK   ++  I+   T   D++LDPF GSG++G  A    R+F+GIE+ + Y +
Sbjct: 524 ----HPTQKSLKVMQEIIQIHTNKDDLVLDPFMGSGSTGVAAICNGRNFLGIELSKKYYN 579

Query: 260 IATKRIAS 267
           IA KR++S
Sbjct: 580 IALKRLSS 587


>gi|225621478|ref|YP_002722737.1| DNA methylase N-4/N-6 domain-containing protein [Brachyspira
           hyodysenteriae WA1]
 gi|225216299|gb|ACN85033.1| DNA methylase N-4/N-6 domain protein [Brachyspira hyodysenteriae
           WA1]
          Length = 324

 Score =  113 bits (283), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 85/281 (30%), Positives = 129/281 (45%), Gaps = 64/281 (22%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFE- 79
           +K I GN+  VL+K+     DL+  DPPYN+  N   Y               KF   + 
Sbjct: 46  NKTINGNTFDVLKKIEKNISDLMIVDPPYNISKNYHGY---------------KFKDIDN 90

Query: 80  -AYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            +Y+ +T  W+ +   +LK   +++V   + +   IG +L+   F I N I W++     
Sbjct: 91  LSYEKYTHLWVESIIPILKKEASIYVCCDWKSSLVIGNVLEKY-FNIQNRITWQRE---- 145

Query: 139 NFRGR----RFQNAHETLIWASPSPKAKGYTFNYDALK------------------AANE 176
             +GR     ++N  E + +A+ S K   YTFN D +K                     E
Sbjct: 146 --KGRGAKNNWKNGMEDIWFATVSNK---YTFNVDDVKIRRKVIAPYRIEGKPKDWTETE 200

Query: 177 DVQMRS--------DWLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIIL 228
           D   R         D  +P  S SE          HPTQKPE L+++++++S+   D I 
Sbjct: 201 DGNFRDTCPSNFWDDISVPYWSMSENT-------AHPTQKPEKLIAKLILASSNANDFIF 253

Query: 229 DPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQ 269
           DPF GSGT+  VAKKL R++ GIE  + Y   A KRI + +
Sbjct: 254 DPFLGSGTTSVVAKKLGRNYSGIEQHKTYCAWAEKRIENAE 294


>gi|118576552|ref|YP_876295.1| DNA modification methylase [Cenarchaeum symbiosum A]
 gi|118195073|gb|ABK77991.1| DNA modification methylase [Cenarchaeum symbiosum A]
          Length = 264

 Score =  112 bits (281), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 68/252 (26%), Positives = 125/252 (49%), Gaps = 19/252 (7%)

Query: 20  KDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDA-VTDSWDKFSSF 78
           +D+I  G+ I  +  +   SVDLI  DPP+ +    +  R +++  +  V D +++ +  
Sbjct: 17  RDRIFHGDCIEGMAAMKESSVDLIVTDPPFAIGFGAR--RANYNRKEGNVMDGYNEITPA 74

Query: 79  EAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
           E Y  FT  W+    RVLK  G+++V   + N+  I   +    F  +N I+WR    + 
Sbjct: 75  E-YPGFTGRWMAGAHRVLKETGSMFVFSGWTNLQDILRAIDETGFKTINHIIWRYQFGV- 132

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNK 198
            +  RRF ++H   ++   + K + +          +    M   W+I          N+
Sbjct: 133 -YTKRRFVSSHYHCLYVCKNDKKRRFYTESRHSDTKSRYRDMEDVWVI----------NR 181

Query: 199 D---GEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQ 255
           +   G+K  PT+ P  L+ +IL  S++ GD+++DPF GSG    V+K++ R + G E+ +
Sbjct: 182 EYWSGKKKTPTKLPGELIRKILQYSSREGDLVMDPFLGSGQVAVVSKEMGRRYAGFEIVR 241

Query: 256 DYIDIATKRIAS 267
           +Y D A +R+ +
Sbjct: 242 EYYDFALERLGA 253


>gi|261837549|gb|ACX97315.1| adenine-methyltransferase [Helicobacter pylori 51]
          Length = 165

 Score =  112 bits (281), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 66/151 (43%), Positives = 91/151 (60%), Gaps = 6/151 (3%)

Query: 114 IGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKA 173
           +G +LQ L+F ILN I W+K+NP PNF  R   ++ E +IWA  S K K + FNY+ LK 
Sbjct: 1   MGRILQKLDFKILNLITWQKTNPPPNFSCRYLTHSAEQIIWARKSRKHK-HVFNYEVLKK 59

Query: 174 ANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFG 233
            N D QMR  W  P  +  E+   K     HPTQKP ALL R+L+ ++    +I DPF G
Sbjct: 60  INNDKQMRDVWSFPAIAPWEKTNGK-----HPTQKPLALLVRLLLMASDENSLIGDPFSG 114

Query: 234 SGTSGAVAKKLRRSFIGIEMKQDYIDIATKR 264
           S T+G  A  L+R FIGIE + +++ ++  R
Sbjct: 115 SSTTGIAANLLKRQFIGIEKESEFVKMSMDR 145


>gi|238027668|ref|YP_002911899.1| DNA methylase N-4/N-6 domain-containing protein [Burkholderia
           glumae BGR1]
 gi|237876862|gb|ACR29195.1| DNA methylase N-4/N-6 domain protein [Burkholderia glumae BGR1]
          Length = 250

 Score =  112 bits (281), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 82/264 (31%), Positives = 113/264 (42%), Gaps = 42/264 (15%)

Query: 18  EWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSS 77
           +W D+   G+   +L  +PA   D + ADPPY           D SL       WD+   
Sbjct: 3   DWLDRCHFGDCRELLPMIPAGVADAVIADPPYG----------DTSL------KWDRVVD 46

Query: 78  FEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPM 137
                     W+ AC R LKP G++WV GS   I     +++   F    DIVWRK N  
Sbjct: 47  ---------GWIDACARTLKPAGSIWVFGSLRFIAPTFELMERAGFRYSQDIVWRKQNGT 97

Query: 138 PNFRGRRFQNAHETLIW---ASPSPKAKGYTFNYDALKAANEDVQMRSDW------LIPI 188
             F   RF+  HE  +     + S   K     +DA K         + W          
Sbjct: 98  -GFHNDRFRRVHEHAVLFYRGAWSDVYKCPQVTHDARKKQVRRKTRAAHWGDIDRGHYTS 156

Query: 189 CSGSERLR-------NKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVA 241
             G  RLR       N+ G  LHPTQKP  L+  ++  S  PG I+LDPF GSG++   A
Sbjct: 157 VDGGPRLRTSVIDMRNEHGHALHPTQKPVDLIELMVRYSVPPGGIVLDPFLGSGSTALAA 216

Query: 242 KKLRRSFIGIEMKQDYIDIATKRI 265
            +  R +IG E+  D  D+  +R+
Sbjct: 217 IRNGRHWIGCELDPDCRDMQAQRL 240


>gi|221369876|ref|YP_002520972.1| DNA methylase N-4/N-6 domain protein [Rhodobacter sphaeroides
           KD131]
 gi|221162928|gb|ACM03899.1| DNA methylase N-4/N-6 domain protein [Rhodobacter sphaeroides
           KD131]
          Length = 253

 Score =  112 bits (280), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 80/264 (30%), Positives = 118/264 (44%), Gaps = 48/264 (18%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           I+ G+ ++ +  LP  SVD +  DPPY     GQ   P           WD+F       
Sbjct: 7   ILPGDCLASMRTLPNCSVDAVVTDPPY-----GQTSLP-----------WDRF------- 43

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWIL-NDIVWRKSNPMPNFR 141
                W+    R+LKP G++WV G+     +     +  + W L  DIVW K N   +F 
Sbjct: 44  --VYGWMAEIGRILKPTGSVWVFGTLRTFTQ---HWREFDGWTLAQDIVWEKHN-GSSFH 97

Query: 142 GRRFQNAHETLI------WASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPIC----SG 191
             RF+  HE         WAS   K K  T +  A     +   +   W+         G
Sbjct: 98  ADRFRRVHEQAAHFYRGDWASVY-KGKVVTMDATAKSVRRKTPPVHMGWIDHGSYVSEDG 156

Query: 192 SERL-------RNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKL 244
             RL       R++ G   HPTQKP A++  +++++  PG ++LDPF GSGT+G VA +L
Sbjct: 157 GPRLMRSVIYSRSEHGRAQHPTQKPAAIIEPLILNACPPGGVVLDPFAGSGTTGGVAARL 216

Query: 245 RRSFIGIEMKQDYIDIATKRIASV 268
            R  I  E   DY+ +  +RI  +
Sbjct: 217 GRKAILCEGNTDYLSVMERRIGGI 240


>gi|167820636|ref|ZP_02452316.1| DNA modification methylase RsrI [Burkholderia pseudomallei 91]
          Length = 281

 Score =  112 bits (280), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 83/249 (33%), Positives = 127/249 (51%), Gaps = 34/249 (13%)

Query: 35  LPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRR 94
           LP  S+DLI ADPPY L   G+ Y  D           DK S  E + A+TR WL     
Sbjct: 43  LPDASIDLIVADPPYGL---GKDYGNDS----------DKRSGDE-HLAWTREWLELAVP 88

Query: 95  VLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIW 154
            LK  G+++V  ++     I + L+     ++N+I+W +  P      RRF + H+ + +
Sbjct: 89  KLKSTGSMYVFCTWQYAPEIFSFLKT-KLTMVNEIIWDRRVPSMGGTTRRFTSVHDNIGF 147

Query: 155 ASPSPKAKGYTFNYDAL---------KAANEDVQMRSDWL-----IPICSGSERLRNKDG 200
            + S   KGY F+ D +         KA +  +   S WL       + S S RL  +  
Sbjct: 148 FAVS---KGYYFDLDPVRIPYDADTKKARSRKLFEGSKWLELGYNQDVWSVS-RLHRQHA 203

Query: 201 EKL-HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYID 259
           E++ HPTQKP  ++ R++++S  PG  +LDPF GSGT+     + RR F+G E+ + Y  
Sbjct: 204 ERVDHPTQKPLEIIERMVLASCPPGGRVLDPFMGSGTTAVACARQRRGFVGYEINESYCA 263

Query: 260 IATKRIASV 268
           IA +R+AS+
Sbjct: 264 IARERVASL 272


>gi|186684880|ref|YP_001868076.1| DNA methylase N-4/N-6 domain-containing protein [Nostoc punctiforme
           PCC 73102]
 gi|186467332|gb|ACC83133.1| DNA methylase N-4/N-6 domain protein [Nostoc punctiforme PCC 73102]
          Length = 369

 Score =  112 bits (280), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 79/273 (28%), Positives = 129/273 (47%), Gaps = 55/273 (20%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           D+I+  +S+ +L  LP + VDL+ + PPYNL   G+ Y    +L              E 
Sbjct: 11  DQILLEDSLQLLRNLPDQCVDLVVSSPPYNL---GKEYESRQAL--------------EI 53

Query: 81  YDAFTRAWLLACRRVLKPNGTL-WVIGSYHNI-------FRIGTMLQNLNFWILNDIVWR 132
           Y     A LL C R+LK  G+L W +G++ +         R   +L++      N I+W 
Sbjct: 54  YLKEQTAVLLECSRILKNTGSLFWQVGAFSDRGMLIPLDIRFFPILESCRLIPRNRIIWA 113

Query: 133 KSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALK-------------------A 173
           + + +     ++F   HET++W +   K+  Y FN D ++                   +
Sbjct: 114 RQHGL--HAQKKFSCRHETILWFT---KSDNYKFNLDPIRVPQKYQNKKHYRGNRKGELS 168

Query: 174 ANEDVQMRSD-WLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFF 232
            N + +   D WL           N + + +HP Q PE L++RI++++T   DI+LDPF 
Sbjct: 169 CNPEGKNPGDIWLFRNVK-----HNHEEQTIHPCQFPEDLVTRIILATTNKNDIVLDPFM 223

Query: 233 GSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRI 265
           GSGT   VA+   R FIG E++  Y  +A +R+
Sbjct: 224 GSGTVAVVARDSERHFIGSEIEPKYYQVALRRL 256


>gi|20663549|pdb|1G60|A Chain A, Crystal Structure Of Methyltransferase Mboiia (Moraxella
           Bovis)
 gi|20663550|pdb|1G60|B Chain B, Crystal Structure Of Methyltransferase Mboiia (Moraxella
           Bovis)
          Length = 260

 Score =  112 bits (280), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 80/266 (30%), Positives = 121/266 (45%), Gaps = 45/266 (16%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           +KI + N    L+++  KSV L   DPPYNL                    WD F S   
Sbjct: 5   NKIHQMNCFDFLDQVENKSVQLAVIDPPYNLS----------------KADWDSFDSHNE 48

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           + AFT  W+      L  +G+L++  +  N   I   L +      N I W K + M + 
Sbjct: 49  FLAFTYRWIDKVLDKLDKDGSLYIFNTPFNCAFICQYLVSKGMIFQNWITWDKRDGMGSA 108

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANED---VQMRSD-------------- 183
           + RRF    ET+++ S   K+K +TFNYD ++   E    ++  S+              
Sbjct: 109 K-RRFSTGQETILFFS---KSKNHTFNYDEVRVPYESTDRIKHASEKGILKNGKRWFPNP 164

Query: 184 --------WLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSG 235
                   W        E++  K  +  H T KP  L+ RI+ +S+ P D++LD F GSG
Sbjct: 165 NGRLCGEVWHFSSQRHKEKVNGKTVKLTHITPKPRDLIERIIRASSNPNDLVLDCFMGSG 224

Query: 236 TSGAVAKKLRRSFIGIEMKQDYIDIA 261
           T+  VAKKL R+FIG +M  +Y++ A
Sbjct: 225 TTAIVAKKLGRNFIGCDMNAEYVNQA 250


>gi|332981877|ref|YP_004463318.1| DNA methylase N-4/N-6 domain-containing protein [Mahella
           australiensis 50-1 BON]
 gi|332699555|gb|AEE96496.1| DNA methylase N-4/N-6 domain protein [Mahella australiensis 50-1
           BON]
          Length = 314

 Score =  112 bits (279), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 87/285 (30%), Positives = 135/285 (47%), Gaps = 61/285 (21%)

Query: 15  SIFEWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQ--LNGQLYRPDHSLVDAVTDSW 72
           S+ +  D+ I  +  S    LP + V+L+F DPPYN+    NG  +              
Sbjct: 37  SVSDITDRTINQDIFSAARFLPQQFVNLLFVDPPYNMSKTFNGNTFNK------------ 84

Query: 73  DKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWR 132
               S + Y  +  +WL      LKP  +L++ G + +   I  ++    F I N I W 
Sbjct: 85  ---MSMDQYTQWLESWLTLLIPALKPIASLYICGDWRSSAAIFEVMSKY-FIIRNRITWE 140

Query: 133 KSNPMPNFRGRR--FQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICS 190
           +       RG +  ++NA E + + + S K   YTFN        E+V+++     P   
Sbjct: 141 REKG----RGSKTNWKNASEDIWFCTVSNK---YTFN-------AENVKLKRLVKAPYKD 186

Query: 191 GSERLRN-----KDGEKL----------------------HPTQKPEALLSRILVSSTKP 223
           GS + ++     K+  +L                      HPTQKPE LL++I+++S+ P
Sbjct: 187 GSGQPKDWHYDGKNKYRLTYPSNIWTDITVPFWSMPENTHHPTQKPEKLLAKIILASSNP 246

Query: 224 GDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASV 268
           GDIILDPF GSGT+  VAKKL R ++GIE+   Y  +A KR+A+ 
Sbjct: 247 GDIILDPFLGSGTTSVVAKKLGRRYVGIEIDNTYCCLAEKRLAAA 291


>gi|87042330|gb|ABD16204.1| M1.NcuI methyltransferase [Moraxella cuniculi]
          Length = 259

 Score =  112 bits (279), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 79/266 (29%), Positives = 119/266 (44%), Gaps = 45/266 (16%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           +KI   N    LEK+  KS+ L   DPPYNL                    WD F     
Sbjct: 4   NKIYHMNCFDFLEKIQNKSIQLAVIDPPYNLN----------------KADWDSFDDHNE 47

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           + AFT  W+      L  NG++++  +  N   I   L +      N I W K + M + 
Sbjct: 48  FLAFTYRWIDKVLDKLDKNGSIYIFNTPFNCAFICQYLVSKGMIFQNWITWDKRDGMGSA 107

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANED---VQMRSD-------------- 183
           + RRF    ET+++ S   K+K +TFNYD ++   E    ++  S+              
Sbjct: 108 K-RRFSTGQETILFFS---KSKNHTFNYDEVRVPYESTDRIKHASEKGILKNGQRWFPNP 163

Query: 184 --------WLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSG 235
                   W        E++  K  +  H T KP  L+ RI+ +S+ P D++LD F GSG
Sbjct: 164 NGRLCGEVWHFSSQRHKEKVNGKTVKLSHITPKPHDLIERIIKASSNPNDLVLDCFMGSG 223

Query: 236 TSGAVAKKLRRSFIGIEMKQDYIDIA 261
           T+  VAKKL R+FIG ++  +Y++ A
Sbjct: 224 TTAIVAKKLGRNFIGCDINTEYVEQA 249


>gi|53716177|ref|YP_106283.1| N-6 adenine-specific DNA methylase [Burkholderia mallei ATCC 23344]
 gi|53722718|ref|YP_111703.1| modification methylase [Burkholderia pseudomallei K96243]
 gi|67640710|ref|ZP_00439507.1| DNA modification methylase RsrI [Burkholderia mallei GB8 horse 4]
 gi|121596899|ref|YP_991244.1| N-6 adenine-specific DNA methylase [Burkholderia mallei SAVP1]
 gi|124382898|ref|YP_001025656.1| N-6 adenine-specific DNA methylase [Burkholderia mallei NCTC 10229]
 gi|126445073|ref|YP_001063438.1| DNA modification methylase RsrI [Burkholderia pseudomallei 668]
 gi|126446610|ref|YP_001077731.1| DNA modification methylase RsrI [Burkholderia mallei NCTC 10247]
 gi|126458257|ref|YP_001076339.1| DNA modification methylase RsrI [Burkholderia pseudomallei 1106a]
 gi|134278482|ref|ZP_01765196.1| DNA modification methylase RsrI [Burkholderia pseudomallei 305]
 gi|166999488|ref|ZP_02265327.1| DNA modification methylase RsrI [Burkholderia mallei PRL-20]
 gi|167828995|ref|ZP_02460466.1| DNA modification methylase RsrI [Burkholderia pseudomallei 9]
 gi|167850471|ref|ZP_02475979.1| DNA modification methylase RsrI [Burkholderia pseudomallei B7210]
 gi|167899065|ref|ZP_02486466.1| DNA modification methylase RsrI [Burkholderia pseudomallei 7894]
 gi|167915749|ref|ZP_02502840.1| DNA modification methylase RsrI [Burkholderia pseudomallei 112]
 gi|167923589|ref|ZP_02510680.1| DNA modification methylase RsrI [Burkholderia pseudomallei BCC215]
 gi|217422579|ref|ZP_03454082.1| DNA modification methylase RsrI [Burkholderia pseudomallei 576]
 gi|226195794|ref|ZP_03791381.1| DNA modification methylase RsrI [Burkholderia pseudomallei Pakistan
           9]
 gi|237508464|ref|ZP_04521179.1| DNA (cytosine-5-)-methyltransferase [Burkholderia pseudomallei
           MSHR346]
 gi|242312128|ref|ZP_04811145.1| DNA modification methylase RsrI [Burkholderia pseudomallei 1106b]
 gi|254176235|ref|ZP_04882893.1| DNA modification methylase RsrI [Burkholderia mallei ATCC 10399]
 gi|254186233|ref|ZP_04892751.1| DNA modification methylase RsrI [Burkholderia pseudomallei Pasteur
           52237]
 gi|254193634|ref|ZP_04900066.1| DNA modification methylase RsrI [Burkholderia pseudomallei S13]
 gi|254201165|ref|ZP_04907530.1| DNA modification methylase RsrI [Burkholderia mallei FMH]
 gi|254205137|ref|ZP_04911490.1| DNA modification methylase RsrI [Burkholderia mallei JHU]
 gi|254265092|ref|ZP_04955957.1| DNA modification methylase RsrI [Burkholderia pseudomallei 1710a]
 gi|254301281|ref|ZP_04968725.1| DNA modification methylase RsrI [Burkholderia pseudomallei 406e]
 gi|254359264|ref|ZP_04975536.1| DNA modification methylase RsrI [Burkholderia mallei 2002721280]
 gi|52213132|emb|CAH39171.1| putative modification methylase [Burkholderia pseudomallei K96243]
 gi|52422147|gb|AAU45717.1| N-6 adenine-specific DNA methylase [Burkholderia mallei ATCC 23344]
 gi|121224697|gb|ABM48228.1| N-6 adenine-specific DNA methylase [Burkholderia mallei SAVP1]
 gi|126224564|gb|ABN88069.1| DNA modification methylase RsrI [Burkholderia pseudomallei 668]
 gi|126232025|gb|ABN95438.1| DNA modification methylase RsrI [Burkholderia pseudomallei 1106a]
 gi|126239464|gb|ABO02576.1| DNA modification methylase RsrI [Burkholderia mallei NCTC 10247]
 gi|134250266|gb|EBA50346.1| DNA modification methylase RsrI [Burkholderia pseudomallei 305]
 gi|147748777|gb|EDK55852.1| DNA modification methylase RsrI [Burkholderia mallei FMH]
 gi|147754723|gb|EDK61787.1| DNA modification methylase RsrI [Burkholderia mallei JHU]
 gi|148028451|gb|EDK86411.1| DNA modification methylase RsrI [Burkholderia mallei 2002721280]
 gi|157811304|gb|EDO88474.1| DNA modification methylase RsrI [Burkholderia pseudomallei 406e]
 gi|157933919|gb|EDO89589.1| DNA modification methylase RsrI [Burkholderia pseudomallei Pasteur
           52237]
 gi|160697277|gb|EDP87247.1| DNA modification methylase RsrI [Burkholderia mallei ATCC 10399]
 gi|169650385|gb|EDS83078.1| DNA modification methylase RsrI [Burkholderia pseudomallei S13]
 gi|217394810|gb|EEC34829.1| DNA modification methylase RsrI [Burkholderia pseudomallei 576]
 gi|225932279|gb|EEH28279.1| DNA modification methylase RsrI [Burkholderia pseudomallei Pakistan
           9]
 gi|235000669|gb|EEP50093.1| DNA (cytosine-5-)-methyltransferase [Burkholderia pseudomallei
           MSHR346]
 gi|238521481|gb|EEP84932.1| DNA modification methylase RsrI [Burkholderia mallei GB8 horse 4]
 gi|242135367|gb|EES21770.1| DNA modification methylase RsrI [Burkholderia pseudomallei 1106b]
 gi|243064538|gb|EES46724.1| DNA modification methylase RsrI [Burkholderia mallei PRL-20]
 gi|254216094|gb|EET05479.1| DNA modification methylase RsrI [Burkholderia pseudomallei 1710a]
 gi|261827031|gb|ABM99404.2| DNA modification methylase RsrI [Burkholderia mallei NCTC 10229]
          Length = 282

 Score =  111 bits (278), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 81/249 (32%), Positives = 126/249 (50%), Gaps = 33/249 (13%)

Query: 35  LPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRR 94
           LP  S+DLI ADPPY L   G+ Y  D           DK S  E + A+TR WL     
Sbjct: 43  LPDASIDLIVADPPYGL---GKDYGNDS----------DKRSGDE-HLAWTREWLELAVP 88

Query: 95  VLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIW 154
            LK  G+++V  ++     I + L+     ++N+I+W +  P      RRF + H+ + +
Sbjct: 89  KLKSTGSMYVFCTWQYAPEIFSFLKT-KLTMVNEIIWDRRVPSMGGTTRRFTSVHDNIGF 147

Query: 155 ASPSPKAKGYTFNYDAL---------KAANEDVQMRSDWLIPICSGSE-----RLRNKDG 200
            + S   KGY F+ D +         KA +  +   S WL    +  +     RL  +  
Sbjct: 148 FAVS---KGYYFDLDPVRIPYDADTKKARSRKLFEGSKWLELGYNPKDVWSVSRLHRQHA 204

Query: 201 EKL-HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYID 259
           E++ HPTQKP  ++ R++++S  PG  +LDPF GSGT+     + RR F+G E+ + Y  
Sbjct: 205 ERVDHPTQKPLEIIERMVLASCPPGGRVLDPFMGSGTTAVACARQRRGFVGYEINESYCA 264

Query: 260 IATKRIASV 268
           IA +R+AS+
Sbjct: 265 IARERVASL 273


>gi|76819441|ref|YP_335927.1| DNA methylase [Burkholderia pseudomallei 1710b]
 gi|76583914|gb|ABA53388.1| DNA methylase [Burkholderia pseudomallei 1710b]
          Length = 258

 Score =  111 bits (278), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 81/249 (32%), Positives = 126/249 (50%), Gaps = 33/249 (13%)

Query: 35  LPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRR 94
           LP  S+DLI ADPPY L   G+ Y  D           DK S  E + A+TR WL     
Sbjct: 19  LPDASIDLIVADPPYGL---GKDYGNDS----------DKRSGDE-HLAWTREWLELAVP 64

Query: 95  VLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIW 154
            LK  G+++V  ++     I + L+     ++N+I+W +  P      RRF + H+ + +
Sbjct: 65  KLKSTGSMYVFCTWQYAPEIFSFLKT-KLTMVNEIIWDRRVPSMGGTTRRFTSVHDNIGF 123

Query: 155 ASPSPKAKGYTFNYDAL---------KAANEDVQMRSDWLIPICSGSE-----RLRNKDG 200
            + S   KGY F+ D +         KA +  +   S WL    +  +     RL  +  
Sbjct: 124 FAVS---KGYYFDLDPVRIPYDADTKKARSRKLFEGSKWLELGYNPKDVWSVSRLHRQHA 180

Query: 201 EKL-HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYID 259
           E++ HPTQKP  ++ R++++S  PG  +LDPF GSGT+     + RR F+G E+ + Y  
Sbjct: 181 ERVDHPTQKPLEIIERMVLASCPPGGRVLDPFMGSGTTAVACARQRRGFVGYEINESYCA 240

Query: 260 IATKRIASV 268
           IA +R+AS+
Sbjct: 241 IARERVASL 249


>gi|257088375|ref|ZP_05582736.1| DNA-methyltransferase [Enterococcus faecalis D6]
 gi|256996405|gb|EEU83707.1| DNA-methyltransferase [Enterococcus faecalis D6]
 gi|315026485|gb|EFT38417.1| DNA (cytosine-5-)-methyltransferase [Enterococcus faecalis TX2137]
          Length = 246

 Score =  111 bits (277), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 84/265 (31%), Positives = 128/265 (48%), Gaps = 43/265 (16%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           +II  +    L ++  +SVDLIF DPPYNL+          S  D ++DSW    S + Y
Sbjct: 3   RIINKDVFKGLNEVKEESVDLIFIDPPYNLK---------KSYADGISDSW---ISDKEY 50

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFR 141
             +   WL      LKPNG+L+++ +  N+  I   L++   +I + IVW   +     +
Sbjct: 51  MDWVEKWLEITISKLKPNGSLYIMNTTQNMPFIDIYLRD-KLYIQSRIVWHYDSSGVQAK 109

Query: 142 GRRFQNAHETLIWASPSPKAKGYTFNYDALKAA--------------------NEDVQMR 181
            R + + +E +++ +   K  GYTFN  A++                      NE     
Sbjct: 110 -RYYGSLYEPILFCTK--KRSGYTFNGSAIEVKTRTGSERKLIDYRKNPPQQYNETKVPG 166

Query: 182 SDWLIPICSGSERLRNKDGEKL-HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAV 240
           + W  P      R+R K  E + HP+QKP +LL RI+++S+  GD ILD F GS   G V
Sbjct: 167 NVWYFP------RVRFKMKEYVKHPSQKPISLLKRIVLASSNEGDTILDVFAGSFALGEV 220

Query: 241 AKKLRRSFIGIEMKQDYIDIATKRI 265
            K   R +IGIEM + Y +I   R+
Sbjct: 221 CKNYSRDYIGIEMSKTYCEIGKNRL 245


>gi|23428395|gb|AAL15431.1| DNA methyltransferase B [Moraxella nonliquefaciens]
 gi|52788778|gb|AAU87369.1| MnlI m6A-methyltransferase [Moraxella nonliquefaciens]
          Length = 239

 Score =  111 bits (277), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 78/248 (31%), Positives = 120/248 (48%), Gaps = 22/248 (8%)

Query: 20  KDKIIKGNSISVLEKLPAKSV--DLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSS 77
           K KI   N ++  ++L    +  + I  DPPY +      +  ++         WD    
Sbjct: 10  KIKIFHDNCLNTFKQLKNDKILINHIITDPPYAISSENNFHTMNNPRKGVDFGEWD---- 65

Query: 78  FEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPM 137
              +D     WL     +L  NG++ +  SY  I +I   +++L   + + ++W+K NPM
Sbjct: 66  ---WDFNPCLWLDDAYPLLDKNGSMVIFCSYRFISQIIHKIEHLGGVVKDVMIWQKQNPM 122

Query: 138 PNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRN 197
           P    RR+    E +IWA  +  +K + FN    K AN+  Q R  +  P   G ER + 
Sbjct: 123 PRNINRRYVQDMEFIIWALKNKNSK-WVFN----KPANKPYQ-RGFFQTPTLLGKERTK- 175

Query: 198 KDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDY 257
                 HPTQKP AL+S I+   T   +IILDPF G G++G   + L R FIGIE  + +
Sbjct: 176 ------HPTQKPLALMSEIIQIHTNENEIILDPFMGVGSTGVACQGLNRYFIGIEQDKAW 229

Query: 258 IDIATKRI 265
            DIA +R+
Sbjct: 230 FDIAGQRL 237


>gi|167621342|ref|ZP_02389973.1| DNA modification methylase RsrI [Burkholderia thailandensis Bt4]
 gi|257141965|ref|ZP_05590227.1| DNA modification methylase RsrI [Burkholderia thailandensis E264]
          Length = 285

 Score =  111 bits (277), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 81/249 (32%), Positives = 126/249 (50%), Gaps = 33/249 (13%)

Query: 35  LPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRR 94
           LP  S+DLI ADPPY L   G+ Y  D           DK S  E + A+TR WL     
Sbjct: 46  LPDASIDLIVADPPYGL---GKDYGNDS----------DKRSGDE-HLAWTREWLELAIP 91

Query: 95  VLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIW 154
            LK  G+++V  ++     I + L+     ++N+I+W +  P      RRF + H+ + +
Sbjct: 92  KLKSTGSMYVFCTWQYAPEIFSFLKT-RLTMINEIIWDRRVPSMGGTTRRFTSVHDNIGF 150

Query: 155 ASPSPKAKGYTFNYDAL---------KAANEDVQMRSDWLIPICSGSE-----RLRNKDG 200
            + S   KGY F+ D +         KA +  +   S WL    +  +     RL  +  
Sbjct: 151 FAVS---KGYYFDLDPVRIPYDADTKKARSRKLFEGSKWLELGYNPKDVWSVSRLHRQHA 207

Query: 201 EKL-HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYID 259
           E++ HPTQKP  ++ R++++S  PG  +LDPF GSGT+     + RR F+G E+ + Y  
Sbjct: 208 ERVDHPTQKPLEIIERMVLASCPPGGRVLDPFMGSGTTAVACARQRRDFVGYEINESYCA 267

Query: 260 IATKRIASV 268
           IA +R+AS+
Sbjct: 268 IARERVASL 276


>gi|167577250|ref|ZP_02370124.1| DNA modification methylase RsrI [Burkholderia thailandensis TXDOH]
          Length = 285

 Score =  111 bits (277), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 81/249 (32%), Positives = 126/249 (50%), Gaps = 33/249 (13%)

Query: 35  LPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRR 94
           LP  S+DLI ADPPY L   G+ Y  D           DK S  E + A+TR WL     
Sbjct: 46  LPDASIDLIVADPPYGL---GKDYGNDS----------DKRSGDE-HLAWTREWLELAIP 91

Query: 95  VLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIW 154
            LK  G+++V  ++     I + L+     ++N+I+W +  P      RRF + H+ + +
Sbjct: 92  KLKSTGSMYVFCTWQYAPEIFSFLKT-RLTMINEIIWDRRVPSMGGTTRRFTSVHDNIGF 150

Query: 155 ASPSPKAKGYTFNYDAL---------KAANEDVQMRSDWLIPICSGSE-----RLRNKDG 200
            + S   KGY F+ D +         KA +  +   S WL    +  +     RL  +  
Sbjct: 151 FAVS---KGYYFDLDPVRIPYDADTKKARSRKLFEGSKWLELGYNPKDVWSVSRLHRQHA 207

Query: 201 EKL-HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYID 259
           E++ HPTQKP  ++ R++++S  PG  +LDPF GSGT+     + RR F+G E+ + Y  
Sbjct: 208 ERVDHPTQKPLEIIERMVLASCPPGGRVLDPFMGSGTTAVACARQRRDFVGYEINESYCA 267

Query: 260 IATKRIASV 268
           IA +R+AS+
Sbjct: 268 IARERVASL 276


>gi|317503648|ref|ZP_07961665.1| site-specific DNA-methyltransferase (adenine-specific) [Prevotella
           salivae DSM 15606]
 gi|315665169|gb|EFV04819.1| site-specific DNA-methyltransferase (adenine-specific) [Prevotella
           salivae DSM 15606]
          Length = 319

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 87/275 (31%), Positives = 128/275 (46%), Gaps = 63/275 (22%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFE--A 80
           +I  +    L+ +P     LI  DPPYNL       +  H          +KFS     +
Sbjct: 42  VINADLFDCLDVIPNDYFHLIIIDPPYNLA------KDFHG---------NKFSKLNTTS 86

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           Y+A+ R+W       L PNGTL++ G +     +  ++      ILN I W++       
Sbjct: 87  YEAYLRSWFGKVCDKLVPNGTLYMCGDWQCSLSMQKVISE-RLTILNRITWQRE------ 139

Query: 141 RGR----RFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQ------MRSDW------ 184
           +GR     ++NA E + +A  +PK   Y F+ +A+K   + +          DW      
Sbjct: 140 KGRGAKANWKNAMEDIWFAVKNPK--DYYFDVEAVKMKRKVIAPYKVDGKPKDWEQTESG 197

Query: 185 --------------LIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDP 230
                          IP  S  E   N D    HPTQKPE L ++++++STKPGD I DP
Sbjct: 198 NFRITYPSNFWDDISIPFWSMPE---NTD----HPTQKPEKLYAKLILASTKPGDKIFDP 250

Query: 231 FFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRI 265
           F GSGTS  VA KL R+++GIE+ +DY   A KR+
Sbjct: 251 FLGSGTSAVVAYKLNRNYVGIELNRDYCLWAAKRL 285


>gi|83716900|ref|YP_438879.1| N-6 adenine-specific DNA methylase [Burkholderia thailandensis
           E264]
 gi|83650725|gb|ABC34789.1| N-6 adenine-specific DNA methylase [Burkholderia thailandensis
           E264]
          Length = 259

 Score =  110 bits (276), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 81/249 (32%), Positives = 126/249 (50%), Gaps = 33/249 (13%)

Query: 35  LPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRR 94
           LP  S+DLI ADPPY L   G+ Y  D           DK S  E + A+TR WL     
Sbjct: 20  LPDASIDLIVADPPYGL---GKDYGNDS----------DKRSGDE-HLAWTREWLELAIP 65

Query: 95  VLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIW 154
            LK  G+++V  ++     I + L+     ++N+I+W +  P      RRF + H+ + +
Sbjct: 66  KLKSTGSMYVFCTWQYAPEIFSFLKT-RLTMINEIIWDRRVPSMGGTTRRFTSVHDNIGF 124

Query: 155 ASPSPKAKGYTFNYDAL---------KAANEDVQMRSDWLIPICSGSE-----RLRNKDG 200
            + S   KGY F+ D +         KA +  +   S WL    +  +     RL  +  
Sbjct: 125 FAVS---KGYYFDLDPVRIPYDADTKKARSRKLFEGSKWLELGYNPKDVWSVSRLHRQHA 181

Query: 201 EKL-HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYID 259
           E++ HPTQKP  ++ R++++S  PG  +LDPF GSGT+     + RR F+G E+ + Y  
Sbjct: 182 ERVDHPTQKPLEIIERMVLASCPPGGRVLDPFMGSGTTAVACARQRRDFVGYEINESYCA 241

Query: 260 IATKRIASV 268
           IA +R+AS+
Sbjct: 242 IARERVASL 250


>gi|328948974|ref|YP_004366311.1| DNA methylase N-4/N-6 domain protein [Treponema succinifaciens DSM
           2489]
 gi|328449298|gb|AEB15014.1| DNA methylase N-4/N-6 domain protein [Treponema succinifaciens DSM
           2489]
          Length = 314

 Score =  110 bits (275), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 85/283 (30%), Positives = 130/283 (45%), Gaps = 55/283 (19%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQ--LNGQLYRPDHSLVDAVTDSWDKFSSF 78
           ++ + G+ + +LE  P    DLI  DPPYNL    NG  +                  S 
Sbjct: 41  NRTLNGDILKMLEFTPDGFADLIIIDPPYNLSKNFNGMKFAS---------------RSQ 85

Query: 79  EAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
           E YD +   W  A  + LK NG+L++ G +     +   ++     +LN I W++     
Sbjct: 86  EGYDEYLATWFPAVCKKLKSNGSLYICGDWKCTSSLQRAVER-ELTVLNRITWQREKG-- 142

Query: 139 NFRGRR--FQNAHETLIWASPSP--------------------KAKGYTFNYDALKAANE 176
             RG +  ++N  E + +A  +P                    KA G   ++D     N 
Sbjct: 143 --RGAKSNWKNGMEDIWFAVKNPADYYFDVEAVKMKRKVLAPYKADGKPKDWDEESEGNF 200

Query: 177 DVQMRS----DWLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFF 232
            +   S    D  +P  S  E   N D    HPTQKPE L ++++++S++PGDI+ DPF 
Sbjct: 201 RLTYPSNFWDDISVPFWSMPE---NTD----HPTQKPEKLYAKLILASSRPGDIVFDPFL 253

Query: 233 GSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIE 275
           GSGT+  VAKKL R F GIE  ++Y   A KR+A  +   +I+
Sbjct: 254 GSGTASVVAKKLGRRFCGIEQNEEYCLWAEKRLALAETDKSIQ 296


>gi|254304047|ref|ZP_04971405.1| site-specific DNA-methyltransferase (adenine-specific)
           [Fusobacterium nucleatum subsp. polymorphum ATCC 10953]
 gi|148324239|gb|EDK89489.1| site-specific DNA-methyltransferase (adenine-specific)
           [Fusobacterium nucleatum subsp. polymorphum ATCC 10953]
          Length = 297

 Score =  110 bits (274), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 83/277 (29%), Positives = 138/277 (49%), Gaps = 33/277 (11%)

Query: 24  IKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDA 83
           I GN + +L+++   SVDLIFADPPY +   G+ +           +  D F +   Y  
Sbjct: 22  ILGNCLDILKEIKDNSVDLIFADPPYGI---GKDF----------GNKTDFFKNKYEYFE 68

Query: 84  FTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGR 143
           + + W+  C RVLK +GT++ + S   +  +   + +  ++I++ IVW   +     + +
Sbjct: 69  WAKKWIDECMRVLKKDGTMYFMTSTQFMSILDNYVDD-KYFIISRIVWCYDSSGVQAKSK 127

Query: 144 RFQNAHETLIWASPSPKAKGYTFNYD-----ALKAANED-VQMRSDWLIPICS------- 190
            F + +E ++  + + K K Y FNY+     A+  +  + +  R     P  +       
Sbjct: 128 -FGSLYEPILMITHNDKVK-YKFNYEDIMVEAITGSKRNLIDYRKKIPAPYSNLKVPGNV 185

Query: 191 ---GSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRS 247
                 R R ++ E  HPTQKPE LL RI+++S+  GD++LDPF GS T+  VA KL R 
Sbjct: 186 WTFNRVRFRMEEYEN-HPTQKPEELLMRIILASSNKGDVVLDPFSGSFTTSNVALKLDRK 244

Query: 248 FIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRT 284
            IGIE+  +Y  I  +R    +   N +L     K+T
Sbjct: 245 AIGIEINPEYFKIGIRRTKLSEYFENEKLEKQKIKKT 281


>gi|94311402|ref|YP_584612.1| DNA methylase N-4/N-6 [Cupriavidus metallidurans CH34]
 gi|93355254|gb|ABF09343.1| DNA methylase N-4/N-6 [Cupriavidus metallidurans CH34]
          Length = 311

 Score =  110 bits (274), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 71/266 (26%), Positives = 132/266 (49%), Gaps = 35/266 (13%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           ++ + + +  ++++P  S+DL+ ADPPY L   G+ Y  D  L+           S +AY
Sbjct: 32  RLYQEDVLEGIKRIPDGSIDLVVADPPYGL---GKDYGNDSDLL-----------SGDAY 77

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFR 141
             ++  W+ A    + P GTL++  ++     +  ML+     ++N+I+W +  P     
Sbjct: 78  LEWSERWMDAIVPKIAPRGTLYLFCTWQYSPELFVMLKR-RMTMINEIIWDRRVPSMGGT 136

Query: 142 GRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSE-------- 193
            R+F + H+ + + +   + + Y F+ D ++    D + +     P   G +        
Sbjct: 137 TRKFSSVHDNIGFFA---RQRDYFFDLDPVRIPY-DAETKKARSRPRFEGKKWLEVGYNP 192

Query: 194 -------RLRNKDGEKL-HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLR 245
                  R+  +D E+  HPTQKP  ++ R+++SS  PG I+LDPF GSGT+     +  
Sbjct: 193 KDLWSVPRIHRQDPERADHPTQKPLEIVERMVLSSCPPGGIVLDPFTGSGTTAVACVRHG 252

Query: 246 RSFIGIEMKQDYIDIATKRIASVQPL 271
           RSF+G EM  +Y  +  +R+ + QP+
Sbjct: 253 RSFVGFEMNPEYAGLVRERVTAAQPV 278


>gi|282879893|ref|ZP_06288620.1| DNA (cytosine-5-)-methyltransferase [Prevotella timonensis CRIS
           5C-B1]
 gi|281306287|gb|EFA98320.1| DNA (cytosine-5-)-methyltransferase [Prevotella timonensis CRIS
           5C-B1]
          Length = 331

 Score =  110 bits (274), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 91/295 (30%), Positives = 140/295 (47%), Gaps = 65/295 (22%)

Query: 3   QKNSLAINENQNSIFEWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQ--LNGQLYRP 60
           +K  L++N+ + S  +  D II  +    L+ +P    +LI  DPPYNL    +G+    
Sbjct: 24  EKFILSVNDIKTSFAD--DTIINADLFDCLDYIPNGYFNLIIIDPPYNLDKDFHGK---- 77

Query: 61  DHSLVDAVTDSWDKFSSF--EAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTML 118
                        KFSS   +AY+ + R+W       L PNGTL+V G +     +  ++
Sbjct: 78  -------------KFSSMKSDAYEDYLRSWFYKVCDKLAPNGTLYVCGDWKCSSSMQRVI 124

Query: 119 QNLNFWILNDIVWRKSNPMPNFRGRR--FQNAHETLIWASPSPKAKGYTFNYDALK---- 172
           +     ++N I W++       RG +  ++NA E + +A  +PK   Y F+ DA+     
Sbjct: 125 EE-RLTVINRITWQREKG----RGAKSNWKNAMEDIWFAVRNPK--DYYFDVDAVMMKRK 177

Query: 173 --------------AANEDVQMR--------SDWLIPICSGSERLRNKDGEKLHPTQKPE 210
                            E+   R         D  IP  S  E   N D    HPTQKPE
Sbjct: 178 VIAPYKVDGNPKDWEETENGNFRITYPSNFWDDISIPFWSMPE---NTD----HPTQKPE 230

Query: 211 ALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRI 265
            L ++++++STK GD I DPF GSGT+  VA+KL RS+ G+E+ ++Y   A KR+
Sbjct: 231 KLYAKLVLASTKLGDKIFDPFLGSGTTAVVAQKLGRSYCGVEINREYCYWAVKRL 285


>gi|206889902|ref|YP_002248225.1| modification methylase BamHI [Thermodesulfovibrio yellowstonii DSM
           11347]
 gi|206741840|gb|ACI20897.1| modification methylase BamHI [Thermodesulfovibrio yellowstonii DSM
           11347]
          Length = 338

 Score =  110 bits (274), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 81/277 (29%), Positives = 130/277 (46%), Gaps = 42/277 (15%)

Query: 11  ENQNSIFEWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTD 70
           +N+N      +KII G+ + ++ K+P  SVD+ FADPP+NL+     Y  +H +      
Sbjct: 2   QNKNFSKSLLNKIIFGDCLEIMRKIPDNSVDVTFADPPFNLKKKYNSYYDEHDV------ 55

Query: 71  SWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNI----FRIGTMLQNLNFWIL 126
                   E Y ++ + WL    R+ KP G+++V    HNI       G+ L  +  +  
Sbjct: 56  --------EIYLSWCKEWLYEMVRITKPTGSIFV----HNIPKWLIYFGSYLNEIAIFRH 103

Query: 127 NDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTF----------NYDALKAANE 176
               W   + M + RG+     H  +++   S K K Y             Y       +
Sbjct: 104 ----WIAWDAMGSPRGKTLLPNHYGILYYVKSDKFKFYDIRMLHKRCRKCKYILQDYGGK 159

Query: 177 DVQMRSDWLIPICSG----SERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFF 232
             QM      P+ S       R+R++     HP Q P  L+ R+L+ ++  GD+ILDPF 
Sbjct: 160 KAQMHQ--FGPLVSDVWTDIHRIRHRKRRDKHPCQLPVHLIERLLLMTSDEGDVILDPFV 217

Query: 233 GSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQ 269
           G+GT+   AK+L R FIGI++ + YI+IA K++   Q
Sbjct: 218 GTGTTAIAAKRLGRRFIGIDIDEKYIEIAHKKLKETQ 254


>gi|186473194|ref|YP_001860536.1| DNA methylase N-4/N-6 domain-containing protein [Burkholderia
           phymatum STM815]
 gi|184195526|gb|ACC73490.1| DNA methylase N-4/N-6 domain protein [Burkholderia phymatum STM815]
          Length = 305

 Score =  110 bits (274), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 80/265 (30%), Positives = 129/265 (48%), Gaps = 36/265 (13%)

Query: 35  LPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRR 94
           LP  S+DLI ADPPY L   G+ Y  D  +            S E + A+TRAWL     
Sbjct: 54  LPDGSIDLIVADPPYGL---GKDYGNDSDM-----------RSGEDFLAWTRAWLDLAIP 99

Query: 95  VLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIW 154
            LKP+G+L++  ++     I   L+     ++N+I+W +  P      RRF + H+ + +
Sbjct: 100 KLKPSGSLYIFCTWQYAPEIFVFLKR-RLLMVNEIIWDRRVPSMGGTTRRFTSVHDNIGY 158

Query: 155 ASPSPKAKGYTFNYDALKAANEDVQMR---------SDWLIPICSGSE-----RLRNKDG 200
            + S   K Y F+ D ++   + V  +         S WL    +  +     RL  +  
Sbjct: 159 FAVS---KDYYFDLDPVRIPYDAVTKKARSRKLFEGSKWLELGYNPKDVWSVSRLHRQHA 215

Query: 201 EKL-HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYID 259
           E++ HPTQKP  ++ R++++S  PG  +LDPF GSGT+     +  R F+G E+ + Y  
Sbjct: 216 ERVDHPTQKPLEIVERMVLASCPPGGRVLDPFMGSGTTAVACARQTREFVGYEINESYCA 275

Query: 260 IATKRI---ASVQPLGNIELTVLTG 281
           IA +R+   A+  P G+     +T 
Sbjct: 276 IARERVSLAANPPPAGSRRKAAVTA 300


>gi|167566406|ref|ZP_02359322.1| N-6 adenine-specific DNA methylase [Burkholderia oklahomensis
           EO147]
          Length = 282

 Score =  109 bits (273), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 80/249 (32%), Positives = 127/249 (51%), Gaps = 33/249 (13%)

Query: 35  LPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRR 94
           LP  S+DLI ADPPY L   G+ Y  D           DK S  E + A+TR WL     
Sbjct: 46  LPDASIDLIVADPPYGL---GKDYGNDS----------DKRSGDE-HLAWTREWLDLAIP 91

Query: 95  VLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIW 154
            LK +G+++V  ++     I + L+     ++N+I+W +  P      RRF + H+ + +
Sbjct: 92  KLKSSGSMYVFCTWQYAPEIFSFLKT-KLTMVNEIIWDRRVPSMGGTTRRFTSVHDNIGF 150

Query: 155 ASPSPKAKGYTFNYDAL---------KAANEDVQMRSDWLIPICSGSE-----RLRNKDG 200
            + S   KGY F+ D +         KA +  +   S WL    +  +     RL  +  
Sbjct: 151 FAVS---KGYYFDLDPVRIPYDADTKKARSRKLFEGSKWLELGYNPKDVWSVSRLHRQHA 207

Query: 201 EKL-HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYID 259
           E++ HPTQKP  ++ R++++S  PG  +LDPF GSGT+     + RR F+G E+ + Y  
Sbjct: 208 ERVDHPTQKPLEIVERMVLASCPPGGRVLDPFMGSGTTAVACARQRRDFVGYEINESYCA 267

Query: 260 IATKRIASV 268
           IA +R+A++
Sbjct: 268 IAHERVAAL 276


>gi|325523911|gb|EGD02128.1| DNA methylase N-4/N-6 domain-containing protein [Burkholderia sp.
           TJI49]
          Length = 284

 Score =  109 bits (273), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 77/250 (30%), Positives = 128/250 (51%), Gaps = 33/250 (13%)

Query: 34  KLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACR 93
           +LP  S+DLI ADPPY L   G+ Y  D           DK S  +A+ A+TR WL    
Sbjct: 47  RLPDASIDLIVADPPYGL---GKDYGNDS----------DKRSG-DAFLAWTREWLELAV 92

Query: 94  RVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLI 153
             LKP+G++++  ++     I + L+     ++N+I+W +  P      RRF + H+ + 
Sbjct: 93  PKLKPSGSMYIFCTWQYAPEIFSFLKT-RLTMVNEIIWDRRVPSMGGTTRRFTSVHDNIG 151

Query: 154 WASPSPKAKGYTFNYDAL---------KAANEDVQMRSDWLIPICSGSE-----RLRNKD 199
           + + S   K Y F+ D +         KA +  +   S WL    +  +     RL  + 
Sbjct: 152 FFAVS---KAYYFDLDPVRIPYDADTKKARSRKLFEGSKWLEMGYNPKDVWSVSRLHRQH 208

Query: 200 GEKL-HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYI 258
            E++ HPTQKP  ++ R++++S  PG  +LDPF GSGT+     +  R F+G E+ + Y 
Sbjct: 209 AERVDHPTQKPLEIIERMVLASCPPGGRVLDPFMGSGTTAVACARQGRDFVGYEINESYC 268

Query: 259 DIATKRIASV 268
            IA +R++++
Sbjct: 269 AIAHERVSAL 278


>gi|119489624|ref|ZP_01622384.1| DNA-methyltransferase [Lyngbya sp. PCC 8106]
 gi|119454536|gb|EAW35684.1| DNA-methyltransferase [Lyngbya sp. PCC 8106]
          Length = 295

 Score =  109 bits (273), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 83/260 (31%), Positives = 135/260 (51%), Gaps = 35/260 (13%)

Query: 23  IIKGNSISVLE-KLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           +  G+++ +L  ++ + SVDLIF DPPYN+   G+ +          ++ +DK+ S E Y
Sbjct: 12  LFYGDALQILSSEISSNSVDLIFIDPPYNI---GKRF----------SNFYDKWESEEKY 58

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFR 141
             +    L  C RVLKP+GTL+V+ S   +      L+     IL+ IVW   +     +
Sbjct: 59  ANWAYKLLDECLRVLKPSGTLYVMTSTQAMPYFDLYLRQKTV-ILSRIVWHYDSSGVQAK 117

Query: 142 GRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRS--DW--LIPICSGSE---- 193
            + F + +E ++    +     Y FN D +K   +    R   D+   +P    +E    
Sbjct: 118 -KYFGSMYEPILHCVKN--KNNYIFNSDDIKVEAKTGAQRKLIDYRKAVPCQYNTEKVPG 174

Query: 194 --------RLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLR 245
                   R R ++ EK HP+QKPEALL RI+++S+    ++LDPF G+ TS AVAK+L 
Sbjct: 175 NVWYFPRVRYRMEEYEK-HPSQKPEALLERIILASSNQDSLVLDPFAGTFTSAAVAKRLG 233

Query: 246 RSFIGIEMKQDYIDIATKRI 265
           R  I IE +++Y+ I  +R+
Sbjct: 234 RISISIESQEEYLKIGLRRV 253


>gi|320103609|ref|YP_004179200.1| DNA methylase N-4/N-6 domain-containing protein [Isosphaera pallida
           ATCC 43644]
 gi|319750891|gb|ADV62651.1| DNA methylase N-4/N-6 domain protein [Isosphaera pallida ATCC
           43644]
          Length = 327

 Score =  109 bits (273), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 81/275 (29%), Positives = 137/275 (49%), Gaps = 48/275 (17%)

Query: 20  KDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFE 79
           +  ++ G++I+ L +L A SVDLI ADPPYNLQ                   WD+F++ E
Sbjct: 52  RGHLVTGDAIAWLNQLDAASVDLIVADPPYNLQ----------------KAKWDRFATEE 95

Query: 80  AYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILND--IVWRKSNPM 137
           AY  ++  W+ A RRVLK  G+L+V G    +     + +    W  +   +VW   N  
Sbjct: 96  AYLTWSLEWIAAARRVLKETGSLYVCGFSETL---ADLKRPALRWFADCRWLVWHYRNKA 152

Query: 138 PNFRGRRFQNAHETLIWASPSPKAK-----------GYTFNYDALKAANE----DVQMRS 182
            N  GR +  +HE+++    +P  +           G+T  Y A   A      D + R+
Sbjct: 153 -NL-GRDWGRSHESILHLRVTPAFRLRLDAVRVPYGGHTVKYPARTQARTSCFGDGRSRA 210

Query: 183 DWLIPICSGSE--------RLRNKDGEKL-HPTQKPEALLSRILVSSTKPGDIILDPFFG 233
            W +P  +G++           N  GE+  HP+QKPE L+  ++++++   D+++DPF G
Sbjct: 211 PW-VPHPAGAKPRDVLEYPTTCNGMGERTPHPSQKPEGLIRHLILAASDEHDLVIDPFSG 269

Query: 234 SGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASV 268
           SGT+   A++L R +IG + +  Y   A +R+ ++
Sbjct: 270 SGTTVVAAQQLNRRWIGCDREPSYHAWAVRRLETL 304


>gi|313667091|gb|ADR72989.1| M.BspEI [Bacillus sp. NEBM136]
          Length = 314

 Score =  109 bits (273), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 84/280 (30%), Positives = 131/280 (46%), Gaps = 60/280 (21%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           K+  G+SI  L+ L  +SVDLIFADPPYN++                   WD F + E+Y
Sbjct: 41  KLFLGDSIQWLKTLETESVDLIFADPPYNIK----------------KAEWDTFENQESY 84

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFR 141
             ++  W++   RVLK NG+L++ G +  I        +  F     +VW   N   N  
Sbjct: 85  IQWSLEWIVEASRVLKKNGSLYICG-FSEILADLKHPASKYFKGCKWLVWHYKNKA-NL- 141

Query: 142 GRRFQNAHETLIWASPSPKAKGYTFNYDALK-------------AANEDVQM-----RSD 183
           G+ F  +HE+L+      K K YT N D ++                E  Q      R +
Sbjct: 142 GKDFGRSHESLLHFR---KTKKYTMNQDLVRIPYGGHTLKYPSHPQAESSQYGSGKKRDN 198

Query: 184 WL-------------IPI-CSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILD 229
           W+             +P  C+G       + +  HPTQKPE L+ + +++S+  GD+ILD
Sbjct: 199 WMPHPLGAKPKDVIEVPTTCNGM------NEKTPHPTQKPEELVRKFILASSNRGDVILD 252

Query: 230 PFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQ 269
           PF GSGT+  VA++L R ++  +  + Y + A +RI   +
Sbjct: 253 PFSGSGTTAVVAEQLGRKWLACDTNRQYNEWAIERIQKAE 292


>gi|126464051|ref|YP_001045164.1| DNA methylase N-4/N-6 domain-containing protein [Rhodobacter
           sphaeroides ATCC 17029]
 gi|126105862|gb|ABN78392.1| DNA methylase N-4/N-6 domain protein [Rhodobacter sphaeroides ATCC
           17029]
          Length = 253

 Score =  109 bits (273), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 85/267 (31%), Positives = 123/267 (46%), Gaps = 54/267 (20%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           I+ G+ ++ +  LP  SVD +  DPPY     GQ   P           WD+F       
Sbjct: 7   ILPGDCLASMRTLPDCSVDAVVTDPPY-----GQTSLP-----------WDRF------- 43

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTM-LQNLNFWIL-NDIVWRKSNPMPNF 140
                W+    R+LKP G++WV G+     R+ T   +  + W L  DIVW K N   +F
Sbjct: 44  --VYGWMPEIARILKPTGSVWVFGT----LRMFTQHWREFDGWTLAQDIVWEKHN-GSSF 96

Query: 141 RGRRFQNAHETLI------WASPSPKAKGYTFNYDALKA--ANEDVQM----RSDWLIPI 188
              RF+  HE         WAS   K K  T +  A  A      V M    R  ++   
Sbjct: 97  HADRFRRVHEQAAHFYRGDWASVY-KGKVVTMDATAKTARRKTRPVHMGQIERGSYVSE- 154

Query: 189 CSGSERL-------RNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVA 241
             G  RL       R++ G  +HPTQKP A++  +++++  PG ++LDPF GSGT+G VA
Sbjct: 155 -DGGPRLMRSVIYARSEHGHAVHPTQKPAAIIEPLILNACPPGGVVLDPFAGSGTTGGVA 213

Query: 242 KKLRRSFIGIEMKQDYIDIATKRIASV 268
            +L R  I  E   DY+    +RI+ +
Sbjct: 214 ARLGRRAILCEGNPDYLSAMERRISGI 240


>gi|126175812|ref|YP_001051961.1| DNA methylase N-4/N-6 domain-containing protein [Shewanella baltica
           OS155]
 gi|125999017|gb|ABN63092.1| DNA methylase N-4/N-6 domain protein [Shewanella baltica OS155]
          Length = 296

 Score =  109 bits (272), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 83/296 (28%), Positives = 134/296 (45%), Gaps = 57/296 (19%)

Query: 18  EWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSS 77
           E  +KI  G+S++ L+ LP  S+D I   PPY  Q        D+ +   + +     S 
Sbjct: 5   ELANKIFTGDSLASLKALPKNSIDCIVTSPPYYGQR-------DYGMDGQIGNE----SK 53

Query: 78  FEAYDAFTRAWLLACRRVLKPNGTLWV-IGSYHNI-------FRIGTMLQNLNFWILNDI 129
            E Y          C+RVLK +G+LW+ +G  +N        +R+   LQ+  + + NDI
Sbjct: 54  LEEYIENLVNIFNECKRVLKDSGSLWLNLGDKYNKGNLMGMPWRVALALQDEGWILRNDI 113

Query: 130 VWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDAL----KAANEDVQMRS--D 183
           +W K N MP+    R    HE + +   + KAK Y ++ DA+    K  +ED +M+   +
Sbjct: 114 IWHKPNAMPHSAKNRLTTDHEYIFFF--TKKAKDYYYDQDAIREEHKTFSEDSKMKGGRN 171

Query: 184 WLIPICSGSERLRNKDGEKLH---------------------PTQK---------PEALL 213
                    E+ +N     LH                     P  K         PE L+
Sbjct: 172 HFGKNGGTPEKGKNSGNSNLHDGRWDQAFHPNGRNKRTVWNVPLSKFRGAHFAVFPERLI 231

Query: 214 SRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQ 269
              +++      I+LDPFFG+GT+G VA +  R ++G+E+  +Y +IA  R+ +VQ
Sbjct: 232 EPCILAGCPKNGIVLDPFFGAGTTGFVAAQQGRKYVGLELNPEYAEIAENRLKTVQ 287


>gi|60682880|ref|YP_213024.1| putative methyltransferase [Bacteroides fragilis NCTC 9343]
 gi|60494314|emb|CAH09109.1| putative DNA methylase [Bacteroides fragilis NCTC 9343]
          Length = 286

 Score =  109 bits (272), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 83/260 (31%), Positives = 129/260 (49%), Gaps = 33/260 (12%)

Query: 22  KIIKGNSISVLE-KLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           KII G++I  L+ ++   SVDLIFADPPYN+  N                  DK+ + + 
Sbjct: 10  KIIHGDAIEALKNEIEDNSVDLIFADPPYNIGKN-------------FAGCIDKWETDDK 56

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           Y ++   WL  C R LKP+G  +V+ S   +      L+     IL+ ++W   +     
Sbjct: 57  YLSWCYQWLDLCIRKLKPSGAFYVMTSTQFMPFFDLYLRE-KLTILSRLIWYYDSSGVQA 115

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDAL------KAANEDVQMRSDWLIPICSGS-- 192
           +   F + +E +++         YTFN +A+       A    +  R +   P  +    
Sbjct: 116 KNY-FGSMYEPILFCVKD--KNNYTFNSEAILVEAKTGAKRGLIDYRKNPPQPYSTEKVP 172

Query: 193 ------ERLRNK-DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLR 245
                  R+R + D  + HPTQKP ALL RI+ +S+  GD+ILDPF G+ T+  VAK L 
Sbjct: 173 GNVWEFARVRYRMDEYENHPTQKPVALLERIIKASSNEGDLILDPFSGTFTTAFVAKTLN 232

Query: 246 RSFIGIEMKQDYIDIATKRI 265
           R  IGIE+++DY+ I  +R+
Sbjct: 233 RRAIGIELQEDYVKIGLRRL 252


>gi|119511116|ref|ZP_01630234.1| type IIS restriction enzyme M1 protein (mod) [Nodularia spumigena
           CCY9414]
 gi|119464211|gb|EAW45130.1| type IIS restriction enzyme M1 protein (mod) [Nodularia spumigena
           CCY9414]
          Length = 293

 Score =  109 bits (272), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 85/300 (28%), Positives = 137/300 (45%), Gaps = 56/300 (18%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           K+ +GNSI  L  L ++S+DL+FADPPYN++                   WD F + E Y
Sbjct: 18  KLYQGNSIDWLTSLESESIDLVFADPPYNIK----------------KAEWDNFENQEKY 61

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFR 141
             ++  W+    R+LK  G+L++ G +  I        +  F     ++W   N   N  
Sbjct: 62  IEWSIQWISQASRILKSTGSLYICG-FSEILADLKHPASKYFKSCRWLIWHYKNKA-NL- 118

Query: 142 GRRFQNAHETLIWASPSPKAK-----------GYTFNYDALKAANEDV------QMRSDW 184
           G  +  +HE++I    S   K            +T  Y +   A          +  ++W
Sbjct: 119 GNDWGRSHESIIHFRKSDSVKLNIDDVRIPYGAHTLKYPSHPQAETSAYGKGTKKKHNNW 178

Query: 185 L-------------IPI-CSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDP 230
                         IP  C+G       D +  HPTQKPE L+ + +++S++ GD+I+DP
Sbjct: 179 TPNPKGAKPKDVIEIPTTCNGM------DEKTPHPTQKPEELIRKFVLASSQEGDLIIDP 232

Query: 231 FFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRTEPRVAF 290
           F GSGT+  VA++L R ++G ++  +Y   ATKRI +V+ +   E      K  E RV+ 
Sbjct: 233 FSGSGTTVVVAEQLNRYWMGCDLNIEYNYWATKRIENVRRMTKEEWLAFDRKNAERRVSI 292


>gi|269838385|ref|YP_003320613.1| DNA methylase N-4/N-6 domain-containing protein [Sphaerobacter
           thermophilus DSM 20745]
 gi|269787648|gb|ACZ39791.1| DNA methylase N-4/N-6 domain protein [Sphaerobacter thermophilus
           DSM 20745]
          Length = 307

 Score =  109 bits (272), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 84/283 (29%), Positives = 135/283 (47%), Gaps = 46/283 (16%)

Query: 18  EWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYR------PDHSLVDAVTDS 71
           E+ D I+  ++++VL  LP   V LI+ DPP+N      L R      PD   V     +
Sbjct: 7   EYVDTIVYSDNLAVLRTLPDGCVPLIYIDPPFNTGKTRSLTRLRTTRDPDGDRVGFQGQT 66

Query: 72  W-------DKFSS-FEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNL-- 121
           +        +F+  F+ Y AF    L+  RRVL PNGTL+V      +  +  +L  +  
Sbjct: 67  YRTLRLGTTRFADVFDDYLAFLEPRLVEARRVLAPNGTLYVHLDPREVHYVKVLLDGIFG 126

Query: 122 NFWILNDIVWRKSNPMPNFRGR---RFQNAHETLIWASPSPKAKGYTFNYDAL------- 171
               LN+I+W       +F GR   R+   H+ ++    SP+   Y FN DA+       
Sbjct: 127 RECFLNEIIWAY-----DFGGRSTRRWPAKHDNILVYVASPR--DYVFNVDAIDRIPYMA 179

Query: 172 -------KAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPG 224
                  KAA   +   + W   + +   + R + G   +PTQKP  +L RI+ +S+ PG
Sbjct: 180 PGLVGPEKAARGKLPTDTWWATIVPT---KARERTG---YPTQKPLTILRRIIAASSNPG 233

Query: 225 DIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIAS 267
           D++LD F GSGT+G  A++L R F+ ++   + + +  +R A 
Sbjct: 234 DLVLDFFAGSGTTGVAARELGRRFLLVDNNPEALQVMARRFAG 276


>gi|254185002|ref|ZP_04891591.1| DNA modification methylase RsrI [Burkholderia pseudomallei 1655]
 gi|184215594|gb|EDU12575.1| DNA modification methylase RsrI [Burkholderia pseudomallei 1655]
          Length = 282

 Score =  108 bits (271), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 80/249 (32%), Positives = 125/249 (50%), Gaps = 33/249 (13%)

Query: 35  LPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRR 94
           LP  S+DLI A PPY L   G+ Y  D           DK S  E + A+TR WL     
Sbjct: 43  LPDASIDLIVAGPPYGL---GKDYGNDS----------DKRSGDE-HLAWTREWLELAVP 88

Query: 95  VLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIW 154
            LK  G+++V  ++     I + L+     ++N+I+W +  P      RRF + H+ + +
Sbjct: 89  KLKSTGSMYVFCTWQYAPEIFSFLKT-KLTMVNEIIWDRRVPSMGGTTRRFTSVHDNIGF 147

Query: 155 ASPSPKAKGYTFNYDAL---------KAANEDVQMRSDWLIPICSGSE-----RLRNKDG 200
            + S   KGY F+ D +         KA +  +   S WL    +  +     RL  +  
Sbjct: 148 FAVS---KGYYFDLDPVRIPYDADTKKARSRKLFEGSKWLELGYNPKDVWSVSRLHRQHA 204

Query: 201 EKL-HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYID 259
           E++ HPTQKP  ++ R++++S  PG  +LDPF GSGT+     + RR F+G E+ + Y  
Sbjct: 205 ERVDHPTQKPLEIIERMVLASCPPGGRVLDPFMGSGTTAVACARQRRGFVGYEINESYCA 264

Query: 260 IATKRIASV 268
           IA +R+AS+
Sbjct: 265 IARERVASL 273


>gi|15645979|ref|NP_208159.1| type IIS restriction enzyme M1 protein (mod) [Helicobacter pylori
           26695]
 gi|2314538|gb|AAD08411.1| type IIS restriction enzyme M1 protein (mod) [Helicobacter pylori
           26695]
          Length = 260

 Score =  108 bits (271), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 77/263 (29%), Positives = 123/263 (46%), Gaps = 44/263 (16%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           +KI   +  + L+KL  KSVDL   DPPYNL++                 SWD F + E 
Sbjct: 4   NKIYIEDVFTFLDKLEDKSVDLAIIDPPYNLKIA----------------SWDSFKNDEE 47

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           +  F+ AW+      LK  G+ ++  +  N       L +     LN I W K +   N 
Sbjct: 48  FLTFSYAWIDKMLPKLKDTGSFYIFNTPFNCALFLAYLHHKKVHFLNFITWVKKDGFANA 107

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQ----------MRSD------- 183
           + +R+ +A E++++ S     K YTFN D ++ A E  +          ++++       
Sbjct: 108 K-KRYNHAQESILFYSMH--KKNYTFNADEIRIAYESAERIKHAQSKGILKNNKRWFPNP 164

Query: 184 --------WLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSG 235
                   W I      E+ + K  +  HP+ KP+AL+ R++ +S+   D+ILD F GSG
Sbjct: 165 KGKLCLDVWEITSQRHVEKEKGKILKPKHPSIKPKALIERMIKASSHKNDLILDLFSGSG 224

Query: 236 TSGAVAKKLRRSFIGIEMKQDYI 258
            +  VAK L R+FIG E   +Y+
Sbjct: 225 MTSLVAKSLERNFIGCESHAEYV 247


>gi|219849124|ref|YP_002463557.1| DNA methylase N-4/N-6 domain-containing protein [Chloroflexus
           aggregans DSM 9485]
 gi|219543383|gb|ACL25121.1| DNA methylase N-4/N-6 domain protein [Chloroflexus aggregans DSM
           9485]
          Length = 304

 Score =  108 bits (270), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 87/302 (28%), Positives = 141/302 (46%), Gaps = 58/302 (19%)

Query: 1   MSQKNSLAINENQNSIF--EWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLY 58
           M   N   I+ N  ++F      +I  G++I+ L  L  +SVD+IFADPPYN++      
Sbjct: 6   MFDSNESQIDPNTPTLFYSHPHGEIWVGDAIAWLRSLETESVDMIFADPPYNIK------ 59

Query: 59  RPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTML 118
                        WD F S E Y  ++  W+    RVLKP+GTL++ G    I  +    
Sbjct: 60  ----------KAEWDTFESQEEYVEWSLLWIREAARVLKPSGTLYICGFSEIIADLKLPA 109

Query: 119 QNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDV 178
             L F     ++W   N   N  G  +  +HE+++      K+K +TFN D ++    + 
Sbjct: 110 SRL-FKGCRWLIWHYKNKA-NL-GSDWGRSHESILHFR---KSKNFTFNIDDVRIPYGNH 163

Query: 179 QMR--------------------SDW-----------LIPICSGSERLRNKDGEKLHPTQ 207
            ++                    + W           +I I +    +  K     HPTQ
Sbjct: 164 TLKYPEHPQAETSQYGKGNGRKNTIWQPHPRGAKPRDVIEIPTTCNGMHEKTP---HPTQ 220

Query: 208 KPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIAS 267
           KPE LL +++++S+  GD+I+DPF GSGT+  VA++LRR++ G ++  +Y   A +RI  
Sbjct: 221 KPEELLRKLVLASSNVGDLIVDPFLGSGTTAVVAEQLRRNWKGCDISLEYCRWAVRRIEL 280

Query: 268 VQ 269
           V+
Sbjct: 281 VE 282


>gi|240047330|ref|YP_002960718.1| Modification methylase HpaI [Mycoplasma conjunctivae HRC/581]
 gi|239984902|emb|CAT04895.1| Modification methylase HpaI [Mycoplasma conjunctivae]
          Length = 299

 Score =  108 bits (270), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 77/251 (30%), Positives = 126/251 (50%), Gaps = 23/251 (9%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           KII GN+I  L+K+ +KS++LI  DPPYNL  +               ++ D    FE Y
Sbjct: 6   KIICGNAIEELKKIESKSINLIVTDPPYNLNKD-------------YGNNKDNLK-FEEY 51

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQ-NLNFWILNDIVWRKSNPMPNF 140
             F+R WL   +R+LK +GT+++      I  I ++L+  LN    + I W  +  +   
Sbjct: 52  LEFSRQWLTEAKRILKDDGTIYIFMGTRYISYIYSILEKELNMHFNSWITWFYTQGIGKT 111

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQ----MRSDWLIPICSGSERLR 196
           +G  F   H+ ++  +   K+K +TFN D ++   +  +    MR      +   S    
Sbjct: 112 KG--FSPRHDDILMFTKH-KSK-FTFNLDDIRVPQKFYRSVNNMRGANPGNVWQFSHMHY 167

Query: 197 NKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQD 256
                K HPTQKPE L  R+++ S+   D +LDPF GSGT   V ++  R  IGI++ ++
Sbjct: 168 CNKNRKKHPTQKPEGLYERMILVSSNENDTVLDPFVGSGTMLRVCQQTNRRGIGIDINEE 227

Query: 257 YIDIATKRIAS 267
           Y+ +  +R+  
Sbjct: 228 YVRMCKERLEE 238


>gi|227528860|ref|ZP_03958909.1| adenine-specific methyltransferase [Lactobacillus vaginalis ATCC
           49540]
 gi|227351222|gb|EEJ41513.1| adenine-specific methyltransferase [Lactobacillus vaginalis ATCC
           49540]
          Length = 322

 Score =  108 bits (270), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 83/273 (30%), Positives = 132/273 (48%), Gaps = 55/273 (20%)

Query: 8   AINENQNSIFEWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDA 67
           A  E   S+ +  +K+I G+S  V+++LP+ S+DL   DPPYNL          +   D 
Sbjct: 27  AKKEKSFSLEQVTNKVINGDSFQVMDQLPSHSIDLALVDPPYNL----------NKKYDG 76

Query: 68  VTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILN 127
           +T    K + ++ Y   T  W+   + +LK + +++V   +     +  +L+   F I N
Sbjct: 77  MTFKQMKPAEYQQY---TEDWINKLKPLLKASASVYVFADWETSIVLAPVLEQY-FTIKN 132

Query: 128 DIVWRKSNPMPNFRGR----RFQNAHETLIWASPSP--------------------KAKG 163
            I W++       +GR     ++N+ E + + +  P                    K  G
Sbjct: 133 RITWQRE------KGRGALTNWKNSSEDIWFLTVDPHDYVFNVDQVKQRRPVVAPYKEDG 186

Query: 164 YTFNYDALKAANEDVQMRS----DWLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVS 219
           +  ++ A KA N    M S    D  IP  S  E   N D    HPTQKPE L+++++++
Sbjct: 187 HAKDWQATKAGNFRDTMPSNLWDDISIPYWSMPE---NTD----HPTQKPEKLMAKVILA 239

Query: 220 STKPGDIILDPFFGSGTSGAVAKKLRRSFIGIE 252
           S+ PGD+I DPF G+G+S   AKKL R FIGIE
Sbjct: 240 SSNPGDLIFDPFAGAGSSLVTAKKLGRHFIGIE 272


>gi|299141019|ref|ZP_07034157.1| methyltransferase [Prevotella oris C735]
 gi|298577985|gb|EFI49853.1| methyltransferase [Prevotella oris C735]
          Length = 340

 Score =  108 bits (270), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 83/290 (28%), Positives = 139/290 (47%), Gaps = 65/290 (22%)

Query: 8   AINENQNSIFEWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQ--LNGQLYRPDHSLV 65
           +I + ++ +F+  D I+ G+ +  L  +P +  +LI  DPPYNL    NG          
Sbjct: 50  SIEDLKSGLFD--DVIVHGDLLDCLGLIPDEYFNLIVIDPPYNLDKDFNG---------- 97

Query: 66  DAVTDSWDKFSSFEA--YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNF 123
                  ++FS+ ++  Y+ + R+W       L+P+G+L++ G +     +  +++    
Sbjct: 98  -------NRFSAMKSAGYEDYLRSWFGQVCDKLRPDGSLYMCGDWKCSASMQRVIEE-RL 149

Query: 124 WILNDIVWRKSNPMPNFRGRR--FQNAHETLIWASPSPKAKGYTFNYDALKAA------- 174
            ++N I W++       RG R  ++N  E + +A  +PK   Y FN DA+K         
Sbjct: 150 TVINRITWQREKG----RGARMNWKNGMEDIWFAVKNPK--DYYFNIDAVKVKRRVRAPY 203

Query: 175 -----------NEDVQMR--------SDWLIPICSGSERLRNKDGEKLHPTQKPEALLSR 215
                      +ED + R         D  +P  S  E          HPTQKPE L ++
Sbjct: 204 RIEGQPKDWEQSEDGKYRFTCPSNFWDDISVPFWSMPENTE-------HPTQKPEKLYAK 256

Query: 216 ILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRI 265
           +L++S+K GD + DPF GSGT   VA+KL R F G+E+ ++Y   A KR+
Sbjct: 257 LLLASSKSGDRVFDPFLGSGTLAVVARKLNRKFCGVEINEEYCLWAAKRL 306


>gi|281420151|ref|ZP_06251150.1| DNA (cytosine-5-)-methyltransferase [Prevotella copri DSM 18205]
 gi|281405951|gb|EFB36631.1| DNA (cytosine-5-)-methyltransferase [Prevotella copri DSM 18205]
          Length = 217

 Score =  108 bits (270), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 83/137 (60%), Gaps = 6/137 (4%)

Query: 133 KSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGS 192
           + NP PN   R F  + E +IWA   PK   Y FNYD +K  NE+ QM   W +P  +  
Sbjct: 46  EDNPPPNISCRYFTYSTEFIIWARKCPKKPHY-FNYDLMKLLNENKQMTDVWRLPAIARW 104

Query: 193 ERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIE 252
           E+ + K     HPTQKP ALL RI+++ST+ G  ILDPF GSGT+G  A    R ++GIE
Sbjct: 105 EKSQGK-----HPTQKPLALLVRIILASTRHGAWILDPFSGSGTTGIAASLTGRRYLGIE 159

Query: 253 MKQDYIDIATKRIASVQ 269
            +++Y+D++ +R   ++
Sbjct: 160 REKEYLDLSIRRRVELE 176


>gi|254421699|ref|ZP_05035417.1| DNA methylase domain protein [Synechococcus sp. PCC 7335]
 gi|196189188|gb|EDX84152.1| DNA methylase domain protein [Synechococcus sp. PCC 7335]
          Length = 330

 Score =  108 bits (269), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 82/277 (29%), Positives = 130/277 (46%), Gaps = 61/277 (22%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQ--LNGQLYRPDHSLVDAVTDSWDKFSSF 78
           D+ I  +S++ L  +P   VDL+  DPPYN Q   NG  +               K    
Sbjct: 50  DRTIHQDSLTALPLMPDSFVDLLIVDPPYNRQKDFNGSTF---------------KVMPE 94

Query: 79  EAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
             Y  +  +W+    R+LKP  ++++   + +   I  +    +F + N I W +     
Sbjct: 95  ADYQIWLASWMSQLPRLLKPTASIYMCCDWQSSNAIYQVFSR-HFQVRNRITWEREK--- 150

Query: 139 NFRG--RRFQNAHETLIWASPSPKAKGYTFNYDALK-------AANEDVQMRSDWL---- 185
             RG  R ++NA E + + + S K   YTFN +A+K          ++     DW     
Sbjct: 151 -GRGAKRNWKNASEDIWFGTMSDK---YTFNVEAVKLQRRVRAPYRDNAGKPKDWQETQQ 206

Query: 186 ----------------IPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILD 229
                           IP  S +E   N D    HPTQKPE L+++++++S+ PG+++ D
Sbjct: 207 GNFRNTYPSNLWTDISIPFWSMAE---NTD----HPTQKPEKLIAKMVLASSNPGNVVFD 259

Query: 230 PFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIA 266
           PF GSGT+  VAKKL R ++GIE ++ Y   A KR+A
Sbjct: 260 PFLGSGTTSVVAKKLGRHYVGIEQEELYACWAQKRLA 296


>gi|255066897|ref|ZP_05318752.1| DNA (cytosine-5-)-methyltransferase [Neisseria sicca ATCC 29256]
 gi|255048972|gb|EET44436.1| DNA (cytosine-5-)-methyltransferase [Neisseria sicca ATCC 29256]
          Length = 285

 Score =  108 bits (269), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 81/265 (30%), Positives = 131/265 (49%), Gaps = 42/265 (15%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           KI   + +  L  +   SVDLIFADPPYN+      ++          DSW    + + Y
Sbjct: 10  KIYLADCLDALNDIQDNSVDLIFADPPYNIGKKFSQFK----------DSW---KTEKEY 56

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFR 141
             +   WL  C   LK NG+L+V+ S  ++  I   L+     IL+ I+W   +     +
Sbjct: 57  IEWCYKWLSLCLNKLKDNGSLYVMASTQSMPYIDIWLRE-RMTILSRIIWHYDSSGVQAK 115

Query: 142 GRRFQNAHETLIWASPSPKAKGYTFNYDALK------AANEDVQMRSD------------ 183
            + + + +E +++A  + K+  YTFN   ++      A  + +  R +            
Sbjct: 116 -KYYGSLYEPILFAVKNNKS--YTFNSSDIEIEAKTGAKRKLIDYRKEIPTPYKTTKVPG 172

Query: 184 --WLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVA 241
             W  P      R R ++ E  HP+QKPEALL RI+ +ST  GD++LDPF G+ ++ AVA
Sbjct: 173 NTWYFPRV----RYRMEEYEN-HPSQKPEALLERIIRASTNEGDLVLDPFGGTFSTSAVA 227

Query: 242 KKLRRSFIGIEMKQDYIDIATKRIA 266
           +KL R  I IE +++Y+ I  +R+ 
Sbjct: 228 QKLNRKSISIEFQEEYLKIGLRRLG 252


>gi|118576082|ref|YP_875825.1| DNA modification methylase [Cenarchaeum symbiosum A]
 gi|118194603|gb|ABK77521.1| DNA modification methylase [Cenarchaeum symbiosum A]
          Length = 252

 Score =  108 bits (269), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 82/269 (30%), Positives = 128/269 (47%), Gaps = 51/269 (18%)

Query: 27  NSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTR 86
           + I  LE +  K+VDL   DPPYNL++                D WD F S E +  FT 
Sbjct: 2   DCIRFLEGIGDKTVDLAVVDPPYNLKV----------------DKWDTFESQEDFLKFTF 45

Query: 87  AWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNL---NFWILNDIVWRKSNPMPNFRGR 143
           AW+      LK    L+V   ++  F    MLQ+L        N I W K + M ++  +
Sbjct: 46  AWMDCLVPKLKETAGLYV---FNTPFNSAYMLQHLVEQGLMFQNWITWDKRDGM-SYTKK 101

Query: 144 RFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQ----MRSDWLIP------------ 187
           R+ N  ET+++ + S K   YTFN+D ++   E VQ     ++  ++             
Sbjct: 102 RYANGQETILFFTKSGK---YTFNHDDIRVPYESVQRIEHAKTRGILKNGKRWYPNSRGR 158

Query: 188 ICS-----GSERLRNKDGEKL----HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSG 238
           +C       SER + K   K+    H T KP  ++ RI+ +S+  GD+++D F GSGT+ 
Sbjct: 159 MCGEIWHMSSERHKVKVNGKVQRLPHKTVKPLDMIKRIITASSNEGDLVIDCFAGSGTTA 218

Query: 239 AVAKKLRRSFIGIEMKQDYIDIATKRIAS 267
              K+L R+FIG +  + Y+  A +RI +
Sbjct: 219 LACKQLNRNFIGCDSNEQYVLSARRRIRT 247


>gi|167583952|ref|ZP_02376340.1| DNA methylase N-4/N-6 domain protein [Burkholderia ubonensis Bu]
          Length = 283

 Score =  108 bits (269), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 79/251 (31%), Positives = 126/251 (50%), Gaps = 33/251 (13%)

Query: 34  KLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACR 93
           +LP  S+DLI ADPPY L   G+ Y  D           DK S  + + A+T AWL    
Sbjct: 46  RLPDASIDLIVADPPYGL---GKDYGNDS----------DKRSG-DDHLAWTLAWLELAI 91

Query: 94  RVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLI 153
             LKP G+++V  ++     I + L+     ++N+I+W +  P      RRF + H+ + 
Sbjct: 92  PKLKPTGSMYVFCTWQYAPEIFSFLKT-KLTMINEIIWDRRVPSMGGTTRRFTSVHDNIG 150

Query: 154 WASPSPKAKGYTFNYDAL---------KAANEDVQMRSDWLIPICSGSE-----RLRNKD 199
           + + S   K Y F+ D +         KA +  +   S WL    +  +     RL  + 
Sbjct: 151 FFAVS---KAYYFDLDPVRIPYDADTKKARSRKLFEGSKWLEMGYNPKDVWSVSRLHRQH 207

Query: 200 GEKL-HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYI 258
            E++ HPTQKP  ++ R++++S  PG  +LDPF GSGT+     +  R F+G E+ + Y 
Sbjct: 208 AERVDHPTQKPLEIIERMVLASCPPGGRVLDPFMGSGTTAVACARQGRDFVGYEINESYC 267

Query: 259 DIATKRIASVQ 269
            IA +RIA++ 
Sbjct: 268 AIAHERIAALD 278


>gi|317013155|gb|ADU83763.1| type IIS restriction enzyme M1 protein (mod) [Helicobacter pylori
           Lithuania75]
          Length = 258

 Score =  108 bits (269), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 77/263 (29%), Positives = 124/263 (47%), Gaps = 44/263 (16%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           +KI   +  + L+KL  KSVDL   DPPYNL++                 SWD F + E 
Sbjct: 4   NKIYIEDVFTFLDKLEDKSVDLAIIDPPYNLKIA----------------SWDSFKNDEE 47

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           +  F+ AW+      LK  G+ ++  +  N       L++     LN I W K +   N 
Sbjct: 48  FLTFSYAWIDKMLPKLKDTGSFYIFNTPFNCALFLAYLRHKKAHFLNFITWVKKDGFANA 107

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQ----------MRSD------- 183
           + +R+ +A E++++ S     K YTFN D ++ A E  +          ++++       
Sbjct: 108 K-KRYNHAQESILFYSMH--KKNYTFNADEVRIAYESTERIKHAQSKGILKNNKRWFPNP 164

Query: 184 --------WLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSG 235
                   W I      E+ + K  +  HP+ KP+AL+ R++ +S+   D+ILD F GSG
Sbjct: 165 KGKLCLDVWEITSQRHVEKEKGKILKPKHPSIKPKALIERMIKASSHKNDLILDLFSGSG 224

Query: 236 TSGAVAKKLRRSFIGIEMKQDYI 258
            +  VAK L R+FIG E   +Y+
Sbjct: 225 MTSLVAKSLERNFIGCESHAEYV 247


>gi|134293157|ref|YP_001116893.1| DNA methylase N-4/N-6 domain-containing protein [Burkholderia
           vietnamiensis G4]
 gi|134136314|gb|ABO57428.1| DNA methylase N-4/N-6 domain protein [Burkholderia vietnamiensis
           G4]
          Length = 283

 Score =  108 bits (269), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 77/250 (30%), Positives = 127/250 (50%), Gaps = 33/250 (13%)

Query: 34  KLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACR 93
           +LP  S+DLI ADPPY L   G+ Y  D           DK S  +A+ A+TR WL    
Sbjct: 46  RLPDASIDLIVADPPYGL---GKDYGNDS----------DKRSG-DAFLAWTREWLDLAI 91

Query: 94  RVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLI 153
             LKP+G++++  ++     I + L+     ++N+I+W +  P      RRF + H+ + 
Sbjct: 92  PKLKPSGSMYIFCTWQYAPEIFSFLKT-KLTMVNEIIWDRRVPSMGGTTRRFTSVHDNIG 150

Query: 154 WASPSPKAKGYTFNYDAL---------KAANEDVQMRSDWLIPICSGSE-----RLRNKD 199
           + + S   K Y F+ D +         KA +  +   S WL    +  +     RL  + 
Sbjct: 151 FFAVS---KAYYFDLDPVRIPYDADTKKARSRKLFEGSKWLEMGYNPKDVWSVSRLHRQH 207

Query: 200 GEKL-HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYI 258
            E++ HPTQKP  ++ R++++S  PG  +LDPF GSGT+     +  R F+G E+ + Y 
Sbjct: 208 AERVDHPTQKPLEIIERMVLASCPPGGRVLDPFMGSGTTAVACARQGRDFVGYEINESYC 267

Query: 259 DIATKRIASV 268
            IA +R+ ++
Sbjct: 268 AIAHERVNAL 277


>gi|281424234|ref|ZP_06255147.1| putative DNA-methyltransferase protein [Prevotella oris F0302]
 gi|281401503|gb|EFB32334.1| putative DNA-methyltransferase protein [Prevotella oris F0302]
          Length = 337

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 83/290 (28%), Positives = 138/290 (47%), Gaps = 65/290 (22%)

Query: 8   AINENQNSIFEWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQ--LNGQLYRPDHSLV 65
           +I + ++ +F+  D I+ G+ +  L  +P +  +LI  DPPYNL    NG          
Sbjct: 47  SIEDLKSGLFD--DVIVHGDLLDCLGLIPDEYFNLIVIDPPYNLDKDFNG---------- 94

Query: 66  DAVTDSWDKFSSFEA--YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNF 123
                  ++FS+ ++  Y+ + R+W       L+P+G L++ G +     +  +++    
Sbjct: 95  -------NRFSAMKSAGYEDYLRSWFGQVCDKLRPDGALYMCGDWKCSASMQRVIEE-RL 146

Query: 124 WILNDIVWRKSNPMPNFRGRR--FQNAHETLIWASPSPKAKGYTFNYDALKAA------- 174
            ++N I W++       RG R  ++N  E + +A  +PK   Y FN DA+K         
Sbjct: 147 TVINRITWQREKG----RGARMNWKNGMEDIWFAVKNPK--DYYFNIDAVKVKRRVRAPY 200

Query: 175 -----------NEDVQMR--------SDWLIPICSGSERLRNKDGEKLHPTQKPEALLSR 215
                      +ED + R         D  +P  S  E          HPTQKPE L ++
Sbjct: 201 RIEGQPKDWEQSEDGKYRFTCPSNFWDDISVPFWSMPENTE-------HPTQKPEKLYAK 253

Query: 216 ILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRI 265
           +L++S+K GD + DPF GSGT   VA+KL R F G+E+ ++Y   A KR+
Sbjct: 254 LLLASSKSGDRVFDPFLGSGTLAVVARKLNRKFCGVEINKEYCLWAAKRL 303


>gi|221196942|ref|ZP_03569989.1| DNA modification methylase RsrI [Burkholderia multivorans CGD2M]
 gi|221203612|ref|ZP_03576631.1| DNA modification methylase RsrI [Burkholderia multivorans CGD2]
 gi|221177546|gb|EEE09974.1| DNA modification methylase RsrI [Burkholderia multivorans CGD2]
 gi|221183496|gb|EEE15896.1| DNA modification methylase RsrI [Burkholderia multivorans CGD2M]
          Length = 283

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 77/250 (30%), Positives = 126/250 (50%), Gaps = 33/250 (13%)

Query: 34  KLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACR 93
           +LP  S+DLI ADPPY L   G+ Y  D           DK S  +A+  +TR WL    
Sbjct: 46  RLPDASIDLIVADPPYGL---GKDYGNDS----------DKRSG-DAFLGWTREWLELAI 91

Query: 94  RVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLI 153
             LKP+G+++V  ++     I + L+     ++N+I+W +  P      RRF + H+ + 
Sbjct: 92  PKLKPSGSMYVFCTWQYAPEIFSFLKT-KLTMINEIIWDRRVPSMGGTTRRFTSVHDNIG 150

Query: 154 WASPSPKAKGYTFNYDAL---------KAANEDVQMRSDWLIPICSGSE-----RLRNKD 199
           + + S   K Y F+ D +         KA +  +   S WL    +  +     RL  + 
Sbjct: 151 FFAVS---KAYYFDLDPVRIPYDADTKKARSRKLFEGSKWLEMGYNPKDVWSVSRLHRQH 207

Query: 200 GEKL-HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYI 258
            E++ HPTQKP  ++ R++++S  PG  +LDPF GSGT+     +  R F+G E+ + Y 
Sbjct: 208 AERVDHPTQKPLEIIERMVLASCPPGGRVLDPFMGSGTTAVACARQGRDFVGYEINESYC 267

Query: 259 DIATKRIASV 268
            IA +R+ ++
Sbjct: 268 AIARERVHAL 277


>gi|207109001|ref|ZP_03243163.1| adenine specific DNA methyltransferase (dpnA) [Helicobacter pylori
           HPKX_438_CA4C1]
          Length = 175

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 67/178 (37%), Positives = 93/178 (52%), Gaps = 13/178 (7%)

Query: 88  WLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQN 147
           W+     ++ PNG + +  SY  I  I   L+   F + + I W K+NPMP    RR+  
Sbjct: 8   WIKHYAPLVNPNGCMIIFCSYRFISYIADFLEENGFVVKDFIQWVKTNPMPRNIHRRYVQ 67

Query: 148 AHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQ 207
             E  +WA    KAK + FN    K  NE          P+ SG E+++       HPTQ
Sbjct: 68  DTEFALWAVKK-KAK-WVFN----KPKNEKYLRPLILKSPVVSGLEKVK-------HPTQ 114

Query: 208 KPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRI 265
           K  AL+ +I+   T P DI+LDPF GSGT+G   K L R+FIGIE +++Y   A KR+
Sbjct: 115 KSLALMEKIISIHTNPNDIVLDPFMGSGTTGLACKNLERNFIGIESEKEYFQTAKKRL 172


>gi|315586029|gb|ADU40410.1| site-specific DNA-methyltransferase (adenine-specific)
           [Helicobacter pylori 35A]
          Length = 260

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 80/264 (30%), Positives = 123/264 (46%), Gaps = 46/264 (17%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           +KI   +  + L+KL  KSVDL   DPPYNL++                 SWD F + E 
Sbjct: 4   NKIYIEDVFTFLDKLEDKSVDLAIIDPPYNLKIA----------------SWDSFKNDEE 47

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           +  F+ AW+      LK  G+ ++  +  N       L++     LN I W K +   N 
Sbjct: 48  FLTFSYAWIDKMLPKLKDTGSFYIFNTPFNCALFLAYLRHKKVHFLNFITWVKKDGFANA 107

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQM------------RSDWLIPI 188
           + +R+ +A E++++ S     K YTFN D ++ A E  +                W  P 
Sbjct: 108 K-KRYNHAQESILFYSMH--KKNYTFNADEIRTAYESTERIKHAQSKGILKNNKRWF-PN 163

Query: 189 CSG----------SERLRNKDGEKL----HPTQKPEALLSRILVSSTKPGDIILDPFFGS 234
             G          S+R   K+  K+    HP+ KP+AL+ R++ +S+   D+ILD F GS
Sbjct: 164 PKGKLCLDVWEITSQRHVEKENGKILKPKHPSIKPKALIERMIKASSHKNDLILDLFSGS 223

Query: 235 GTSGAVAKKLRRSFIGIEMKQDYI 258
           G +  VAK L R+FIG E   +Y+
Sbjct: 224 GMTSLVAKSLGRNFIGCETHAEYV 247


>gi|317010047|gb|ADU80627.1| type IIS restriction enzyme M1 protein (mod) [Helicobacter pylori
           India7]
          Length = 260

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 78/263 (29%), Positives = 123/263 (46%), Gaps = 44/263 (16%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           +KI   +  + L+KL  KSVDL   DPPYNL++                 SWD F + E 
Sbjct: 4   NKIYIEDVFTFLDKLEDKSVDLAIIDPPYNLKIA----------------SWDSFKNDEE 47

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           +  F+ AW+      +K  G+ ++  +  N       L++     LN I W K +   N 
Sbjct: 48  FLTFSYAWIDKVLPKIKDTGSFYIFNTPFNCALFLAYLRHKKVHFLNFITWVKKDGFANA 107

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQM------------RSDWLI-- 186
           + +R+ +A E++++ S     K YTFN D ++ A E  +                W    
Sbjct: 108 K-KRYNHAQESILFYSMH--KKNYTFNADEIRIAYESTERIKHAQSKGILKNNKRWFPNP 164

Query: 187 --PIC-----SGSERLRNKDGEKL----HPTQKPEALLSRILVSSTKPGDIILDPFFGSG 235
              +C       S+R   K+  K+    HP+ KP+AL+ R++ +S+   D+ILD F GSG
Sbjct: 165 KGKLCLDVWEIASQRHVEKENGKILKPKHPSIKPKALIERMIKASSHKNDLILDLFSGSG 224

Query: 236 TSGAVAKKLRRSFIGIEMKQDYI 258
            +  VAK L R+FIG E   +Y+
Sbjct: 225 MTSLVAKSLERNFIGCESHAEYV 247


>gi|291165802|gb|EFE27850.1| DNA (cytosine-5-)-methyltransferase [Filifactor alocis ATCC 35896]
          Length = 310

 Score =  107 bits (268), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 81/277 (29%), Positives = 130/277 (46%), Gaps = 64/277 (23%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQ--LNGQLYRPDHSLVDAVTDSWDKFSSF 78
           DK I G++   +  LP   VDL+  DPPYNL    NG+ ++    L D  TD        
Sbjct: 37  DKTILGDTFDTIPYLPKNFVDLLIVDPPYNLDKNFNGKQFK---QLND--TD-------- 83

Query: 79  EAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
             Y+ +T+ W+     +LK   +++V   + +   IG +L+   F++ N I W++     
Sbjct: 84  --YEEYTKQWIQKVIPLLKDTASVYVCCDWKSSLIIGNILKQY-FFLQNRITWQRE---- 136

Query: 139 NFRGR----RFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSE- 193
             +GR     ++N  E + +A+   K+K +TF+        EDV++R   L P     + 
Sbjct: 137 --KGRGAMSNWKNGMEDIWFAT---KSKNFTFHV-------EDVKIRRKVLAPYRKNGKP 184

Query: 194 ---------RLRNKDGEKL----------------HPTQKPEALLSRILVSSTKPGDIIL 228
                    + RN                      HPTQKPE LL++++++S+  GD++ 
Sbjct: 185 KDWEETENGKFRNTYPSNFWDDISIPYWSMSENTAHPTQKPEKLLAKLILASSNRGDVVF 244

Query: 229 DPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRI 265
           DPF GSG++   AKKL R F+GIE    Y     KR+
Sbjct: 245 DPFLGSGSTSVTAKKLNRHFVGIEQNPQYCIWTEKRL 281


>gi|161521164|ref|YP_001584591.1| DNA methylase N-4/N-6 domain-containing protein [Burkholderia
           multivorans ATCC 17616]
 gi|189352659|ref|YP_001948286.1| putative adenine-specific DNA-methyltransferase [Burkholderia
           multivorans ATCC 17616]
 gi|221212473|ref|ZP_03585450.1| DNA modification methylase RsrI [Burkholderia multivorans CGD1]
 gi|28971665|dbj|BAC65265.1| probable DNA-methyltransferasee [Burkholderia multivorans]
 gi|160345214|gb|ABX18299.1| DNA methylase N-4/N-6 domain protein [Burkholderia multivorans ATCC
           17616]
 gi|189336681|dbj|BAG45750.1| putative adenine-specific DNA-methyltransferase [Burkholderia
           multivorans ATCC 17616]
 gi|221167572|gb|EEE00042.1| DNA modification methylase RsrI [Burkholderia multivorans CGD1]
          Length = 283

 Score =  107 bits (267), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 77/250 (30%), Positives = 126/250 (50%), Gaps = 33/250 (13%)

Query: 34  KLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACR 93
           +LP  S+DLI ADPPY L   G+ Y  D           DK S  +A+  +TR WL    
Sbjct: 46  RLPDASIDLIVADPPYGL---GKDYGNDS----------DKRSG-DAFLEWTREWLELAI 91

Query: 94  RVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLI 153
             LKP+G+++V  ++     I + L+     ++N+I+W +  P      RRF + H+ + 
Sbjct: 92  PKLKPSGSMYVFCTWQYAPEIFSFLKT-KLTMINEIIWDRRVPSMGGTTRRFTSVHDNIG 150

Query: 154 WASPSPKAKGYTFNYDAL---------KAANEDVQMRSDWLIPICSGSE-----RLRNKD 199
           + + S   K Y F+ D +         KA +  +   S WL    +  +     RL  + 
Sbjct: 151 FFAVS---KAYYFDLDPVRIPYDADTKKARSRKLFEGSKWLEMGYNPKDVWSVSRLHRQH 207

Query: 200 GEKL-HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYI 258
            E++ HPTQKP  ++ R++++S  PG  +LDPF GSGT+     +  R F+G E+ + Y 
Sbjct: 208 AERVDHPTQKPLEIIERMVLASCPPGGRVLDPFMGSGTTAVACARQGRDFVGYEINESYC 267

Query: 259 DIATKRIASV 268
            IA +R+ ++
Sbjct: 268 AIARERVHAL 277


>gi|238024260|ref|YP_002908492.1| DNA modification methylase [Burkholderia glumae BGR1]
 gi|237878925|gb|ACR31257.1| DNA modification methylase [Burkholderia glumae BGR1]
          Length = 282

 Score =  107 bits (267), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 78/246 (31%), Positives = 123/246 (50%), Gaps = 33/246 (13%)

Query: 35  LPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRR 94
           LP  S+DLI ADPPY L   G+ Y  D           DK    +A+ A+TR WL     
Sbjct: 46  LPDASIDLIVADPPYGL---GKDYGNDS----------DKLQG-DAHLAWTRQWLELAIP 91

Query: 95  VLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIW 154
            LK +G+L+V  ++     I + L+     ++N+I+W +  P      RR+ + H+ + +
Sbjct: 92  KLKASGSLYVFCTWQYAPEIFSFLKT-RLTMVNEIIWDRRVPSMGGTTRRYTSVHDNIGF 150

Query: 155 ASPSPKAKGYTFNYDAL---------KAANEDVQMRSDWLIPICSGSE-----RLRNKDG 200
            + S   K Y F+ D +         KA +  +   S WL    +  +     RL  +  
Sbjct: 151 FAVS---KSYYFDLDPVRIPYDAETKKARSRKLFEGSKWLELGYNPKDVWSISRLHRQHA 207

Query: 201 EKL-HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYID 259
           E++ HPTQKP  L+ R+++SS  PG ++LDPF GSGT+     +  R F+G E+ + Y  
Sbjct: 208 ERVDHPTQKPLELVERMVLSSCPPGGVVLDPFMGSGTTAVACARHGRGFVGYEINESYCA 267

Query: 260 IATKRI 265
           IA +R+
Sbjct: 268 IARERV 273


>gi|227544742|ref|ZP_03974791.1| adenine-specific methyltransferase [Lactobacillus reuteri CF48-3A]
 gi|300909012|ref|ZP_07126475.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus reuteri SD2112]
 gi|227185282|gb|EEI65353.1| adenine-specific methyltransferase [Lactobacillus reuteri CF48-3A]
 gi|300894419|gb|EFK87777.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus reuteri SD2112]
          Length = 319

 Score =  107 bits (266), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 82/275 (29%), Positives = 127/275 (46%), Gaps = 51/275 (18%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           +KII G+S  V+ KL    VDL   DPPYNL          +   D +  S+ K S+ + 
Sbjct: 36  NKIINGDSFKVMTKLSPHQVDLALIDPPYNL----------NKQYDGL--SFKKMSTSQ- 82

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           Y A+T+ W+   + +LK N +++V   +     +  +L+  NF I N I W++     + 
Sbjct: 83  YQAYTQKWIDLLKPLLKENASIYVFSDWATSMALAPILEK-NFTIQNRITWQREKGRGSL 141

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQ------MRSDWL--------- 185
           +   ++N  E + + + +P    YTFN D +K   + V       +  DW          
Sbjct: 142 KN--WKNGMEDIWFLTANPS--DYTFNVDQVKQRRQVVAPYRQDGVAKDWQATKNGNFRD 197

Query: 186 -----------IPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGS 234
                      IP  S  E          HPTQKPE LL++I+++S+ P D I DPF GS
Sbjct: 198 TMPSNFWDDISIPYWSMPENTG-------HPTQKPEKLLAKIILASSNPNDFIFDPFAGS 250

Query: 235 GTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQ 269
           G+S   A KL R ++GIE    Y      R+  ++
Sbjct: 251 GSSLVTAAKLNRRYLGIEQSLLYCAWGQYRLNQIK 285


>gi|62422064|gb|AAX82614.1| putative adenine-specific methyltransferase [Lactobacillus reuteri]
          Length = 319

 Score =  107 bits (266), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 82/275 (29%), Positives = 127/275 (46%), Gaps = 51/275 (18%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           +KII G+S  V+ KL    VDL   DPPYNL          +   D +  S+ K S+ + 
Sbjct: 36  NKIINGDSFKVMTKLSPHQVDLALIDPPYNL----------NKQYDGL--SFKKMSTSQ- 82

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           Y A+T+ W+   + +LK N +++V   +     +  +L+  NF I N I W++     + 
Sbjct: 83  YQAYTQKWIDLLKPLLKENASIYVFSDWATSMALAPILEK-NFTIQNRITWQREKGRGSL 141

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQ------MRSDWL--------- 185
           +   ++N  E + + + +P    YTFN D +K   + V       +  DW          
Sbjct: 142 KN--WKNGMEDIWFLTANPS--DYTFNVDQVKQRRQVVAPYRQDGVAKDWQATKNGNFRD 197

Query: 186 -----------IPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGS 234
                      IP  S  E          HPTQKPE LL++I+++S+ P D I DPF GS
Sbjct: 198 TMPSNFWDDISIPYWSMPENTG-------HPTQKPEKLLAKIILASSNPNDFIFDPFAGS 250

Query: 235 GTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQ 269
           G+S   A KL R ++GIE    Y      R+  ++
Sbjct: 251 GSSLVTAAKLNRRYLGIEQSLLYCAWGQYRLNQIK 285


>gi|127465|sp|P23192|MTM2_MORBO RecName: Full=Modification methylase MboII; Short=M.MboII; AltName:
           Full=Adenine-specific methyltransferase MboII; AltName:
           Full=DNA MTase MboIIA
 gi|44181|emb|CAA40297.1| methyltransferase MboII [Moraxella bovis]
          Length = 260

 Score =  107 bits (266), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 78/266 (29%), Positives = 119/266 (44%), Gaps = 45/266 (16%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           +KI + N    L+++  KSV L   DPPYNL                    WD F S   
Sbjct: 5   NKIHQMNCFDFLDQVENKSVQLAVIDPPYNLS----------------KADWDSFDSHNE 48

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           +  FT  W+      L  +G+L++  +  N   I   L +      N I W K + M + 
Sbjct: 49  FLPFTYRWIDKVLDKLDKDGSLYIFNTPFNCAFICQYLVSKGMIFQNWITWDKRDGMGSA 108

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANED---VQMRSD-------------- 183
           + R F    ET+++ S   K+K +TFNYD ++   E    ++  S+              
Sbjct: 109 K-RGFSTGQETILFFS---KSKNHTFNYDEVRVPYESTDRIKHASEKGILKNGKRWFPNP 164

Query: 184 --------WLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSG 235
                   W        E++  K  +  H T KP  L+ RI+ +S+ P D++LD F GSG
Sbjct: 165 NGRLCGEVWHFSSQRHKEKVNGKTVKLTHITPKPRDLIERIIRASSNPNDLVLDCFMGSG 224

Query: 236 TSGAVAKKLRRSFIGIEMKQDYIDIA 261
           T+  VAKKL R+FIG +M  +Y++ A
Sbjct: 225 TTAIVAKKLGRNFIGCDMNAEYVNQA 250


>gi|170703050|ref|ZP_02893876.1| DNA methylase N-4/N-6 domain protein [Burkholderia ambifaria
           IOP40-10]
 gi|170132042|gb|EDT00544.1| DNA methylase N-4/N-6 domain protein [Burkholderia ambifaria
           IOP40-10]
          Length = 283

 Score =  107 bits (266), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 76/247 (30%), Positives = 124/247 (50%), Gaps = 33/247 (13%)

Query: 34  KLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACR 93
           +LP  S+DLI ADPPY L   G+ Y  D           DK S  + + A+TR WL    
Sbjct: 46  RLPDASIDLIVADPPYGL---GKDYGNDS----------DKRSG-DVFLAWTREWLELAI 91

Query: 94  RVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLI 153
             LKP+G++++  ++     I + L+     ++N+I+W +  P      RRF + H+ + 
Sbjct: 92  PKLKPSGSMYIFCTWQYAPEIFSFLKT-KLTMVNEIIWDRRVPSMGGTTRRFTSVHDNIG 150

Query: 154 WASPSPKAKGYTFNYDAL---------KAANEDVQMRSDWLIPICSGSE-----RLRNKD 199
           + + S   K Y F+ D +         KA +  +   S WL    +  +     RL  + 
Sbjct: 151 FFAVS---KAYYFDLDPVRIPYDADTKKARSRKLFEGSKWLEMGYNPKDVWSVSRLHRQH 207

Query: 200 GEKL-HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYI 258
            E++ HPTQKP  ++ R++++S  PG  +LDPF GSGT+     +  R F+G E+ + Y 
Sbjct: 208 AERVDHPTQKPLEIIERMVLASCPPGGRVLDPFMGSGTTAVACARQGRDFVGYEINESYC 267

Query: 259 DIATKRI 265
            IA +R+
Sbjct: 268 AIAHERV 274


>gi|107026752|ref|YP_624263.1| DNA methylase N-4/N-6 [Burkholderia cenocepacia AU 1054]
 gi|116692056|ref|YP_837589.1| DNA methylase N-4/N-6 domain-containing protein [Burkholderia
           cenocepacia HI2424]
 gi|170735951|ref|YP_001777211.1| DNA methylase N-4/N-6 domain-containing protein [Burkholderia
           cenocepacia MC0-3]
 gi|105896126|gb|ABF79290.1| DNA methylase N-4/N-6 [Burkholderia cenocepacia AU 1054]
 gi|116650056|gb|ABK10696.1| DNA methylase N-4/N-6 domain protein [Burkholderia cenocepacia
           HI2424]
 gi|169818139|gb|ACA92721.1| DNA methylase N-4/N-6 domain protein [Burkholderia cenocepacia
           MC0-3]
          Length = 283

 Score =  107 bits (266), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 76/249 (30%), Positives = 126/249 (50%), Gaps = 33/249 (13%)

Query: 35  LPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRR 94
           LP  S+DLI ADPPY L   G+ Y  D           DK S  + + A+TR WL     
Sbjct: 47  LPDASIDLIVADPPYGL---GKDYGNDS----------DKRSG-DDFLAWTRGWLELAIP 92

Query: 95  VLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIW 154
            LKP+G++++  ++     I + L+     ++N+I+W +  P      RRF + H+ + +
Sbjct: 93  KLKPSGSMYIFCTWQYAPEIFSFLKT-QLTMVNEIIWDRRVPSMGGTTRRFTSVHDNIGF 151

Query: 155 ASPSPKAKGYTFNYDAL---------KAANEDVQMRSDWLIPICSGSE-----RLRNKDG 200
            + S   K Y F+ D +         KA +  +   S WL    +  +     RL  +  
Sbjct: 152 FAVS---KAYYFDLDPVRIPYDADTKKARSRKLFEGSKWLEMGYNPKDVWSVSRLHRQHA 208

Query: 201 EKL-HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYID 259
           E++ HPTQKP  ++ R++++S  PG  +LDPF GSGT+     +  R F+G E+ + Y  
Sbjct: 209 ERVDHPTQKPLEIIERMVLASCPPGGRVLDPFMGSGTTAVACARQGRDFVGYEINESYCA 268

Query: 260 IATKRIASV 268
           IA +R++++
Sbjct: 269 IAHERVSAL 277


>gi|156743626|ref|YP_001433755.1| DNA methylase N-4/N-6 domain-containing protein [Roseiflexus
           castenholzii DSM 13941]
 gi|156234954|gb|ABU59737.1| DNA methylase N-4/N-6 domain protein [Roseiflexus castenholzii DSM
           13941]
          Length = 332

 Score =  107 bits (266), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 80/275 (29%), Positives = 131/275 (47%), Gaps = 56/275 (20%)

Query: 26  GNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFT 85
           G++I+ L  L  +SVD+IFADPPYN++                   WD F S E Y  ++
Sbjct: 61  GDTIAWLRSLETESVDMIFADPPYNIR----------------KAEWDTFESQEEYVEWS 104

Query: 86  RAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRF 145
             W+    RVLKP+GTL++ G +  I     +  +  F     ++W   N   N  G  +
Sbjct: 105 LLWIREAARVLKPDGTLYICG-FSEIIADLKLPASRFFKGCRWLIWHYKNKA-NL-GSDW 161

Query: 146 QNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMR--------------------SDW- 184
             +HE+++      K+K +TFN D ++    +  ++                    S W 
Sbjct: 162 GRSHESILHFR---KSKNFTFNIDDVRIPYGNHTLKYPEHPQAETSQYGKGNGRKNSIWQ 218

Query: 185 ----------LIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGS 234
                     +I I +    +  K     HPTQKPE LL +++++S+  GD+I+DPF GS
Sbjct: 219 PHPRGAKPRDVIEIPTTCNGMHEKTP---HPTQKPEELLRKLVLASSNVGDLIVDPFLGS 275

Query: 235 GTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQ 269
           GT+  VA++LRR++ G ++  +Y     +RI  V+
Sbjct: 276 GTTAVVAEQLRRNWKGCDISLEYCRWTVRRIELVE 310


>gi|171321986|ref|ZP_02910869.1| DNA methylase N-4/N-6 domain protein [Burkholderia ambifaria MEX-5]
 gi|171092716|gb|EDT38001.1| DNA methylase N-4/N-6 domain protein [Burkholderia ambifaria MEX-5]
          Length = 283

 Score =  107 bits (266), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 76/247 (30%), Positives = 124/247 (50%), Gaps = 33/247 (13%)

Query: 34  KLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACR 93
           +LP  S+DLI ADPPY L   G+ Y  D           DK S  + + A+TR WL    
Sbjct: 46  RLPDASIDLIVADPPYGL---GKDYGNDS----------DKRSG-DVFLAWTREWLELAI 91

Query: 94  RVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLI 153
             LKP+G++++  ++     I + L+     ++N+I+W +  P      RRF + H+ + 
Sbjct: 92  PKLKPSGSMYIFCTWQYAPEIFSFLKT-KLTMVNEIIWDRRVPSMGGTTRRFTSVHDNIG 150

Query: 154 WASPSPKAKGYTFNYDAL---------KAANEDVQMRSDWLIPICSGSE-----RLRNKD 199
           + + S   K Y F+ D +         KA +  +   S WL    +  +     RL  + 
Sbjct: 151 FFAVS---KAYYFDLDPVRIPYDADTKKARSRKLFEGSKWLEMGYNPKDVWSVSRLHRQH 207

Query: 200 GEKL-HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYI 258
            E++ HPTQKP  ++ R++++S  PG  +LDPF GSGT+     +  R F+G E+ + Y 
Sbjct: 208 AERVDHPTQKPLEIIERMVLASCPPGGRVLDPFMGSGTTAVACARQGRDFVGYEINESYC 267

Query: 259 DIATKRI 265
            IA +R+
Sbjct: 268 AIAHERV 274


>gi|268683469|ref|ZP_06150331.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Neisseria
           gonorrhoeae SK-92-679]
 gi|268623753|gb|EEZ56153.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Neisseria
           gonorrhoeae SK-92-679]
          Length = 152

 Score =  106 bits (265), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 72/123 (58%), Gaps = 1/123 (0%)

Query: 31  VLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLL 90
           +LEK P    D+IFADPPY L  +G     +  +V     +WDK     A   F   WL 
Sbjct: 31  ILEKHPNGCFDMIFADPPYFLSNDG-FSCQNGQMVSVNKGNWDKSKGMAADLEFYEEWLR 89

Query: 91  ACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHE 150
            C  +LKPNGT+WV G++HNI+ IG ++Q + + ILN+I W K NP PN   R F ++ E
Sbjct: 90  LCYALLKPNGTIWVCGTFHNIYLIGYLMQTVGYHILNNITWEKPNPPPNLSCRFFTHSTE 149

Query: 151 TLI 153
           T++
Sbjct: 150 TIL 152


>gi|240013323|ref|ZP_04720236.1| putative modification methylase DpnIIB [Neisseria gonorrhoeae
           DGI18]
 gi|240120394|ref|ZP_04733356.1| putative modification methylase DpnIIB [Neisseria gonorrhoeae
           PID24-1]
 gi|240127400|ref|ZP_04740061.1| putative modification methylase DpnIIB [Neisseria gonorrhoeae
           SK-93-1035]
 gi|268685774|ref|ZP_06152636.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-93-1035]
 gi|268626058|gb|EEZ58458.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-93-1035]
          Length = 161

 Score =  106 bits (265), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 72/123 (58%), Gaps = 1/123 (0%)

Query: 31  VLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLL 90
           +LEK P    D+IFADPPY L  +G     +  +V     +WDK     A   F   WL 
Sbjct: 40  ILEKHPNGCFDMIFADPPYFLSNDG-FSCQNGQMVSVNKGNWDKSKGMAADLEFYEEWLR 98

Query: 91  ACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHE 150
            C  +LKPNGT+WV G++HNI+ IG ++Q + + ILN+I W K NP PN   R F ++ E
Sbjct: 99  LCYALLKPNGTIWVCGTFHNIYLIGYLMQTVGYHILNNITWEKPNPPPNLSCRFFTHSTE 158

Query: 151 TLI 153
           T++
Sbjct: 159 TIL 161


>gi|317176865|dbj|BAJ54654.1| adenine specific DNA methyltransferase [Helicobacter pylori F16]
          Length = 209

 Score =  106 bits (265), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 76/223 (34%), Positives = 106/223 (47%), Gaps = 23/223 (10%)

Query: 45  ADPPYNLQLNGQLYRPDHSLVDAVT-DSWDK-FSSFEAYDAFTRAWLLACRRVLKPNGTL 102
            DPPYN+ +         +    +    WDK F   E        W+     ++ PNG +
Sbjct: 5   TDPPYNISVKNNFSTLKSAKRQGIDFGEWDKNFRLLE--------WIKRYAPLVNPNGCM 56

Query: 103 WVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAK 162
            +  SY  I  I   L+   F + + I W K+NPM     R +    E  +WA    KAK
Sbjct: 57  VIFCSYRFINYIADFLEENGFIVKDFIQWIKNNPMSKNINRCYVQDTEFALWAVKK-KAK 115

Query: 163 GYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTK 222
            + FN    K  NE          P+ SG E+++       HPTQK  AL+ +I+   T 
Sbjct: 116 -WVFN----KPKNEKYLRPLILKSPVVSGLEKVK-------HPTQKSLALMEKIISIHTN 163

Query: 223 PGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRI 265
           P DI+LDPF GSGT+G   K L R+FIGIE +++Y  IA KR+
Sbjct: 164 PNDIVLDPFMGSGTTGLACKNLERNFIGIESEKEYFQIAKKRL 206


>gi|240124888|ref|ZP_04737774.1| putative modification methylase [Neisseria gonorrhoeae SK-92-679]
          Length = 125

 Score =  106 bits (265), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 72/123 (58%), Gaps = 1/123 (0%)

Query: 31  VLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLL 90
           +LEK P    D+IFADPPY L  +G     +  +V     +WDK     A   F   WL 
Sbjct: 4   ILEKHPNGCFDMIFADPPYFLSNDG-FSCQNGQMVSVNKGNWDKSKGMAADLEFYEEWLR 62

Query: 91  ACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHE 150
            C  +LKPNGT+WV G++HNI+ IG ++Q + + ILN+I W K NP PN   R F ++ E
Sbjct: 63  LCYALLKPNGTIWVCGTFHNIYLIGYLMQTVGYHILNNITWEKPNPPPNLSCRFFTHSTE 122

Query: 151 TLI 153
           T++
Sbjct: 123 TIL 125


>gi|283778311|ref|YP_003369066.1| DNA methylase N-4/N-6 domain-containing protein [Pirellula staleyi
           DSM 6068]
 gi|283436764|gb|ADB15206.1| DNA methylase N-4/N-6 domain protein [Pirellula staleyi DSM 6068]
          Length = 295

 Score =  106 bits (265), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 79/281 (28%), Positives = 127/281 (45%), Gaps = 54/281 (19%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           +++I+G+ ++ L  LPA  VDL FADPP+N+  +               D +D   + + 
Sbjct: 7   NQLIQGDCVAGLASLPAGCVDLAFADPPFNIGYD--------------YDEYDDRRATDD 52

Query: 81  YDAFTRAWLLACRRVLKPNGTLWV-IGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPN 139
           Y  +   WL    RVLKP+GT W+ IG  +       M +       + +VW  +  + N
Sbjct: 53  YLTWCDQWLAEVSRVLKPDGTFWLAIGDEYAAELKVAMQRQHGLHCRSWVVWYYTFGV-N 111

Query: 140 FRGRRFQNAHETLIWASPSPKAKGYTFNYDALKA------------ANEDVQMRSD---- 183
            + + F  +H  L      PK   +TFN D ++             AN   ++  D    
Sbjct: 112 CKAK-FSRSHAHLFHMVKDPKK--FTFNVDEIRVPSARQLVYADNRANPKGRLPDDTWIL 168

Query: 184 ---------------WLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIIL 228
                          W  P  +G+ + R       H  Q PE LL RI+ +++ PG+++L
Sbjct: 169 RPQDLPDGFQPDDDTWYFPRVAGTFKER----AGWHGCQMPEQLLGRIIKATSNPGELVL 224

Query: 229 DPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQ 269
           DPF GSGT+  VAKKL R ++G E+ ++Y    T R+   +
Sbjct: 225 DPFSGSGTTLVVAKKLGRKYLGFELSKEYAARVTDRLKETK 265


>gi|172062886|ref|YP_001810537.1| DNA methylase N-4/N-6 domain-containing protein [Burkholderia
           ambifaria MC40-6]
 gi|171995403|gb|ACB66321.1| DNA methylase N-4/N-6 domain protein [Burkholderia ambifaria
           MC40-6]
          Length = 283

 Score =  106 bits (265), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 76/247 (30%), Positives = 124/247 (50%), Gaps = 33/247 (13%)

Query: 34  KLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACR 93
           +LP  S+DLI ADPPY L   G+ Y  D           DK S  + + A+TR WL    
Sbjct: 46  RLPDASIDLIVADPPYGL---GKDYGNDS----------DKRSG-DDFLAWTREWLELAI 91

Query: 94  RVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLI 153
             LKP+G++++  ++     I + L+     ++N+I+W +  P      RRF + H+ + 
Sbjct: 92  PKLKPSGSMYIFCTWQYAPEIFSFLKT-QLTMVNEIIWDRRVPSMGGTTRRFTSVHDNIG 150

Query: 154 WASPSPKAKGYTFNYDAL---------KAANEDVQMRSDWLIPICSGSE-----RLRNKD 199
           + + S   K Y F+ D +         KA +  +   S WL    +  +     RL  + 
Sbjct: 151 FFAVS---KAYYFDLDPVRIPYDADTKKARSRKLFEGSKWLEMGYNPKDVWSVSRLHRQH 207

Query: 200 GEKL-HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYI 258
            E++ HPTQKP  ++ R++++S  PG  +LDPF GSGT+     +  R F+G E+ + Y 
Sbjct: 208 AERVDHPTQKPLEIIERMVLASCPPGGRVLDPFMGSGTTAVACARQGRDFVGYEINESYC 267

Query: 259 DIATKRI 265
            IA +R+
Sbjct: 268 AIAHERV 274


>gi|224538890|ref|ZP_03679429.1| hypothetical protein BACCELL_03786 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|224519497|gb|EEF88602.1| hypothetical protein BACCELL_03786 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 262

 Score =  106 bits (265), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 86/282 (30%), Positives = 131/282 (46%), Gaps = 57/282 (20%)

Query: 18  EWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSS 77
           E+ +KI   + +++ E LP KSV L+   PPYN+ +          LV++    +     
Sbjct: 2   EYTNKIFNHSCLNMSE-LPDKSVSLMVTSPPYNINIEYGNKWDKGKLVESKGKKYIDNLE 60

Query: 78  FEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLN----FWIL------- 126
            E Y       +   +RVLK +G +W        F I    +N      FW++       
Sbjct: 61  EEEYRTMLSVVIEETKRVLKDDGEIW--------FNIKNRYKNEEIIPPFWVMEFFKDMY 112

Query: 127 --NDIVWRKSNPMPNF-----RGRRFQNAHETLIWASPSPKAKG-YTFNYDALKAANEDV 178
             N I+W       NF       +RF + +E + + +   K KG YTFN + +K     +
Sbjct: 113 LKNIIIW-------NFDWGGSTNKRFCSRYEYVFFFT---KKKGDYTFNLEDVKIP--AL 160

Query: 179 QMRSD------------WLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDI 226
             R D            W I + SG+   R +     HP Q PE L+ RI+   T PGD+
Sbjct: 161 NYRPDRYKSQLKNPTDVWNISLVSGNSPERTE-----HPAQYPEELIERIIKVGTNPGDL 215

Query: 227 ILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASV 268
           +LDPF GSGT+  VAKKL R+++G E++ D+I IA  R+ +V
Sbjct: 216 VLDPFMGSGTTAVVAKKLGRNYVGYEIEPDFIKIAENRLNNV 257


>gi|115358100|ref|YP_775238.1| DNA methylase N-4/N-6 domain-containing protein [Burkholderia
           ambifaria AMMD]
 gi|115283388|gb|ABI88904.1| DNA methylase N-4/N-6 domain protein [Burkholderia ambifaria AMMD]
          Length = 283

 Score =  106 bits (265), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 76/247 (30%), Positives = 124/247 (50%), Gaps = 33/247 (13%)

Query: 34  KLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACR 93
           +LP  S+DLI ADPPY L   G+ Y  D           DK S  + + A+TR WL    
Sbjct: 46  RLPDASIDLIVADPPYGL---GKDYGNDS----------DKRSG-DDFLAWTREWLELAI 91

Query: 94  RVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLI 153
             LKP+G++++  ++     I + L+     ++N+I+W +  P      RRF + H+ + 
Sbjct: 92  PKLKPSGSMYIFCTWQYAPEIFSFLKT-QLTMVNEIIWDRRVPSMGGTTRRFTSVHDNIG 150

Query: 154 WASPSPKAKGYTFNYDAL---------KAANEDVQMRSDWLIPICSGSE-----RLRNKD 199
           + + S   K Y F+ D +         KA +  +   S WL    +  +     RL  + 
Sbjct: 151 FFAVS---KAYYFDLDPVRIPYDADTKKARSRKLFEGSKWLEMGYNPKDVWSVSRLHRQH 207

Query: 200 GEKL-HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYI 258
            E++ HPTQKP  ++ R++++S  PG  +LDPF GSGT+     +  R F+G E+ + Y 
Sbjct: 208 AERVDHPTQKPLEIIERMVLASCPPGGRVLDPFMGSGTTAVACARQGRDFVGYEINESYC 267

Query: 259 DIATKRI 265
            IA +R+
Sbjct: 268 AIAHERV 274


>gi|58865222|emb|CAA65779.2| site-specific DNA-methyltransferase [Geobacillus
           stearothermophilus]
          Length = 226

 Score =  106 bits (265), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 74/241 (30%), Positives = 113/241 (46%), Gaps = 35/241 (14%)

Query: 37  AKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTD-------SWD-KFSSFEAYDAFTRAW 88
            + +DLI ADPPY +          H++ D           +WD +F + E        W
Sbjct: 9   GECIDLIIADPPYVVSKESNF----HTMRDRKNQRTGTHFGNWDIEFDNNE--------W 56

Query: 89  LLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNA 148
           +    +VLKP G+L V   +     I  + +   F   + ++W K+NPMP  R RR+   
Sbjct: 57  ISFAYKVLKPGGSLIVFNDFKKATIIYDIAERCGFEYKDTLIWHKTNPMPRNRDRRYIPN 116

Query: 149 HETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQK 208
            E + W     K   +TFN    K     +   S+      SG         ++ HPTQK
Sbjct: 117 VEMIQWYVKKGK---WTFNRQNEKYEGCILSYPSE------SGG------GFKRYHPTQK 161

Query: 209 PEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASV 268
           P  L+  ++   +   DIILDPF GSGT+G  +  L R+FIG E+ ++Y+ IA +RI ++
Sbjct: 162 PVKLIEYLIRIHSNENDIILDPFMGSGTTGVASLNLNRNFIGFEINEEYVQIANERIKNI 221

Query: 269 Q 269
           Q
Sbjct: 222 Q 222


>gi|124003829|ref|ZP_01688677.1| adenine-specific DNA methylase [Microscilla marina ATCC 23134]
 gi|123990884|gb|EAY30351.1| adenine-specific DNA methylase [Microscilla marina ATCC 23134]
          Length = 403

 Score =  106 bits (265), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 85/281 (30%), Positives = 134/281 (47%), Gaps = 42/281 (14%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           +K+ +G+ I +L KL A SVDL++ DPP+  Q N  L   D S     +D W    S ++
Sbjct: 4   NKLYQGHCIEILRKLEADSVDLVYFDPPFFTQKNHTLTNRDGSKKYQFSDHW---KSLDS 60

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILN---DIVWRKSNPM 137
           Y       L+  RRVLK +G++++         I T+L  + F + N   +I+W      
Sbjct: 61  YLVLIEGCLIESRRVLKNSGSVFLHCDKTVSHHIRTVLDKV-FGVKNFRSEIIWSYKRWS 119

Query: 138 PNFRGRRFQNAHETLIWASPSPKAKGYTFNY----------------DALKAANEDVQMR 181
            + +G    NAH+ + + S   K K + FN                 +  K AN     +
Sbjct: 120 NSKKG--LLNAHQNIYFYS---KTKEFKFNQYYTDYAPSTNVDQILQERKKTANGKSVYK 174

Query: 182 SDWLIPICSGSER-------------LRNKDGEKL-HPTQKPEALLSRILVSSTKPGDII 227
           +D    +  G E+             L  K  E++ +PTQKP  LL +IL   +  GD+I
Sbjct: 175 TDDSGKVILGKEKKGVPLSDVWEIPYLNPKAKERVGYPTQKPVLLLKQILNVGSNKGDLI 234

Query: 228 LDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASV 268
           +DPF GSGT+   AK L R+FIGI+  ++ I +A +R+  +
Sbjct: 235 VDPFCGSGTTCVAAKSLERNFIGIDSSEEAISLANQRLQDM 275


>gi|317179830|dbj|BAJ57616.1| Type IIS restriction enzyme M1 protein [Helicobacter pylori F32]
          Length = 260

 Score =  106 bits (264), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 77/263 (29%), Positives = 122/263 (46%), Gaps = 44/263 (16%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           +KI   +  + L+KL  KSVDL   DPPYNL++                 SWD F + E 
Sbjct: 4   NKIYIEDVFTFLDKLEDKSVDLAIIDPPYNLKIA----------------SWDSFKNDEE 47

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           +  F+ AW+      LK  G+ ++  +  N       L +     LN I W K +   N 
Sbjct: 48  FLTFSYAWIDKMLPKLKDTGSFYIFNTPFNCALFLAYLHHKKVHFLNFITWVKKDGFANA 107

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQ----------MRSD------- 183
           + +R+  A E++++ S     K YTFN D ++ A E  +          ++++       
Sbjct: 108 K-KRYNPAQESILFYSMH--KKNYTFNADEVRIAYESTERIKHAQSKGILKNNKRWFPNP 164

Query: 184 --------WLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSG 235
                   W I      E+ + K  +  HP+ KP+AL+ R++ +S+   D+ILD F GSG
Sbjct: 165 KGKLCLDVWEIASQRHVEKEKGKILKPKHPSIKPKALIERMIKASSHKNDLILDLFSGSG 224

Query: 236 TSGAVAKKLRRSFIGIEMKQDYI 258
            +  VAK L R+FIG E   +Y+
Sbjct: 225 MTSLVAKSLGRNFIGCESHAEYV 247


>gi|312868808|ref|ZP_07728997.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus oris PB013-T2-3]
 gi|311095651|gb|EFQ53906.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus oris PB013-T2-3]
          Length = 321

 Score =  106 bits (264), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 79/274 (28%), Positives = 125/274 (45%), Gaps = 49/274 (17%)

Query: 20  KDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWD-KFSSF 78
           +D+ I G+S  ++ + P +  DL   DPPYNL              D   D  + K  S 
Sbjct: 39  RDRSINGDSFQLVRQFPDQFADLALVDPPYNL--------------DKHYDGLNFKHQST 84

Query: 79  EAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
           + Y  +T+ W+   +  LKP+ +L+V   +     +  +L   NF + N I W++     
Sbjct: 85  DEYQEYTQRWIDLVKPKLKPHASLYVFADWQTSIALAPVLA-ANFTVKNRITWQREKG-- 141

Query: 139 NFRGRR--FQNAHETLIWASPSPKAKGYTFNYDALK------AANEDVQMRSDWLIPICS 190
             RG +  ++N  E + + +   K   YTFN D +K      A   +     DW     S
Sbjct: 142 --RGAKGNWKNGMEDIWFLTMDDKK--YTFNVDQVKQRRQVIAPYRENGQAKDWH---ES 194

Query: 191 GSERLRNKDGEKL----------------HPTQKPEALLSRILVSSTKPGDIILDPFFGS 234
            + R R+                      HPTQKPE LL++++++S+ PGD ILDPF G+
Sbjct: 195 AAGRFRDTMPSNFWDDISIPYWSMAENTGHPTQKPEKLLAKLILASSNPGDTILDPFAGA 254

Query: 235 GTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASV 268
           G+S   AKKL R F+G+E  + Y      R+ + 
Sbjct: 255 GSSLVTAKKLGRHFVGVEQSRLYTAWGVYRLQAA 288


>gi|291295897|ref|YP_003507295.1| DNA methylase N-4/N-6 domain-containing protein [Meiothermus ruber
           DSM 1279]
 gi|290470856|gb|ADD28275.1| DNA methylase N-4/N-6 domain protein [Meiothermus ruber DSM 1279]
          Length = 286

 Score =  106 bits (264), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 78/290 (26%), Positives = 129/290 (44%), Gaps = 62/290 (21%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQ--------------------LNGQLYRPD 61
           +I++   +  +  LP  S  LI+ DPP+N +                      G+ YR +
Sbjct: 3   RIVQAECLDYIRTLPEASFPLIYLDPPFNTRKTQQRRRIRAVADEQGSRRGFGGKRYRTE 62

Query: 62  HSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNL 121
                   D +D F  F       R  L    R+L PNG+L+V   Y  +  +  +L  +
Sbjct: 63  ALEAPVYPDRYDDFVEF------LRPRLEQAYRLLTPNGSLFVHLDYREVHYVKVLLDQI 116

Query: 122 --NFWILNDIVWRKSNPMPNFRGR---RFQNAHETLIWASPSPKAKGYTFNYDALKAANE 176
                 +N+I+W       ++ GR   R+   H+TL+W +  P+   YTFNY+A+     
Sbjct: 117 FGRKSFINEIIWAY-----DYGGRSKKRWPAKHDTLLWYAKHPQK--YTFNYEAID---- 165

Query: 177 DVQMRSDWLIPICSGSER---------------LRNKDGEKL-HPTQKPEALLSRILVSS 220
               R  +L P  +G E+               +     EK  +PTQKP  LL RI+   
Sbjct: 166 ----RIPYLAPKMAGPEKASRGKTPTDVWWMTIVPTSSKEKTGYPTQKPLRLLERIVRVH 221

Query: 221 TKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQP 270
           + PG+++LD F GSGT+G  A +  R F+ ++   D + +  +R+A+ +P
Sbjct: 222 SNPGEVVLDFFAGSGTTGEAAARNGRGFLLVDQSPDAVAVMRRRLAAFEP 271


>gi|206562848|ref|YP_002233611.1| putative DNA methylase [Burkholderia cenocepacia J2315]
 gi|198038888|emb|CAR54850.1| putative DNA methylase [Burkholderia cenocepacia J2315]
          Length = 283

 Score =  105 bits (263), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 76/249 (30%), Positives = 126/249 (50%), Gaps = 33/249 (13%)

Query: 35  LPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRR 94
           LP  S+DLI ADPPY L   G+ Y  D           DK S  + + A+TR WL     
Sbjct: 47  LPDASIDLIVADPPYGL---GKDYGNDS----------DKRSG-DDFLAWTREWLDLAIP 92

Query: 95  VLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIW 154
            LKP+G++++  ++     I + L+     ++N+I+W +  P      RRF + H+ + +
Sbjct: 93  KLKPSGSMYIFCTWQYAPEIFSFLKT-KLTMVNEIIWDRRVPSMGGTTRRFTSVHDNIGF 151

Query: 155 ASPSPKAKGYTFNYDAL---------KAANEDVQMRSDWLIPICSGSE-----RLRNKDG 200
            + S   K Y F+ D +         KA +  +   S WL    +  +     RL  +  
Sbjct: 152 FAVS---KAYYFDLDPVRIPYDADTKKARSRKLFEGSKWLEMGYNPKDVWSVSRLHRQHA 208

Query: 201 EKL-HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYID 259
           E++ HPTQKP  ++ R++++S  PG  +LDPF GSGT+     +  R F+G E+ + Y  
Sbjct: 209 ERVDHPTQKPLEIIERMVLASCPPGGRVLDPFMGSGTTAVACARQGRDFVGYEINESYCA 268

Query: 260 IATKRIASV 268
           IA +R++++
Sbjct: 269 IAHERVSAL 277


>gi|149174979|ref|ZP_01853603.1| adenine-specific methyltransferase [Planctomyces maris DSM 8797]
 gi|148846316|gb|EDL60655.1| adenine-specific methyltransferase [Planctomyces maris DSM 8797]
          Length = 306

 Score =  105 bits (263), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 87/296 (29%), Positives = 135/296 (45%), Gaps = 59/296 (19%)

Query: 27  NSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTR 86
           + I+ +++L A+S+DL FADPP+N+      Y              D+  S E Y  +  
Sbjct: 11  DCIAGMQELEAESIDLAFADPPFNIGYEYDQYE-------------DRLES-EQYLDWCN 56

Query: 87  AWLLACRRVLKPNGTLWV-IGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRF 145
            WL    R+LKP+GT W+ IG  +       M + L     + ++W  +  + N + + F
Sbjct: 57  LWLKEVVRLLKPDGTFWLAIGDEYAAELKVMMQRELGLTCRSWVIWYYTFGV-NCKNK-F 114

Query: 146 QNAHETLIWASPSPKAKGYTFNYD--------------ALKAAN---------------- 175
             +H  L +    PK   +TFN D                K AN                
Sbjct: 115 SRSHAHLFYMVKDPKQ--FTFNADDPAIRIPSARQLVYGDKRANPKGRLPDDTWILRPQD 172

Query: 176 --EDVQMRSD-WLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFF 232
             E  Q   D W  P  +G+ + R    +  H  Q PE LL RI+ + + P +++LDPF 
Sbjct: 173 IPESFQSEEDTWYFPRINGTFKER----QGWHGCQMPEQLLGRIIRACSHPEEVVLDPFS 228

Query: 233 GSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASV---QPLGNIELTVLTGKRTE 285
           GSGT+ AVAKKL R F+G E+ ++Y   A +R+A +   QPL   E  +++   T+
Sbjct: 229 GSGTTLAVAKKLERQFVGFELSEEYGARAQQRLAEIKPGQPLDGTENPLVSAPTTK 284


>gi|163816177|ref|ZP_02207545.1| hypothetical protein COPEUT_02361 [Coprococcus eutactus ATCC 27759]
 gi|158448597|gb|EDP25592.1| hypothetical protein COPEUT_02361 [Coprococcus eutactus ATCC 27759]
          Length = 237

 Score =  105 bits (263), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 76/249 (30%), Positives = 127/249 (51%), Gaps = 27/249 (10%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           K+   N++  +++LP  S+DLI  DPPYNL    Q  R +  L +  T + +K + +++ 
Sbjct: 10  KLFNENNLDFMKRLPDSSIDLILTDPPYNL---SQFSRGNIHLNNGKTIN-NKIAEWDSI 65

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLN--FWILNDIVWRKSNPMPN 139
                 ++    R++KP G +++  SY     +G      N  F      VW K+ P  +
Sbjct: 66  PLNPNDYIEPFTRIIKPTGNIFIFTSYS---LLGKWYDAFNPLFSTFQIFVWHKTTPTQS 122

Query: 140 FRGRRFQNAHETLI--WASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRN 197
                F N+ E ++  W       KG+T+N+     +++D QM + +  P C   E++ +
Sbjct: 123 VYHNSFLNSCELVVCLWN------KGHTWNF-----SSQD-QMHNFFECPSCMFPEKIIS 170

Query: 198 KDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDY 257
                 HPTQKP  L+  +L+ S+ P DII DPF G GT+G  A K  R FIGI++ + Y
Sbjct: 171 PK----HPTQKPLELIEHLLLISSNPNDIIFDPFMGVGTTGEAALKNNRRFIGIDIDEKY 226

Query: 258 IDIATKRIA 266
           +  + KR++
Sbjct: 227 VKASLKRLS 235


>gi|163846243|ref|YP_001634287.1| DNA methylase N-4/N-6 domain-containing protein [Chloroflexus
           aurantiacus J-10-fl]
 gi|222523998|ref|YP_002568468.1| DNA methylase N-4/N-6 domain-containing protein [Chloroflexus sp.
           Y-400-fl]
 gi|163667532|gb|ABY33898.1| DNA methylase N-4/N-6 domain protein [Chloroflexus aurantiacus
           J-10-fl]
 gi|222447877|gb|ACM52143.1| DNA methylase N-4/N-6 domain protein [Chloroflexus sp. Y-400-fl]
          Length = 337

 Score =  105 bits (262), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 77/272 (28%), Positives = 128/272 (47%), Gaps = 51/272 (18%)

Query: 26  GNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFT 85
           G++I+ L  L  +SVD+IFADPPYN++                   WD F S  AY  ++
Sbjct: 67  GDAIAWLRSLETESVDMIFADPPYNIR----------------KAEWDSFESQAAYVEWS 110

Query: 86  RAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRF 145
             W+    RVLKP GTL++ G +  I     +  +  F     ++W   N   N  G+ +
Sbjct: 111 LEWISEAARVLKPTGTLYICG-FSEIIADLKLPASRFFKGCRWLIWHYKNKA-NL-GKDW 167

Query: 146 QNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKL-- 203
             +HE+++      K + +TFN D ++       ++     P    S+  R +  + +  
Sbjct: 168 GRSHESILHFR---KDRQFTFNIDDIRIPYGHHTLKYP-DHPQAETSQYSRGRRRQAVWR 223

Query: 204 --------------------------HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTS 237
                                     HPTQKPE LL +++++S+  GD+I+DPF GSGT+
Sbjct: 224 PHPRGAKPRDVLEIPTTCNGMHEKTPHPTQKPEELLRKLVLASSNVGDVIVDPFLGSGTT 283

Query: 238 GAVAKKLRRSFIGIEMKQDYIDIATKRIASVQ 269
             VA++L+R + G ++  +Y   A +RI  V+
Sbjct: 284 AVVAEQLKRRWKGCDISLEYCQWAVQRIELVE 315


>gi|228470286|ref|ZP_04055190.1| DNA methylase [Porphyromonas uenonis 60-3]
 gi|228308029|gb|EEK16904.1| DNA methylase [Porphyromonas uenonis 60-3]
          Length = 285

 Score =  105 bits (262), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 85/262 (32%), Positives = 129/262 (49%), Gaps = 33/262 (12%)

Query: 21  DKIIKGNSISVL-EKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFE 79
           +KII G+++  L E +   SVDL+FADPPYN+  N               D WD   S E
Sbjct: 7   NKIIHGDALQALSECISDNSVDLVFADPPYNIGKN----------FAGCLDKWD---SDE 53

Query: 80  AYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPN 139
           +Y  +  +WL  C + LKP G L+V+ S   +      L+     IL+ IVW   +    
Sbjct: 54  SYLRWCYSWLDLCIQKLKPTGALYVMTSTQFMPYFDLYLRE-RLDILSRIVWSYDSSGVQ 112

Query: 140 FRGRRFQNAHETLIWASPSPKAKGYTFNY-DALKAANED-----VQMRSDWLIPICSGS- 192
            + R F + +E +++       + YTFN  D L  A        +  R +   P  +   
Sbjct: 113 AK-RYFGSLYEPILFCVKD--KRQYTFNASDILVEAKTGAKRGLIDYRKNPPQPYSTTKV 169

Query: 193 -------ERLRNKDGE-KLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKL 244
                   R+R +  E + HPTQKP  LL RI+ +S+  GD++LDPF G+ T+  VA  L
Sbjct: 170 PGNVWEFTRVRYRMPEYENHPTQKPIELLERIIKASSNEGDVVLDPFSGTFTTSYVASLL 229

Query: 245 RRSFIGIEMKQDYIDIATKRIA 266
            R  IGIE++++Y+ I  +R+ 
Sbjct: 230 HRKSIGIELQEEYVKIGLRRLG 251


>gi|166368612|ref|YP_001660885.1| putative methyltransferase [Microcystis aeruginosa NIES-843]
 gi|166090985|dbj|BAG05693.1| DNA-methyltransferase [Microcystis aeruginosa NIES-843]
          Length = 295

 Score =  105 bits (262), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 84/259 (32%), Positives = 130/259 (50%), Gaps = 33/259 (12%)

Query: 23  IIKGNSISVLE-KLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           I  G+S+ +L  ++ + SVDLIF DPPYN+   G+ +           D +DK+ S   Y
Sbjct: 12  IFHGDSLPILSSEIASNSVDLIFLDPPYNI---GKHF----------ADFYDKWESENDY 58

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFR 141
             +    L  C R+LKP GTL+V+ S   +      L+     IL+ I+W   +      
Sbjct: 59  INWANQILDQCLRILKPQGTLYVMASTQAMPYFDLYLRQ-KMTILSRIIWHYDSSGVQ-A 116

Query: 142 GRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRS--DW--LIPICSGSE---- 193
            + F + +E ++          YTFN   +K   +    R   D+   IP    +E    
Sbjct: 117 TKYFGSMYEPILHCVKD--KNNYTFNSKDIKIEAKTGAKRKLIDYRKAIPSQYNTEKVPG 174

Query: 194 ------RLRNK-DGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRR 246
                 R+R + D  + HP+QKPE+LL RI+++ST    I+LDPF G+ T+ AVAK+L R
Sbjct: 175 NVWYFPRVRYRMDEYENHPSQKPESLLERIILASTDKSGIVLDPFAGTFTAAAVAKRLGR 234

Query: 247 SFIGIEMKQDYIDIATKRI 265
             I IE +++Y+ I  +RI
Sbjct: 235 ISISIESQEEYLKIGLRRI 253


>gi|17231903|ref|NP_488451.1| putative methyltransferase [Nostoc sp. PCC 7120]
 gi|17133547|dbj|BAB76110.1| DNA-methyltransferase [Nostoc sp. PCC 7120]
          Length = 295

 Score =  105 bits (261), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 79/259 (30%), Positives = 133/259 (51%), Gaps = 33/259 (12%)

Query: 23  IIKGNSISVLEK-LPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           +  G+++++L   +P++SVDLIF DPPYN+   G+ +   H          DK+ S E Y
Sbjct: 12  LFHGDALNILSSNIPSESVDLIFIDPPYNI---GKHFSNFH----------DKWESEEEY 58

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFR 141
             +   WL  C RVLK +GT++V+ S   +      L+     IL+ IVW   +      
Sbjct: 59  ANWAYKWLDECIRVLKSHGTIYVMTSTQAMPYFDIYLRQ-KLTILSRIVWHYDSSGVQ-A 116

Query: 142 GRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRS--DW--LIPICSGSE---- 193
            + F + +E ++    +     Y FN + +K   +    R   D+   +P    +E    
Sbjct: 117 TKYFGSMYEPILHCVKN--KSNYIFNSEEIKIEAKTGAQRKLIDYRKAVPAPYNTEKVPG 174

Query: 194 ------RLRNKDGE-KLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRR 246
                 R+R +  E + HP+QKPE+L+ RI++SS+    ++LDPF G+ T  +VAK+L R
Sbjct: 175 NVWYFSRVRYRMPEYENHPSQKPESLIERIILSSSNEDSLVLDPFAGTFTVASVAKRLGR 234

Query: 247 SFIGIEMKQDYIDIATKRI 265
             I IE +++Y+ I  +R+
Sbjct: 235 KSISIESQEEYLKIGLRRV 253


>gi|187921472|ref|YP_001890504.1| DNA methylase N-4/N-6 domain-containing protein [Burkholderia
           phytofirmans PsJN]
 gi|187719910|gb|ACD21133.1| DNA methylase N-4/N-6 domain protein [Burkholderia phytofirmans
           PsJN]
          Length = 301

 Score =  104 bits (260), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 78/280 (27%), Positives = 139/280 (49%), Gaps = 34/280 (12%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           +++  + ++ +  +P  S+DLI  DPPY L   G+ Y  D  +            + E +
Sbjct: 38  QLLNRDFLTDVANIPDGSIDLIVCDPPYGL---GKDYGNDSDM-----------RTGEDF 83

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFR 141
            A+TR WL      LKP+G+L++  ++     I + L+     ++N+I+W +  P     
Sbjct: 84  LAWTRGWLELAIPKLKPSGSLYIFCTWQYAPEIFSFLKT-KLTMINEIIWDRRVPSMGGT 142

Query: 142 GRRFQNAHETLIWASPSPKAKGYTFNYDALK----AANEDVQMR-----SDWLIPICSGS 192
            RRF + H+ + + + S   K Y F+ D ++    AA +  + R     S WL    +  
Sbjct: 143 VRRFTSVHDNIGFFAVS---KDYFFDLDPVRIPYDAATKKARSRKLFEGSKWLEVGYNPK 199

Query: 193 E-----RLRNKDGEKL-HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRR 246
           +     RL  +  E++ HPTQKP  ++ R++++S   G  +LDPF GSGT+     + +R
Sbjct: 200 DVWSVSRLHRQHAERVAHPTQKPLEIVERMVLASCPKGGRVLDPFMGSGTTAVACARQQR 259

Query: 247 SFIGIEMKQDYIDIATKRI-ASVQPLGNIELTVLTGKRTE 285
            F+G E+ + Y  IA +R+ A+  P     +   T ++TE
Sbjct: 260 EFVGYEINESYCAIARERVSAAANPPVARRVKAKTQRQTE 299


>gi|78062971|ref|YP_372879.1| DNA methylase N-4/N-6 [Burkholderia sp. 383]
 gi|77970856|gb|ABB12235.1| DNA methylase N-4/N-6 [Burkholderia sp. 383]
          Length = 283

 Score =  104 bits (260), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 76/246 (30%), Positives = 123/246 (50%), Gaps = 33/246 (13%)

Query: 35  LPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRR 94
           LP  S+DLI ADPPY L   G+ Y  D           DK S  + + A+TR WL     
Sbjct: 47  LPDASIDLIVADPPYGL---GKDYGNDS----------DKRSG-DDFLAWTREWLELAIP 92

Query: 95  VLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIW 154
            LKP+G++++  ++     I + L+     ++N+I+W +  P      RRF + H+ + +
Sbjct: 93  KLKPSGSMYIFCTWQYAPEIFSFLKT-QLTMVNEIIWDRRVPSMGGTTRRFTSVHDNIGF 151

Query: 155 ASPSPKAKGYTFNYDAL---------KAANEDVQMRSDWLIPICSGSE-----RLRNKDG 200
            + S   K Y F+ D +         KA +  +   S WL    +  +     RL  +  
Sbjct: 152 FAVS---KAYYFDLDPVRIPYDADTKKARSRKLFEGSKWLEMGYNPKDVWSVSRLHRQHA 208

Query: 201 EKL-HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYID 259
           E++ HPTQKP  ++ R++++S  PG  +LDPF GSGT+     +  R F+G E+ + Y  
Sbjct: 209 ERVDHPTQKPLEIIERMVLASCPPGGRVLDPFMGSGTTAVACARQGRDFVGYEINESYCA 268

Query: 260 IATKRI 265
           IA +R+
Sbjct: 269 IAHERV 274


>gi|257468517|ref|ZP_05632611.1| putative methyltransferase [Fusobacterium ulcerans ATCC 49185]
 gi|317062777|ref|ZP_07927262.1| DNA-methyltransferase [Fusobacterium ulcerans ATCC 49185]
 gi|313688453|gb|EFS25288.1| DNA-methyltransferase [Fusobacterium ulcerans ATCC 49185]
          Length = 255

 Score =  104 bits (260), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 86/269 (31%), Positives = 130/269 (48%), Gaps = 46/269 (17%)

Query: 27  NSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTR 86
           + I  L+K+   SVDL+F DPPYNL   G+ Y+          D W    + E Y  +  
Sbjct: 7   DVIDGLKKVENASVDLLFIDPPYNL---GKKYK-------GTIDHW---KTDEEYLEWCY 53

Query: 87  AWLLACRRVLKPNGTLWVI-----GSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFR 141
           +WL    + LKPNG L+ +     G+Y +I+    M       IL+ I+W   +     +
Sbjct: 54  SWLEVSLQKLKPNGCLYFMSSTQYGAYFDIYLREKM------HILSRIIWEYDSSGVQAK 107

Query: 142 GRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLI------PICSGSE-- 193
            + F + +E +I+A  +   K YTFN+  +  A +    R   LI      P+    E  
Sbjct: 108 -KHFGSLYEPIIFAVMN--KKNYTFNFKDIMVATKTGAQRK--LIDYRKNPPVPYNEEKV 162

Query: 194 --------RLRNKDGEKL-HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKL 244
                   R+R +  E + HP+QKPEALL RI+  ST   D ILD F GS + G V K+L
Sbjct: 163 PGNVWYFPRVRYRMKEYVEHPSQKPEALLERIIKVSTNETDTILDLFAGSFSLGMVCKRL 222

Query: 245 RRSFIGIEMKQDYIDIATKRIASVQPLGN 273
            R +IGIE  ++Y  +  +R+   + + N
Sbjct: 223 NRKYIGIEKSKEYYTVGIERLKDKKEVLN 251


>gi|307726598|ref|YP_003909811.1| DNA methylase N-4/N-6 domain-containing protein [Burkholderia sp.
           CCGE1003]
 gi|307587123|gb|ADN60520.1| DNA methylase N-4/N-6 domain protein [Burkholderia sp. CCGE1003]
          Length = 303

 Score =  104 bits (260), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 76/282 (26%), Positives = 137/282 (48%), Gaps = 33/282 (11%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           +++  + ++ +  +P  S+DLI  DPPY L   G+ Y  D  +            S + +
Sbjct: 39  QLLNRDFLTDVANIPDGSIDLILCDPPYGL---GKDYGNDSDM-----------RSGDDF 84

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFR 141
            A+TR WL      LKP+G+L++  ++     I + L+     ++N+I+W +  P     
Sbjct: 85  LAWTRGWLELAVPKLKPSGSLYIFCTWQYAPEIFSFLKT-KLVMINEIIWDRRVPSMGGT 143

Query: 142 GRRFQNAHETLIWASPSPKAKGYTFNYDALK----AANEDVQMR-----SDWLIPICSGS 192
            RRF + H+ + + + S   K Y F+ D ++    AA +  + R     S WL    +  
Sbjct: 144 TRRFTSVHDNIGFFAVS---KDYYFDLDPVRIPYDAATKKARSRKLFEGSKWLELGYNPK 200

Query: 193 E-----RLRNKDGEKL-HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRR 246
           +     RL  +  E++ HPTQKP  ++ R++++S   G  +LDPF GSGT+     + +R
Sbjct: 201 DVWSVSRLHRQHAERVDHPTQKPLEIVERMVLASCPKGGRVLDPFMGSGTTAVACARQQR 260

Query: 247 SFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRTEPRV 288
            F+G E+ + Y  IA +R+++          V    + +P V
Sbjct: 261 EFVGYEINESYCAIARERVSAAAAAPAGRAPVKARAQRQPEV 302


>gi|313143165|ref|ZP_07805358.1| type IIS restriction enzyme M1 protein [Helicobacter cinaedi CCUG
           18818]
 gi|313128196|gb|EFR45813.1| type IIS restriction enzyme M1 protein [Helicobacter cinaedi CCUG
           18818]
          Length = 261

 Score =  104 bits (260), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 73/265 (27%), Positives = 126/265 (47%), Gaps = 47/265 (17%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           +KI   +  S LE L   S+DL   DPPYNL++                 SWD F S + 
Sbjct: 10  NKIYIQDCFSFLESLADSSIDLAIIDPPYNLKIA----------------SWDSFKSEKE 53

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGS-YHNIFRIGTMLQNLNFWILNDIVWRKSNPMPN 139
           + AF+  W+      +K NG+ ++  + YH    +  + +   F   N I W K + + +
Sbjct: 54  FLAFSYKWIDLLLPKMKKNGSFYIFNTPYHCALFLHYLQEKAVF--QNFITWYKKDGL-S 110

Query: 140 FRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAA------------------------N 175
           +  +RF N  E++++ +    +K Y FN ++++                          N
Sbjct: 111 YTKKRFVNNQESILFYTMD--SKSYCFNPESIRVPYESTSRIEHAKKNGILKNGKRWYPN 168

Query: 176 EDVQMRSD-WLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGS 234
           E+ ++  D W I      +++  K  +  HPT KP+ ++ R++ +S+K GD++LD F GS
Sbjct: 169 ENGKLCPDVWEIASQRHKQKVNGKTQKLHHPTIKPKEMIERMIKASSKKGDLVLDLFSGS 228

Query: 235 GTSGAVAKKLRRSFIGIEMKQDYID 259
           G +  VA+ L R+FIG E   +Y+D
Sbjct: 229 GMTSLVARDLERNFIGCEASIEYVD 253


>gi|148543440|ref|YP_001270810.1| DNA methylase N-4/N-6 domain-containing protein [Lactobacillus
           reuteri DSM 20016]
 gi|184152848|ref|YP_001841189.1| hypothetical protein LAR_0193 [Lactobacillus reuteri JCM 1112]
 gi|227363589|ref|ZP_03847706.1| adenine-specific methyltransferase [Lactobacillus reuteri MM2-3]
 gi|325681783|ref|ZP_08161302.1| DNA (cytosine-5-)-methyltransferase domain protein [Lactobacillus
           reuteri MM4-1A]
 gi|148530474|gb|ABQ82473.1| DNA methylase N-4/N-6 domain protein [Lactobacillus reuteri DSM
           20016]
 gi|183224192|dbj|BAG24709.1| hypothetical protein [Lactobacillus reuteri JCM 1112]
 gi|227071385|gb|EEI09691.1| adenine-specific methyltransferase [Lactobacillus reuteri MM2-3]
 gi|324978874|gb|EGC15822.1| DNA (cytosine-5-)-methyltransferase domain protein [Lactobacillus
           reuteri MM4-1A]
          Length = 319

 Score =  104 bits (259), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 84/285 (29%), Positives = 127/285 (44%), Gaps = 59/285 (20%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNL--QLNGQLYRPDHSLVDAVTDSWDKFSSF 78
           +KII G+S  V+ +L    VDL   DPPYNL  Q +G  +               K  S 
Sbjct: 36  NKIINGDSFKVMTQLAPHQVDLALIDPPYNLNKQYDGLNF---------------KKMST 80

Query: 79  EAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
             Y  +T+ W+   + +LK N +++V   +     +  +L+  NF I N I W++     
Sbjct: 81  SQYQTYTQKWIDLLKPLLKENASIYVFSDWATSMALAPILEK-NFTIQNRITWQREKG-- 137

Query: 139 NFRG--RRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQ------MRSDWL----- 185
             RG  + ++N  E + + + +P    YTFN D +K   + V       +  DW      
Sbjct: 138 --RGSQKNWKNGMEDIWFLTANPS--DYTFNVDQVKQRRQVVAPYRQDGVAKDWQATKNG 193

Query: 186 ---------------IPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDP 230
                          IP  S  E          HPTQKPE LL++I+++S+ P D I DP
Sbjct: 194 NFRDTMPSNFWDDISIPYWSMPENTG-------HPTQKPEKLLAKIILASSNPNDFIFDP 246

Query: 231 FFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIE 275
           F GSG+S   A KL R ++GIE    Y      R+  V+   +I+
Sbjct: 247 FAGSGSSLVTAAKLNRRYLGIEQSLLYCAWGQYRLNQVKDDPSIQ 291


>gi|224436664|ref|ZP_03657673.1| type IIS restriction enzyme M1 protein (mod) [Helicobacter cinaedi
           CCUG 18818]
          Length = 254

 Score =  104 bits (259), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 73/265 (27%), Positives = 126/265 (47%), Gaps = 47/265 (17%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           +KI   +  S LE L   S+DL   DPPYNL++                 SWD F S + 
Sbjct: 3   NKIYIQDCFSFLESLADSSIDLAIIDPPYNLKIA----------------SWDSFKSEKE 46

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGS-YHNIFRIGTMLQNLNFWILNDIVWRKSNPMPN 139
           + AF+  W+      +K NG+ ++  + YH    +  + +   F   N I W K + + +
Sbjct: 47  FLAFSYKWIDLLLPKMKKNGSFYIFNTPYHCALFLHYLQEKAVF--QNFITWYKKDGL-S 103

Query: 140 FRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAA------------------------N 175
           +  +RF N  E++++ +    +K Y FN ++++                          N
Sbjct: 104 YTKKRFVNNQESILFYTMD--SKSYCFNPESIRVPYESTSRIEHAKKNGILKNGKRWYPN 161

Query: 176 EDVQMRSD-WLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGS 234
           E+ ++  D W I      +++  K  +  HPT KP+ ++ R++ +S+K GD++LD F GS
Sbjct: 162 ENGKLCPDVWEIASQRHKQKVNGKTQKLHHPTIKPKEMIERMIKASSKKGDLVLDLFSGS 221

Query: 235 GTSGAVAKKLRRSFIGIEMKQDYID 259
           G +  VA+ L R+FIG E   +Y+D
Sbjct: 222 GMTSLVARDLERNFIGCEASIEYVD 246


>gi|184200490|ref|YP_001854697.1| putative methyltransferase [Kocuria rhizophila DC2201]
 gi|183580720|dbj|BAG29191.1| putative methyltransferase [Kocuria rhizophila DC2201]
          Length = 289

 Score =  104 bits (259), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 85/292 (29%), Positives = 135/292 (46%), Gaps = 60/292 (20%)

Query: 18  EWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSL------------- 64
           E    I+ G +++VLE LP +S  L++ DPP+N   + Q+ R   S+             
Sbjct: 12  EGTSAIVHGENLTVLESLPDESFSLVYLDPPFNTGRD-QVRRTTRSVPVAHGEGDRVGFA 70

Query: 65  ---VDAVTDSWDKFS-SFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQN 120
               + +  S  ++  SF  Y  F    L   RRVL  +GTL+V   Y  +  +  +L  
Sbjct: 71  GRSYETIMGSLRRYEDSFADYLGFLEPRLAHARRVLARHGTLYVHLDYREVHYVKVLLDA 130

Query: 121 L--NFWILNDIVWRKSNPMPNFRGR---RFQNAHETLIWASPSPKAKGYTFNYDALKAAN 175
           +      LN+IVW       +F GR   R+   H+T++     P A  Y FN       +
Sbjct: 131 MFGRECFLNEIVWAY-----DFGGRTTRRWPAKHDTILVYVKDPAA--YHFN-------S 176

Query: 176 EDVQMRSDWLIPICSGSERL-------------------RNKDGEKLHPTQKPEALLSRI 216
           +DV  R  ++ P   G E+                    R K G   +PTQKP  +L RI
Sbjct: 177 QDVD-REPYMAPGLVGPEKAARGKLPTDVWWHTIVSPTGREKTG---YPTQKPAGVLRRI 232

Query: 217 LVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASV 268
           + +S++PGD +LD F GSGT+GAV+ +L R F+ ++   + +++   R+  V
Sbjct: 233 VTASSRPGDWVLDFFAGSGTTGAVSAELGRRFVCVDSNPEAVEVMRLRLPDV 284


>gi|237753191|ref|ZP_04583671.1| adenine specific DNA methyltransferase [Helicobacter winghamensis
           ATCC BAA-430]
 gi|229375458|gb|EEO25549.1| adenine specific DNA methyltransferase [Helicobacter winghamensis
           ATCC BAA-430]
          Length = 232

 Score =  103 bits (258), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 72/248 (29%), Positives = 117/248 (47%), Gaps = 23/248 (9%)

Query: 22  KIIKGNSISVLEKLPAKSVDL--IFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFE 79
           K+   +S + ++++    V +  I  DPPYN+  +                 WDK     
Sbjct: 2   KLYNADSYTFIQQMLENKVKVHHIITDPPYNISKSNNFPSMRQRRQGVDFGVWDK----- 56

Query: 80  AYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPN 139
            +D  +  W+     +L  NG++ +  SY  I  I   L+N N  + + ++W+KSNPMP 
Sbjct: 57  GFDLVS--WIPQYAEILDKNGSMIIFCSYRFISFITQALENSNMIVKDVLIWQKSNPMPR 114

Query: 140 FRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKD 199
              RR+    E  +WA  S     + FN       ++   +RS +   + SG E+L    
Sbjct: 115 NTTRRYVQDLEFAVWAVKS--GAKWVFN-----KPSDVPYLRSIFTHALVSGKEKLG--- 164

Query: 200 GEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYID 259
               HPTQK   L+  ++   T   +++LDPF GSG++GA   +L R FIGIE  + +  
Sbjct: 165 ----HPTQKSLKLMKDLIQIHTNLNEVVLDPFMGSGSTGAACLELGREFIGIERDKKFFT 220

Query: 260 IATKRIAS 267
           +A KR+ S
Sbjct: 221 MAQKRLES 228


>gi|296159696|ref|ZP_06842519.1| DNA methylase N-4/N-6 domain protein [Burkholderia sp. Ch1-1]
 gi|295890140|gb|EFG69935.1| DNA methylase N-4/N-6 domain protein [Burkholderia sp. Ch1-1]
          Length = 301

 Score =  103 bits (258), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 73/260 (28%), Positives = 131/260 (50%), Gaps = 33/260 (12%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           +++  + +S +  +P  S+DLI  DPPY L   G+ Y  D  +            + + +
Sbjct: 38  QLLNRDFLSDVANIPDGSIDLILCDPPYGL---GKDYGNDSDM-----------RTGDDF 83

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFR 141
            A+TR WL      LKP+G+L++  ++     I + L+     ++N+I+W +  P     
Sbjct: 84  LAWTRGWLELAIPKLKPSGSLYIFCTWQYAPEIFSFLKT-KLTMINEIIWDRRVPSMGGT 142

Query: 142 GRRFQNAHETLIWASPSPKAKGYTFNYDALK----AANEDVQMR-----SDWLIPICSGS 192
            RRF + H+ + + + S   K Y F+ D ++    AA +  + R     S WL    +  
Sbjct: 143 VRRFTSVHDNIGFFAVS---KDYFFDLDPVRIPYDAATKKARSRKLFEGSKWLEVGYNPK 199

Query: 193 E-----RLRNKDGEKL-HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRR 246
           +     RL  +  E++ HPTQKP  ++ R++++S   G  +LDPF GSGT+     + +R
Sbjct: 200 DVWSVSRLHRQHAERVAHPTQKPLEIVERMVLASCPKGGRVLDPFMGSGTTAVACARQQR 259

Query: 247 SFIGIEMKQDYIDIATKRIA 266
            F+G E+ + Y  IA +R++
Sbjct: 260 EFVGYEINESYCAIARERVS 279


>gi|113868574|ref|YP_727063.1| DNA-methyltransferase [Ralstonia eutropha H16]
 gi|113527350|emb|CAJ93695.1| DNA-Methyltransferase [Ralstonia eutropha H16]
          Length = 308

 Score =  103 bits (258), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 71/261 (27%), Positives = 126/261 (48%), Gaps = 35/261 (13%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           ++ + +    + +LP  SVDLI ADPPY L   G+ Y  D  L+           S + Y
Sbjct: 29  RLFQEDMFEGIARLPDGSVDLIVADPPYGL---GKDYGNDSDLL-----------SGQEY 74

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFR 141
             ++  W+ A    L P GTL++  ++     +  ML+     ++N+I+W +  P     
Sbjct: 75  LDWSERWMNAVVPKLAPKGTLYLFCTWQYSPELFVMLKR-RLTMINEIIWDRRVPSMGGT 133

Query: 142 GRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSE-------- 193
            R+F + H+ + + +   +A+ Y F+ D ++    D + +     P   G +        
Sbjct: 134 TRKFSSVHDNIGFFA---RARDYYFDLDPVRIPY-DPETKKARSRPRFEGKKWLEVGYNP 189

Query: 194 -------RLRNKDGEKL-HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLR 245
                  R+  +D E+  HPTQKP  ++ R+++SS  PG ++LDPF GSGT+     +  
Sbjct: 190 KDLWSVSRIHRQDPERANHPTQKPLEIVERMVLSSCPPGGLVLDPFAGSGTTAVACLRHG 249

Query: 246 RSFIGIEMKQDYIDIATKRIA 266
           R F G E+  +Y+ +A  R++
Sbjct: 250 RRFAGFEINPEYVQVACDRVS 270


>gi|323529195|ref|YP_004231347.1| DNA methylase N-4/N-6 domain-containing protein [Burkholderia sp.
           CCGE1001]
 gi|323386197|gb|ADX58287.1| DNA methylase N-4/N-6 domain protein [Burkholderia sp. CCGE1001]
          Length = 303

 Score =  103 bits (257), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 72/262 (27%), Positives = 132/262 (50%), Gaps = 33/262 (12%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           +++  + ++ +  +P  S+DLI  DPPY L   G+ Y  D  +            + + +
Sbjct: 39  QLLNRDFLTDVANIPDGSIDLILCDPPYGL---GKDYGNDSDM-----------RTGDDF 84

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFR 141
            A+TR WL      LKP+G+L++  ++     I + L+     ++N+I+W +  P     
Sbjct: 85  LAWTRGWLELAIPKLKPSGSLYIFCTWQYAPEIFSFLKT-RLLMINEIIWDRRVPSMGGT 143

Query: 142 GRRFQNAHETLIWASPSPKAKGYTFNYDALK----AANEDVQMR-----SDWLIPICSGS 192
            RRF + H+ + + + S   K Y F+ D ++    AA +  + R     S WL    +  
Sbjct: 144 TRRFTSVHDNIGFFAVS---KDYYFDLDPVRIPYDAATKKARSRKLFEGSKWLELGYNPK 200

Query: 193 E-----RLRNKDGEKL-HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRR 246
           +     RL  +  E++ HPTQKP  ++ R++++S   G  +LDPF GSGT+     + +R
Sbjct: 201 DVWSVSRLHRQHAERVDHPTQKPLEIVERMVLASCPKGGRVLDPFMGSGTTAVACARQQR 260

Query: 247 SFIGIEMKQDYIDIATKRIASV 268
            F+G E+ + Y  IA +R+++ 
Sbjct: 261 EFVGYEINESYCAIARERVSAA 282


>gi|91777257|ref|YP_552465.1| putative modification methylase [Burkholderia xenovorans LB400]
 gi|91689917|gb|ABE33115.1| Putative modification methylase [Burkholderia xenovorans LB400]
          Length = 301

 Score =  103 bits (257), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 75/260 (28%), Positives = 131/260 (50%), Gaps = 33/260 (12%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           +++  + +S +  +P  S+DLI  DPPY L   G+ Y  D  +      + D F S+   
Sbjct: 38  QLLNRDFLSDVANIPDGSIDLILCDPPYGL---GKDYGNDSDM-----RTGDDFLSW--- 86

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFR 141
              TR WL      LKP+G+L++  ++     I + L+     ++N+I+W +  P     
Sbjct: 87  ---TRGWLELAIPKLKPSGSLYIFCTWQYAPEIFSFLKT-KLTMINEIIWDRRVPSMGGT 142

Query: 142 GRRFQNAHETLIWASPSPKAKGYTFNYDALK----AANEDVQMR-----SDWLIPICSGS 192
            RRF + H+ + + + S   K Y F+ D ++    AA +  + R     S WL    +  
Sbjct: 143 VRRFTSVHDNIGFFAVS---KDYFFDLDPVRIPYDAATKKARSRKLFEGSKWLEVGYNPK 199

Query: 193 E-----RLRNKDGEKL-HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRR 246
           +     RL  +  E++ HPTQKP  ++ R++++S   G  +LDPF GSGT+     + +R
Sbjct: 200 DVWSVSRLHRQHAERVAHPTQKPLEIVERMVLASCPKGGRVLDPFMGSGTTAVACARQQR 259

Query: 247 SFIGIEMKQDYIDIATKRIA 266
            F+G E+ + Y  IA +R++
Sbjct: 260 EFVGYEINESYCAIARERVS 279


>gi|51891472|ref|YP_074163.1| DNA modification methylase M.SthI [Symbiobacterium thermophilum IAM
           14863]
 gi|51855161|dbj|BAD39319.1| DNA modification methylase M.SthI [Symbiobacterium thermophilum IAM
           14863]
          Length = 289

 Score =  103 bits (257), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 77/287 (26%), Positives = 126/287 (43%), Gaps = 69/287 (24%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPY----NLQLNGQLYRPDHSLVDAVTDSWDKFSSF 78
           I++G++   L+++P  S+  +   PPY    +  + GQ+      L D+V    +   S 
Sbjct: 19  ILEGDARLALQRIPDNSIQCVVTSPPYWSLRDYGIEGQI-----GLEDSVYQYINTLVSV 73

Query: 79  EAYDAFTRAWLLACRRVLKPNGTLWV-IGSYHN--------------------------- 110
                         RRVLKP+GTLW+ IG  +                            
Sbjct: 74  ----------FREVRRVLKPDGTLWLNIGDSYTSGGRTWRAPDKKNQARAMSIRPDTPEG 123

Query: 111 ---------IFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKA 161
                     +R+   LQ   +++ +DI+W K N MP     R   +HE +   S   K+
Sbjct: 124 LKPKDLIGVPWRLAFALQQDGWYLRSDIIWHKPNAMPESVKDRPTRSHEYIFLFS---KS 180

Query: 162 KGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSST 221
           + Y ++Y A++  N     RS W I           +  ++ H    P  L+   +++ +
Sbjct: 181 ERYYYDYQAIREEN-GRNRRSVWHI---------NTQPNKEAHFAVFPTTLVEPCILAGS 230

Query: 222 KPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASV 268
           KPGD +LDPF GSGT+  V + L R ++GIE+  +YI IA KR+ S+
Sbjct: 231 KPGDYVLDPFLGSGTTAVVCQNLDRKYVGIELNPEYIQIAVKRLTSI 277


>gi|193216190|ref|YP_001997389.1| putative methyltransferase [Chloroherpeton thalassium ATCC 35110]
 gi|193089667|gb|ACF14942.1| Site-specific DNA-methyltransferase (adenine-specific)
           [Chloroherpeton thalassium ATCC 35110]
          Length = 292

 Score =  103 bits (257), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 79/275 (28%), Positives = 135/275 (49%), Gaps = 39/275 (14%)

Query: 7   LAINENQNSIFEWKDKIIKGNSISVLEK-LPAKSVDLIFADPPYNLQLNGQLYRPDHSLV 65
           +A  EN+N +      I  G++I +L++ +  +S+DL+F DPPYN+   G+ +       
Sbjct: 1   MAKFENKNHV------IYHGDAIDILQREIADESIDLVFVDPPYNI---GKKF------- 44

Query: 66  DAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWI 125
              +D  DK+ S   Y  +   W+  C R+LKP GTL+++     +      +++    +
Sbjct: 45  ---SDFHDKWPSDTDYAEWAYRWIDECIRILKPTGTLYLMSGTQAMPYFDLYVRD-KLTV 100

Query: 126 LNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDAL------KAANEDVQ 179
           L  +VW   +     + + F + +E ++       AK Y FN D +       A  + + 
Sbjct: 101 LGRLVWAYDSSGVQAK-KYFGSMYEPILHCVKD--AKAYCFNADDILVEAKTGAKRKLID 157

Query: 180 MRSDWLIPICSGS--------ERLRNK-DGEKLHPTQKPEALLSRILVSSTKPGDIILDP 230
            R +   P  +           R+R + D  + HP+QKP  LL RI+ +S+  GDI+LDP
Sbjct: 158 YRGEVPKPYNTQKVPGNVWEFPRVRYRMDEYEDHPSQKPMVLLERIVRASSNAGDIVLDP 217

Query: 231 FFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRI 265
           F G+ T+ AVAK   R  + IE ++ Y+ I  +RI
Sbjct: 218 FAGTFTAAAVAKAFGRKSVSIESQEKYLKIGLRRI 252


>gi|158333607|ref|YP_001514779.1| DNA methylase [Acaryochloris marina MBIC11017]
 gi|158303848|gb|ABW25465.1| DNA methylase [Acaryochloris marina MBIC11017]
          Length = 289

 Score =  103 bits (257), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 81/278 (29%), Positives = 133/278 (47%), Gaps = 65/278 (23%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQ--LNGQLYRPDHSLVDAVTDSWDKFSSF 78
           D  I+G+ + +  KL   S++L+  DPPYNL    NG+ +                  S 
Sbjct: 15  DITIQGDCLDIAPKLLQGSINLLILDPPYNLNKVFNGRTFAK---------------QSV 59

Query: 79  EAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
            AY  +        + +L+P+ ++++ G + +   I T+  + +F + N I W +     
Sbjct: 60  AAYTEWLDYICSKLKPLLRPDASIYICGDWFSSASIFTVATS-HFQVRNRITWERE---- 114

Query: 139 NFRGR----RFQNAHETLIWASPSPKAKGYTFNYDALK-------------------AAN 175
             +GR     ++NA E + + + S     YTFN  A+K                   +  
Sbjct: 115 --KGRGAHSNWKNASEDIWFCTNS---NSYTFNSQAVKQRRRVLAPYRRPDGSPKDWSQT 169

Query: 176 EDVQMR--------SDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDII 227
           E+   R        +D  IP  S  E   N D    HPTQK E L+++++++S+ PGD +
Sbjct: 170 ENGNFRDTFASNLWTDISIPFWSMPE---NTD----HPTQKSEKLVAKLILASSNPGDTV 222

Query: 228 LDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRI 265
           LDPF GSGT+  VAKKL+R FIGIE+ ++Y  ++ +RI
Sbjct: 223 LDPFLGSGTTSVVAKKLQRQFIGIEIDEEYCLLSERRI 260


>gi|194467616|ref|ZP_03073603.1| DNA methylase N-4/N-6 domain protein [Lactobacillus reuteri 100-23]
 gi|194454652|gb|EDX43549.1| DNA methylase N-4/N-6 domain protein [Lactobacillus reuteri 100-23]
          Length = 319

 Score =  103 bits (257), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 81/283 (28%), Positives = 126/283 (44%), Gaps = 55/283 (19%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNL--QLNGQLYRPDHSLVDAVTDSWDKFSSF 78
           +KII G+S  V+ +L    VDL   DPPYNL  Q +G  +               K  S 
Sbjct: 36  NKIINGDSFKVMTQLAPYQVDLALIDPPYNLNKQYDGLNF---------------KKMST 80

Query: 79  EAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
             Y  +T+ W+   + +LK N +++V   +     +  +L+  NF I N I W++     
Sbjct: 81  SKYQTYTQKWIDLLKPLLKENASIYVFSDWATSMALAPILEK-NFTIQNRITWQREKGRG 139

Query: 139 NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQ------MRSDWL------- 185
           + +   ++N  E + + + +P    YTFN D +K   + V       +  DW        
Sbjct: 140 SLKN--WKNGMEDIWFLTANPS--DYTFNVDQVKQRRQVVAPYRQDGVAKDWQATKNGNF 195

Query: 186 -------------IPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFF 232
                        IP  S  E          HPTQKPE LL++I+++S+ P D I DPF 
Sbjct: 196 RDTMPSNFWDDISIPYWSMPENTG-------HPTQKPEKLLAKIILASSNPNDFIFDPFA 248

Query: 233 GSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIE 275
           GSG+S   A KL R ++GIE    Y      R+  ++   +I+
Sbjct: 249 GSGSSLVTAAKLNRRYLGIEQSLLYCAWGQYRLNQIKDDPSIQ 291


>gi|259502088|ref|ZP_05744990.1| conserved hypothetical protein [Lactobacillus antri DSM 16041]
 gi|259169901|gb|EEW54396.1| conserved hypothetical protein [Lactobacillus antri DSM 16041]
          Length = 326

 Score =  103 bits (256), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 78/274 (28%), Positives = 123/274 (44%), Gaps = 49/274 (17%)

Query: 20  KDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWD-KFSSF 78
           +D+ I G+S  V+ + P +  DL   DPPYNL              D   D  + K  S 
Sbjct: 46  RDRSINGDSFQVVRQFPDRFADLALVDPPYNL--------------DKRYDGLNFKHQST 91

Query: 79  EAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
             Y  +T+ W+   +  L P  +L+V   +     +  +L   NF + N I W++     
Sbjct: 92  GEYQEYTQRWIDLIKPKLTPTASLYVFADWQTSVALAPVLA-ANFTVKNRITWQREKG-- 148

Query: 139 NFRGRR--FQNAHETLIWASPSPKAKGYTFNYDALK------AANEDVQMRSDWLIPICS 190
             RG +  ++N  E + + +   +   YTFN D +K      A   +     DW     S
Sbjct: 149 --RGAKGNWKNGMEDIWFLTMDERE--YTFNVDQVKQRRQVIAPYRENGQAKDWH---ES 201

Query: 191 GSERLRNKDGEKL----------------HPTQKPEALLSRILVSSTKPGDIILDPFFGS 234
            + R R+                      HPTQKPE LL++++++S+ PGD++LDPF G+
Sbjct: 202 AAGRFRDTMPSNFWDDISIPYWSMAENTGHPTQKPEKLLAKLILASSNPGDLVLDPFAGA 261

Query: 235 GTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASV 268
           G+S   AKKL R F+GIE  + Y      R+ + 
Sbjct: 262 GSSLVTAKKLDRHFVGIEQSRLYTAWGVYRLQAA 295


>gi|296160132|ref|ZP_06842951.1| DNA methylase N-4/N-6 domain protein [Burkholderia sp. Ch1-1]
 gi|295889606|gb|EFG69405.1| DNA methylase N-4/N-6 domain protein [Burkholderia sp. Ch1-1]
          Length = 249

 Score =  103 bits (256), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 75/256 (29%), Positives = 110/256 (42%), Gaps = 54/256 (21%)

Query: 19  WKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSF 78
           W D+   G+   +++ +PA   D    DPPY           D SL+      WD+  + 
Sbjct: 3   WLDQCHFGDCRELMKAMPAAIADACITDPPYG----------DTSLI------WDRRCA- 45

Query: 79  EAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
                    W+    RVLKP  ++WV GS   +  +   +    F    +IVWRK N   
Sbjct: 46  --------GWIDQVSRVLKPASSIWVFGSMRFVATLFAEMDAAGFRYGQEIVWRKQNGT- 96

Query: 139 NFRGRRFQNAHETLI------WAS--PSPKAKG--------------YTFNYDALKAANE 176
            F   RF+  HE  I      W     +P+                 +T N +A    +E
Sbjct: 97  GFHNDRFRRVHEFAIQFYRGAWEDVFKAPQYSNDATARTVRRKTRPTHTGNIEAGHYVSE 156

Query: 177 DVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGT 236
           D   R      +      + N+ G  LHPTQKP A+++ ++  S  PG ++LDPF GSG+
Sbjct: 157 DGGPR------LVQSVIEVPNEHGRALHPTQKPLAIIAPLIAYSVPPGGVVLDPFLGSGS 210

Query: 237 SGAVAKKLRRSFIGIE 252
           +G  AK+L R FIG E
Sbjct: 211 TGIAAKQLGRHFIGCE 226


>gi|170691068|ref|ZP_02882234.1| DNA methylase N-4/N-6 domain protein [Burkholderia graminis C4D1M]
 gi|170144317|gb|EDT12479.1| DNA methylase N-4/N-6 domain protein [Burkholderia graminis C4D1M]
          Length = 303

 Score =  102 bits (255), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 70/260 (26%), Positives = 129/260 (49%), Gaps = 33/260 (12%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           +++  + ++ +  +P  S+DLI  DPPY L   G+ Y  D  +            + + +
Sbjct: 39  QLLNRDFLTDVANIPDASIDLILCDPPYGL---GKDYGNDSDM-----------RTGDDF 84

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFR 141
            A+TR WL      LKP+G+L++  ++     I + L+     ++N+I+W +  P     
Sbjct: 85  LAWTRGWLELAIPKLKPSGSLYIFCTWQYAPEIFSFLKT-KLTMINEIIWDRRVPSMGGT 143

Query: 142 GRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMR---------SDWLIPICSGS 192
            RRF + H+ + + + S   K Y F+ D ++   + V  +         S WL    +  
Sbjct: 144 TRRFTSVHDNIGFFAVS---KDYYFDLDPVRIPYDAVTKKARSRKLFEGSKWLELGYNPK 200

Query: 193 E-----RLRNKDGEKL-HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRR 246
           +     RL  +  E++ HPTQKP  ++ R++++S   G  +LDPF GSGT+     + +R
Sbjct: 201 DVWSVSRLHRQHAERVDHPTQKPLEIVERMVLASCPKGGRVLDPFMGSGTTAVACARQQR 260

Query: 247 SFIGIEMKQDYIDIATKRIA 266
            F+G E+ + Y  IA +R++
Sbjct: 261 EFVGYEINESYCAIARERVS 280


>gi|295700770|ref|YP_003608663.1| DNA methylase N-4/N-6 domain protein [Burkholderia sp. CCGE1002]
 gi|295439983|gb|ADG19152.1| DNA methylase N-4/N-6 domain protein [Burkholderia sp. CCGE1002]
          Length = 304

 Score =  102 bits (255), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 71/260 (27%), Positives = 128/260 (49%), Gaps = 33/260 (12%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           +++  + ++ +  +P  S+DLI  DPPY L   G+ Y  D  +            + E +
Sbjct: 39  QLLNRDFLTDVANIPDGSIDLIVCDPPYGL---GKDYGNDSDM-----------RTGEEF 84

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFR 141
             +TR WL      LKP+G+L++  ++     I + L+     ++N+I+W +  P     
Sbjct: 85  LVWTRGWLELAVPKLKPSGSLYIFCTWQYAPEIFSFLKT-KLVMVNEIIWDRRVPSMGGT 143

Query: 142 GRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMR---------SDWLIPICSGS 192
            RRF + H+ + + + S   K Y F+ D ++   + V  +         S WL    +  
Sbjct: 144 TRRFTSVHDNIGFFAVS---KDYFFDLDPVRIPYDAVTKKARSRKLFEGSKWLELGYNPK 200

Query: 193 E-----RLRNKDGEKL-HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRR 246
           +     RL  +  E++ HPTQKP  ++ R+++SS   G  +LDPF GSGT+     + +R
Sbjct: 201 DVWSVSRLHRQHAERVAHPTQKPLEIVERMVLSSCPKGGRVLDPFMGSGTTAVACVRHQR 260

Query: 247 SFIGIEMKQDYIDIATKRIA 266
            F+G E+ + Y  IA +R++
Sbjct: 261 EFVGYEINESYCAIARERVS 280


>gi|148654309|ref|YP_001274514.1| adenine-specific DNA-methyltransferase [Roseiflexus sp. RS-1]
 gi|148566419|gb|ABQ88564.1| Site-specific DNA-methyltransferase (adenine-specific) [Roseiflexus
           sp. RS-1]
          Length = 303

 Score =  102 bits (254), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 85/283 (30%), Positives = 135/283 (47%), Gaps = 50/283 (17%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYN---LQLNGQLYRPDHSLVDAVTDSWDKFSS- 77
           KI   ++I VL  LP++SVDLI+ DPP+N   +Q   QL        D V     ++ S 
Sbjct: 14  KIYLADNIDVLRTLPSESVDLIYIDPPFNTGKVQERTQLKTVRSESGDRVGFQGHRYESI 73

Query: 78  ----------FEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNL--NFWI 125
                     F+ Y AF    L+   R+L P+G L+V   Y  +     +L  +      
Sbjct: 74  VVGKKRFADLFDDYLAFLEPRLVEAHRILAPHGCLYVHLDYREVHYCKVLLDAIFDRACF 133

Query: 126 LNDIVWRKSNPMPNFRGR---RFQNAHETLIWASPSPKAKGYTFNYDAL----------- 171
           LN+I+W       ++ GR   R+   H+T++  +  P    + FN DA+           
Sbjct: 134 LNEIIWAY-----DYGGRPRDRWPPKHDTILLYAKVPGQ--HVFNLDAIERIPYMAPGLV 186

Query: 172 ---KAANEDVQMRSDW--LIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDI 226
              KAA   +   + W  ++P  +GSE    K G   +PTQKP  +L RI+ +S+ PG +
Sbjct: 187 GPEKAARGKLPTDTWWHTIVP-TNGSE----KTG---YPTQKPLGILRRIIQASSHPGAV 238

Query: 227 ILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQ 269
           +LD F GSGT+G  A +L R FI ++  Q+ + +  +R   ++
Sbjct: 239 VLDFFAGSGTTGIAALELGRRFILVDNSQEALQVMARRFDGIR 281


>gi|209518946|ref|ZP_03267756.1| DNA methylase N-4/N-6 domain protein [Burkholderia sp. H160]
 gi|209500598|gb|EEA00644.1| DNA methylase N-4/N-6 domain protein [Burkholderia sp. H160]
          Length = 304

 Score =  102 bits (254), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 71/260 (27%), Positives = 127/260 (48%), Gaps = 33/260 (12%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           +++  + ++ +  +P  S+DLI  DPPY L   G+ Y  D  +            + E +
Sbjct: 39  QLLNRDFLTDVANIPDGSIDLIVCDPPYGL---GKDYGNDSDM-----------RTGEEF 84

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFR 141
             +TR WL      LKP G+L++  ++     I + L+     ++N+I+W +  P     
Sbjct: 85  LVWTRGWLELAVPKLKPTGSLYIFCTWQYAPEIFSFLKT-KLTMVNEIIWDRRVPSMGGT 143

Query: 142 GRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMR---------SDWLIPICSGS 192
            RRF + H+ + + + S   K Y F+ D ++   + V  +         S WL    +  
Sbjct: 144 TRRFTSVHDNIGFFAVS---KDYFFDLDPVRIPYDAVTKKARSRKLFEGSKWLELGYNPK 200

Query: 193 E-----RLRNKDGEKL-HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRR 246
           +     RL  +  E++ HPTQKP  ++ R+++SS   G  +LDPF GSGT+     + +R
Sbjct: 201 DVWSVSRLHRQHAERVAHPTQKPLEIVERMVLSSCPKGGRVLDPFMGSGTTAVACVRHQR 260

Query: 247 SFIGIEMKQDYIDIATKRIA 266
            F+G E+ + Y  IA +R++
Sbjct: 261 EFVGYEINESYCAIARERVS 280


>gi|325996643|gb|ADZ52048.1| type IIS restriction enzyme M1 protein [Helicobacter pylori 2018]
 gi|325998232|gb|ADZ50440.1| type IIS restriction enzyme M1 protein [Helicobacter pylori 2017]
          Length = 258

 Score =  102 bits (253), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 79/264 (29%), Positives = 120/264 (45%), Gaps = 46/264 (17%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           +KI   +  + L+KL  KSVDL   DPPYNL++                 SWD F + E 
Sbjct: 2   NKIYIEDVFTFLDKLEDKSVDLAIIDPPYNLKIA----------------SWDSFKNDEE 45

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           +  F+ AW+      +K  G+ ++  +  N       L +     LN I W K +   N 
Sbjct: 46  FLTFSYAWIDKVLPKIKDTGSFYIFNTPFNCALFLAYLCHKKAHFLNFITWVKKDGFANA 105

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQM------------RSDWLIPI 188
           + +R+ +A E++++ S     K YTFN D ++ A E  +                W  P 
Sbjct: 106 K-KRYNHAQESILFYSMH--KKNYTFNADEVRTAYESTERIKHAQSKGILKNNKRWF-PN 161

Query: 189 CSG----------SERLRNKDGEKL----HPTQKPEALLSRILVSSTKPGDIILDPFFGS 234
             G          S+R   K+  K+    HP+ KP+AL+ R++ +S+   D+ILD F GS
Sbjct: 162 PKGKLCLDVWEITSQRHVEKENGKILKPKHPSIKPKALIERMIKASSNENDLILDLFSGS 221

Query: 235 GTSGAVAKKLRRSFIGIEMKQDYI 258
           G    VAK L R+FIG E    Y+
Sbjct: 222 GMISLVAKSLGRNFIGCETHAGYV 245


>gi|261837492|gb|ACX97258.1| type IIS m6A methylase [Helicobacter pylori 51]
          Length = 247

 Score =  102 bits (253), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 78/257 (30%), Positives = 120/257 (46%), Gaps = 44/257 (17%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           +KI   +  + L+KL  KSVDL   DPPYNL++                 SWD F + E 
Sbjct: 4   NKIYIEDVFTFLDKLEDKSVDLAIIDPPYNLKIA----------------SWDSFKNDEE 47

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           +  F+ AW+      LK  G+ ++  +  N       L +     LN I W K +   N 
Sbjct: 48  FLTFSYAWIDKMLPKLKDTGSFYIFNTPFNCALFLAYLCHKKVHFLNFITWVKKDGFANA 107

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALK-----------AANEDVQMRSDWLIPIC 189
           + +R+ +A E++++ S     K YTFN D ++           A N+ +   +    P  
Sbjct: 108 K-KRYNHAQESILFYSMH--KKNYTFNADEIRTTYESTERIKHAQNKGILKNNKRWFPNP 164

Query: 190 SG----------SERLRNKDGEKL----HPTQKPEALLSRILVSSTKPGDIILDPFFGSG 235
            G          S+R   K+  K+    HP+ KP+AL+ R++ +S+   D+ILD F GSG
Sbjct: 165 KGKLCLDVWEITSQRHVEKENGKILKPKHPSIKPKALIERMIKASSHKNDLILDLFSGSG 224

Query: 236 TSGAVAKKLRRSFIGIE 252
            +  VAK L R+FIG E
Sbjct: 225 MTSLVAKSLGRNFIGCE 241


>gi|323345089|ref|ZP_08085313.1| modification methylase BglII (N(4)) [Prevotella oralis ATCC 33269]
 gi|323094359|gb|EFZ36936.1| modification methylase BglII (N(4)) [Prevotella oralis ATCC 33269]
          Length = 260

 Score =  102 bits (253), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 78/271 (28%), Positives = 129/271 (47%), Gaps = 43/271 (15%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           DKI   +S   + ++P KSV L+   PPYN+ ++      +  +V +    +    S   
Sbjct: 2   DKIF-NHSSEFMSEIPDKSVSLMVTSPPYNIDISYGNKWKNRRIVSSKGKKYADKQSEAD 60

Query: 81  YDAFTRAWLLACRRVLKPNGTLW--VIGSYHNI-----FRIGTMLQNLNFWILNDIVWRK 133
           Y       +   +RVLK +G +W  +   Y N      F I    +++  ++ N ++W  
Sbjct: 61  YRKMLDKVIKETKRVLKDDGQIWFNIKNRYENCVIQPPFWIMEYFKDM--YLKNIVIW-- 116

Query: 134 SNPMPNF-----RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSD----- 183
                NF       +RF + +E + + + +     YTFN D +K     +  R D     
Sbjct: 117 -----NFDWGGATQKRFCSRYEYVFFFTKN--KDKYTFNLDDVKIPA--LNYRPDRYKSQ 167

Query: 184 -------WLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGT 236
                  W I + SG+   R +     HP+Q PE L+ RI+   T  GD++LDPF GSGT
Sbjct: 168 LKNPTDVWKISLVSGNSPERTE-----HPSQYPEELVERIIKVGTHEGDLVLDPFMGSGT 222

Query: 237 SGAVAKKLRRSFIGIEMKQDYIDIATKRIAS 267
           +  VAK+L R ++G E++ +YI+IA KR+ +
Sbjct: 223 TAVVAKRLNRRYVGYEIEPEYIEIANKRLEN 253


>gi|325564297|gb|ADZ31432.1| M.DraI [Deinococcus radiophilus]
          Length = 328

 Score =  101 bits (252), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 83/287 (28%), Positives = 133/287 (46%), Gaps = 61/287 (21%)

Query: 20  KDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSF- 78
           ++KII  +    L+ LP   VDL+  DPPYNL    ++Y            +  KFS   
Sbjct: 40  RNKIINQDLFDCLDNLPDAFVDLMIIDPPYNLD---KVY------------AGKKFSQTD 84

Query: 79  -EAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPM 137
            E Y  +  +WL    R+LKP+ T+++   + +   I ++       I + I W +    
Sbjct: 85  DETYKEWVDSWLSRLIRLLKPDATVYICCDWQSSNVIHSVASKY-LKIRSRITWEREKG- 142

Query: 138 PNFRGRR--FQNAHETLIWASPSPKAKGYTFNYDALKAANEDV----------------- 178
              RG +  ++N  E + + +     K Y F+ +A+K     +                 
Sbjct: 143 ---RGSKDNWKNCSEDIWYCTV---GKKYFFDVEAVKLMKRVIAPYRDGDGKPKDWSEKA 196

Query: 179 ----------QMRSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIIL 228
                      + +D  IP  S  E   N D    HPTQKPE L+++++VSS+K GD+I 
Sbjct: 197 EGKYRLTHPSNLWTDISIPFWSMPE---NTD----HPTQKPEKLIAKLIVSSSKKGDMIF 249

Query: 229 DPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIE 275
           DPF GSGTS   AKKL R+++GIE+ ++Y  +A  R+   +    I+
Sbjct: 250 DPFMGSGTSCVTAKKLGRNYLGIEISEEYCKMAAARLIRAEDDKRIQ 296


>gi|317014760|gb|ADU82196.1| type IIS restriction enzyme M1 protein (mod) [Helicobacter pylori
           Gambia94/24]
          Length = 260

 Score =  101 bits (252), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 79/264 (29%), Positives = 119/264 (45%), Gaps = 46/264 (17%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           +KI   +  + L+KL  KSVDL   DPPYNL++                 SWD F + E 
Sbjct: 4   NKIYIEDVFTFLDKLEDKSVDLAIIDPPYNLKIA----------------SWDSFKNDEE 47

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           +  F+ AW+      +K  G+ ++  +  N       L       LN I W K +   N 
Sbjct: 48  FLTFSYAWIDKVLPKIKDTGSFYIFNTPFNCALFLAYLCQKKAHFLNFITWVKKDGFANA 107

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQM------------RSDWLIPI 188
           + +R+ +A E++++ S     K YTFN D ++ A E  +                W  P 
Sbjct: 108 K-KRYNHAQESILFYSMH--KKNYTFNADEVRTAYESTERIKHAQSKGILKNNKRWF-PN 163

Query: 189 CSG----------SERLRNKDGEKL----HPTQKPEALLSRILVSSTKPGDIILDPFFGS 234
             G          S+R   K+  K+    HP+ KP+AL+ R++ +S+   D+ILD F GS
Sbjct: 164 PKGKLCLDVWEITSQRHVEKENGKILKPKHPSIKPKALIERMIKASSNENDLILDLFSGS 223

Query: 235 GTSGAVAKKLRRSFIGIEMKQDYI 258
           G    VAK L R+FIG E    Y+
Sbjct: 224 GMISLVAKSLGRNFIGCETHAGYV 247


>gi|87306976|ref|ZP_01089122.1| adenine-specific methyltransferase [Blastopirellula marina DSM
           3645]
 gi|87290349|gb|EAQ82237.1| adenine-specific methyltransferase [Blastopirellula marina DSM
           3645]
          Length = 309

 Score =  101 bits (252), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 82/281 (29%), Positives = 120/281 (42%), Gaps = 54/281 (19%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           DK+   + I  + KLP  SVDL+FADPP+N+     +Y              D   S + 
Sbjct: 7   DKLKNVDCIQGMSKLPDGSVDLVFADPPFNIGFKYDVY--------------DDRRSADE 52

Query: 81  YDAFTRAWLLACRRVLKPNGTLWV-IGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPN 139
           Y  ++RAW+    RVLK +G+ W+ IG            ++L     N +VW  +  M  
Sbjct: 53  YLEWSRAWMEQVARVLKSDGSFWLAIGDDFAAELKVLATRDLGMHCRNWVVWYYTFGM-- 110

Query: 140 FRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAAN------------------------ 175
               +F  +H  L +    P+   +TFN  +++  +                        
Sbjct: 111 HCKAKFTRSHTHLFYFVKDPE--NFTFNDMSVRVPSARMLVYGDRRANPKGRLPDDTWVL 168

Query: 176 ------EDVQMRSD-WLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIIL 228
                 E  Q   D W  P  +G+ + R       H  Q PE LL RI+  S+  G+ +L
Sbjct: 169 RPQDIPESFQAEEDTWHFPRVAGTFKER----AGFHGCQMPEQLLGRIIKVSSSEGETVL 224

Query: 229 DPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQ 269
           DPF GSG++  VAKKL R  +G EM  +Y   A  RI  VQ
Sbjct: 225 DPFAGSGSTLVVAKKLGRRHLGFEMSPEYAAAAQARIDEVQ 265


>gi|315231720|ref|YP_004072156.1| modification methylase [Thermococcus barophilus MP]
 gi|315184748|gb|ADT84933.1| modification methylase [Thermococcus barophilus MP]
          Length = 312

 Score =  100 bits (250), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 77/268 (28%), Positives = 139/268 (51%), Gaps = 32/268 (11%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           D+II G+ +  + KL  K V L F DPP+N    G+ YR            ++   S E 
Sbjct: 4   DEIILGDCLEWIPKL--KGVHLSFLDPPFN---QGKEYR-----------FFNDNLSEEE 47

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRK-SNPMPN 139
           Y  + +  +    +V +  G ++ +    N   +  +L+   + + N I+W+K ++ +P 
Sbjct: 48  YWGWMKEVVREIYKVTEKGGAIYFMQREKNTEWVLRILRETGWTLQNLIIWKKMASAVP- 106

Query: 140 FRGRRFQNAHETLIWASPSPKAKGYT---FNYDAL---KAANEDVQMRSDWLIPI----- 188
            +  RF  A++ + +A+   K + +     +Y      K   E+    +D    I     
Sbjct: 107 -QRYRFNKAYQIIAFATKGKKPRVFNKLRVDYPLAPWHKYPRENGIYLTDVWDDIRELTS 165

Query: 189 --CSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRR 246
              +G E LR++ G+++H  Q P ALL RI++SST PGD++LDPF G+GT+  VAK+L+R
Sbjct: 166 GYFAGDEPLRDESGKRIHLQQSPVALLLRIILSSTMPGDLVLDPFAGTGTTLVVAKQLKR 225

Query: 247 SFIGIEMKQDYIDIATKRIASVQPLGNI 274
            ++GIE+   Y+++  KR++ ++   +I
Sbjct: 226 HYVGIEIDPHYVEVIKKRLSKLRKADDI 253


>gi|325107355|ref|YP_004268423.1| DNA methylase N-4/N-6 domain protein [Planctomyces brasiliensis DSM
           5305]
 gi|324967623|gb|ADY58401.1| DNA methylase N-4/N-6 domain protein [Planctomyces brasiliensis DSM
           5305]
          Length = 625

 Score =  100 bits (250), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 81/311 (26%), Positives = 137/311 (44%), Gaps = 80/311 (25%)

Query: 20  KDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFE 79
           ++ I+ G+ ++ ++ LP+ SVDLIFADPP+N+     +Y+                 + +
Sbjct: 9   RNTILPGDCVAGMQSLPSGSVDLIFADPPFNIGYEYDVYK--------------DVLAGD 54

Query: 80  AYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPN 139
            Y A+++ W+ A    LKP+GT W+         +    + + F + + ++W  +  + N
Sbjct: 55  QYVAWSKDWMQAAYDCLKPDGTFWLAIGDEYAAELKVTAREIGFHMRSWVIWYYTFGV-N 113

Query: 140 FRGRRFQNAHETLIW---------------ASPSPKAKGYTFNYDALKAANEDVQMRSD- 183
            R R+F  +H  L +               A+  P A+   +N    K AN   ++  D 
Sbjct: 114 CR-RKFSRSHAHLFYFVKNADEFTFLDDEPANRIPSARQLVYND---KRANPAGRLPDDT 169

Query: 184 WLI-PICSGSE---------------------RLRNKDGEK------------------- 202
           W+I P  +  E                      LR +D E                    
Sbjct: 170 WIISPDTAEGELQLPDSIVQELREGMPGEQTWTLRPQDLESCFQAEEDTWYFPRVAGTFK 229

Query: 203 ----LHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYI 258
                H  Q PE LL RI+ S ++PG+++LDPF GS T+ AVAKKL R+++G E+ +DY+
Sbjct: 230 ERAGFHGCQMPEQLLGRIVRSCSRPGELVLDPFSGSATTLAVAKKLNRNYLGFELSEDYV 289

Query: 259 DIATKRIASVQ 269
                R+  V+
Sbjct: 290 AHGLARLDGVR 300


>gi|167044904|gb|ABZ09571.1| putative DNA methylase [uncultured marine crenarchaeote
           HF4000_APKG8D22]
          Length = 255

 Score =  100 bits (250), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 67/256 (26%), Positives = 123/256 (48%), Gaps = 26/256 (10%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           +KI   + I  ++ +P + +DL+  DPP+ +    +    + +    V   + +    + 
Sbjct: 2   NKIYNKDCIVGMKAIPNEKIDLVITDPPFAINFKAKKANYNRT-ASRVLSGYHEIKVEDY 60

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           YD FT AW+    R+LK +G+++V   ++N+  I T L +  F  +N I+W+    +   
Sbjct: 61  YD-FTNAWMYEIYRILKKSGSMYVFSGWNNLKDILTALDDNGFTTINHIIWKYQFGVVT- 118

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRS--------DWLIPICSGS 192
             ++F  +H   ++     K + + F Y   K   +    RS         W+I      
Sbjct: 119 -SKKFVTSHYHCLFVCKDNKKRKF-FPYSRFKKNAKTSDGRSLHYKDKEDVWII------ 170

Query: 193 ERLRNKD---GEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFI 249
               N++   G+   PT+ P  ++ +IL  S++  D++LDPF GSG    ++K L R ++
Sbjct: 171 ----NREYWTGDDKTPTKLPAEIIKKILQYSSQKTDLVLDPFLGSGQVAVISKMLGRRYL 226

Query: 250 GIEMKQDYIDIATKRI 265
           G E+ + Y D ATKRI
Sbjct: 227 GFEIVKPYYDFATKRI 242


>gi|163845918|ref|YP_001633962.1| DNA methylase N-4/N-6 domain-containing protein [Chloroflexus
           aurantiacus J-10-fl]
 gi|222523640|ref|YP_002568110.1| DNA methylase N-4/N-6 domain-containing protein [Chloroflexus sp.
           Y-400-fl]
 gi|163667207|gb|ABY33573.1| DNA methylase N-4/N-6 domain protein [Chloroflexus aurantiacus
           J-10-fl]
 gi|222447519|gb|ACM51785.1| DNA methylase N-4/N-6 domain protein [Chloroflexus sp. Y-400-fl]
          Length = 400

 Score =  100 bits (248), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 84/291 (28%), Positives = 143/291 (49%), Gaps = 40/291 (13%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           ++ G+   VL+ +   S+DL++ DPP+  Q    L   D +   +  D+W+   S E Y 
Sbjct: 3   VLCGDCRIVLQSINDSSIDLVYMDPPFFTQKTHALVNRDGNASYSFEDTWE---SIETYL 59

Query: 83  AFTRAWLLACRRVLKPNGTLWV----IGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMP 138
           AF R  L+ C+RVLK  G+++V      S+H    +  +    +F   ++I+W       
Sbjct: 60  AFMREVLIQCKRVLKDTGSIFVHCDRSASHHLRVLLDQIFGPEHFQ--SEIIWTYRRWSN 117

Query: 139 NFRGRRFQNAHETLIWASPSPKAK--------GYTFNYDAL---KAANEDVQ--MRSDWL 185
           + +G     AH+T+ + S +   K          T N D +   +A NE  +   R D  
Sbjct: 118 SKKG--LLPAHQTIYFYSKTENFKFNVLFTDYSPTTNIDQILQARARNEKGKSVYRRDQH 175

Query: 186 IPICSGSER-------------LRNKDGEKL-HPTQKPEALLSRILVSSTKPGDIILDPF 231
             I +G E+             L  K  E++ +PTQKP  LL RI+  +T  GD +LDPF
Sbjct: 176 GNIVAGKEKKGVPLSDVWYIPFLNPKAKERVGYPTQKPVLLLERIIKIATDSGDSVLDPF 235

Query: 232 FGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGK 282
            GSGT+   AK L R++IGI++ ++ + ++ +R+   QP+ +    ++ G+
Sbjct: 236 CGSGTTLVAAKLLGRTYIGIDISREAVSLSEERLR--QPIKSESQLLVVGE 284


>gi|218439992|ref|YP_002378321.1| DNA methylase N-4/N-6 domain protein [Cyanothece sp. PCC 7424]
 gi|218172720|gb|ACK71453.1| DNA methylase N-4/N-6 domain protein [Cyanothece sp. PCC 7424]
          Length = 305

 Score = 99.4 bits (246), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 75/265 (28%), Positives = 123/265 (46%), Gaps = 45/265 (16%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           DKI+ G+ + +  K+P +S+D+ FADPP+N +               + D+ +    F+ 
Sbjct: 7   DKILLGDCLDLFSKIPDESIDVTFADPPFNFK----------KKYGNIKDNLE----FKE 52

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTML-------QNLNFWILNDIVWRK 133
           Y  +   W+    RV KP+G++++    HNI +  T          N   WI  D     
Sbjct: 53  YLKWCELWIDEMIRVTKPSGSIFI----HNIPKWLTYYCSFLNEKSNFRHWISWDA---P 105

Query: 134 SNPMPNFRGRRFQNAHE-TLIWASPSPKAKGYTFNYDALKAAN-----EDVQMRSDWLIP 187
           + PM    G+  Q +H   L +A    K K Y   Y   +        +D   + D + P
Sbjct: 106 TAPM----GKTLQPSHYGILFYAKTLAKNKFYEIRYSHKRCRKCNYLYKDYGGKKDSIHP 161

Query: 188 -------ICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAV 240
                  + +   R+++      HP Q P  LL RI++ ST   DIILDPF G+GT+   
Sbjct: 162 FGPLVSDVWTDIHRIKHNKYRDNHPCQLPVHLLERIILMSTDESDIILDPFMGTGTTAIA 221

Query: 241 AKKLRRSFIGIEMKQDYIDIATKRI 265
           AK+L R +IG E+ + Y+++A  ++
Sbjct: 222 AKRLGRHYIGFEINELYLEVAEGKL 246


>gi|153831218|ref|ZP_01983885.1| DNA methylase [Vibrio cholerae 623-39]
 gi|148873298|gb|EDL71433.1| DNA methylase [Vibrio cholerae 623-39]
          Length = 314

 Score = 99.4 bits (246), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 79/270 (29%), Positives = 124/270 (45%), Gaps = 43/270 (15%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           + +G+SI  L+ L ++SVDLIF+DPPYN+                    WDKF + E Y 
Sbjct: 41  LYEGDSIEWLKTLDSESVDLIFSDPPYNIN----------------KADWDKFETQEKYI 84

Query: 83  AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRG 142
            ++  W+    RVLK  GTL+V G +  I           F     ++W   N   N  G
Sbjct: 85  DWSMQWISEAYRVLKKEGTLYVCG-FSEILADIKHPSMKYFKSCRWLIWHYKNKA-NL-G 141

Query: 143 RRFQNAHETLIWASPSPKA-----------KGYTFNYDALKAAN----EDVQMRSDWLIP 187
             +  +HE+++    S K             G+T  Y +   A      +   R D   P
Sbjct: 142 NDWGRSHESILHLRKSNKKIFNVDDVRVPYGGHTLKYPSHPQAQTSQYSNGSKRKDVWTP 201

Query: 188 ICSGSE--------RLRNKDGEKL-HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSG 238
              G++           N  GEK  HPTQKPE L+ + +++S+  GD+++DPF GSGT+ 
Sbjct: 202 HPRGAKPRDVIEVPTTCNGMGEKTKHPTQKPEELVRKFILASSNEGDLVIDPFSGSGTTA 261

Query: 239 AVAKKLRRSFIGIEMKQDYIDIATKRIASV 268
            VA++L R +   ++   Y + A  R+ ++
Sbjct: 262 VVAEQLGRRWAACDINPQYNNWAMDRLDNI 291


>gi|159900577|ref|YP_001546824.1| site-specific DNA-methyltransferase [Herpetosiphon aurantiacus ATCC
           23779]
 gi|159893616|gb|ABX06696.1| Site-specific DNA-methyltransferase (adenine-specific)
           [Herpetosiphon aurantiacus ATCC 23779]
          Length = 281

 Score = 99.4 bits (246), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 79/283 (27%), Positives = 129/283 (45%), Gaps = 46/283 (16%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYN---LQLNGQLYRPDHSLVDAVTDSWDKFSS 77
           +K+  G++++VL  LPA S DLI+ DPP+N   +Q   QL        D V     ++SS
Sbjct: 2   NKLYFGDNLAVLATLPAASYDLIYIDPPFNTGKIQSRTQLRTVRSEQGDRVGFGGHRYSS 61

Query: 78  -----------FEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNL--NFW 124
                      F+ + AF    LL   R+LKP G+ +    Y  +     ++  +     
Sbjct: 62  IKIGERAYGDSFDDFLAFIEPRLLEAYRLLKPQGSFFFHIDYREVHYCKVLIDQIFGRDS 121

Query: 125 ILNDIVWRKSNPMPNFRGRR-FQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSD 183
            +N+I+W         R R+ +   H+T++W +  P+   YTFNYD +         R  
Sbjct: 122 FINEIIWAYDY---GARSRKKWSTKHDTILWYAKDPE--NYTFNYDQID--------RIP 168

Query: 184 WLIPICSGSERLR----------------NKDGEKLHPTQKPEALLSRILVSSTKPGDII 227
           ++ P   G E+                  N   +  +PTQKP A+L+RI+   + P D +
Sbjct: 169 YMAPGLVGPEKAARGKTPTDVWWNTIVSPNGKEKTGYPTQKPLAILNRIVRVHSNPNDQL 228

Query: 228 LDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQP 270
           LD F GSG+ G  A +  R+F  I+     I++  +R+A  +P
Sbjct: 229 LDFFAGSGSFGEAAARNGRNFTLIDQNPQAIEVMRQRLAFAEP 271


>gi|269926576|ref|YP_003323199.1| DNA methylase N-4/N-6 domain protein [Thermobaculum terrenum ATCC
           BAA-798]
 gi|269790236|gb|ACZ42377.1| DNA methylase N-4/N-6 domain protein [Thermobaculum terrenum ATCC
           BAA-798]
          Length = 276

 Score = 99.0 bits (245), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 77/271 (28%), Positives = 128/271 (47%), Gaps = 50/271 (18%)

Query: 26  GNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFT 85
           G+++S L+KL + SV L++ADPP+         R +   VD      D +   + Y  + 
Sbjct: 7   GDNLSFLKKLASGSVTLVYADPPF---------RTNRIRVDENGKYNDVWQGIDHYLEWL 57

Query: 86  RAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNL----NFWILNDIVWRKSNPMPNFR 141
              L    R+L  +GT ++     ++  +  ++ ++    NF   N+I+W  +      R
Sbjct: 58  APRLCEIHRILSEDGTFYLHLDRRSVHYVRLLMDDIFGANNFQ--NEIIWHYTG---GGR 112

Query: 142 G-RRFQNAHETLIWASPSPKAKGYTFNYDALKA--------ANEDVQMRSD--------- 183
           G R F + H+ ++      K + Y FN DA++         A   ++ RS          
Sbjct: 113 GSRHFPHKHDNILVYH---KTRKYKFNVDAVREPYAKTSGYARSGIRARSGKFYSPHPLG 169

Query: 184 ------WLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTS 237
                 W IPI +     R       +P+QKPE LL RI+V+S+  GDI+LDPF GSGT+
Sbjct: 170 KVLDDVWFIPIVNPLSPERTG-----YPSQKPEELLRRIIVASSDKGDIVLDPFCGSGTT 224

Query: 238 GAVAKKLRRSFIGIEMKQDYIDIATKRIASV 268
              A KL R +IG++   + I I  +R+ ++
Sbjct: 225 LVAAHKLERQWIGMDSSPEAISICIERLKAI 255


>gi|207722999|ref|YP_002253422.1| dna-methyltransferase (dna-modification methylase) protein
           [Ralstonia solanacearum MolK2]
 gi|206588188|emb|CAQ18757.1| dna-methyltransferase (dna-modification methylase) protein
           [Ralstonia solanacearum MolK2]
          Length = 272

 Score = 99.0 bits (245), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 75/252 (29%), Positives = 124/252 (49%), Gaps = 33/252 (13%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           D I   + I+ + +L   SV+L+ ADPPY L   G+ Y  D           DK S  EA
Sbjct: 7   DGIFNEDCIAGIGQLADGSVNLVIADPPYGL---GKDYGNDS----------DKLSG-EA 52

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           Y A++  W+ A    L  NG++++  ++     +  ML+     ++N+I+W +  P    
Sbjct: 53  YLAWSERWIEAVLPKLARNGSVYLFCTWQYAPELFVMLKR-RLAMINEIIWDRRVPSMGG 111

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAA--NEDVQMRS-------DWLIPICSG 191
             R+F + H+ + + + S   + Y F+ DA++     E  + RS        WL    + 
Sbjct: 112 STRKFSSVHDNIGFFAAS---RDYYFDVDAVRIPYDAETKKARSRKRFEGKKWLEVGYNP 168

Query: 192 SE-----RLRNKDGEKL-HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLR 245
            +     RL  +D E+  HPTQKP  L+ R++++S  PG ++LDPF GSGT+     +  
Sbjct: 169 KDVWSVSRLHRQDPERAEHPTQKPLELVERMVLASCPPGGLVLDPFLGSGTTAVACARRG 228

Query: 246 RSFIGIEMKQDY 257
           R F G E+  +Y
Sbjct: 229 RRFAGFEINAEY 240


>gi|300703719|ref|YP_003745321.1| site-specific DNA-methyltransferase (adenine-specific) [Ralstonia
           solanacearum CFBP2957]
 gi|299071382|emb|CBJ42701.1| Site-specific DNA-methyltransferase (adenine-specific) [Ralstonia
           solanacearum CFBP2957]
          Length = 272

 Score = 99.0 bits (245), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 75/252 (29%), Positives = 124/252 (49%), Gaps = 33/252 (13%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           D I   + I+ + +L   SV+L+ ADPPY L   G+ Y  D           DK S  EA
Sbjct: 7   DGIFNEDCIAGIGQLADGSVNLVIADPPYGL---GKDYGNDS----------DKLSG-EA 52

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           Y A++  W+ A    L  NG++++  ++     +  ML+     ++N+I+W +  P    
Sbjct: 53  YLAWSERWIEAVLPKLARNGSVYLFCTWQYAPELFVMLKR-RLAMINEIIWDRRVPSMGG 111

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAA--NEDVQMRS-------DWLIPICSG 191
             R+F + H+ + + + S   + Y F+ DA++     E  + RS        WL    + 
Sbjct: 112 STRKFSSVHDNIGFFAAS---RDYYFDVDAVRIPYDAETKKARSRKRFEGKKWLEVGYNP 168

Query: 192 SE-----RLRNKDGEKL-HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLR 245
            +     RL  +D E+  HPTQKP  L+ R++++S  PG ++LDPF GSGT+     +  
Sbjct: 169 KDVWSVSRLHRQDPERAEHPTQKPLELVERMVLASCPPGGLVLDPFLGSGTTAVACARRG 228

Query: 246 RSFIGIEMKQDY 257
           R F G E+  +Y
Sbjct: 229 RRFAGFEINAEY 240


>gi|207742815|ref|YP_002259207.1| dna-methyltransferase (dna-modification methylase) protein
           [Ralstonia solanacearum IPO1609]
 gi|206594209|emb|CAQ61136.1| dna-methyltransferase (dna-modification methylase) protein
           [Ralstonia solanacearum IPO1609]
          Length = 272

 Score = 99.0 bits (245), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 75/252 (29%), Positives = 124/252 (49%), Gaps = 33/252 (13%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           D I   + I+ + +L   SV+L+ ADPPY L   G+ Y  D           DK S  EA
Sbjct: 7   DGIFNEDCIAGIGQLADGSVNLVIADPPYGL---GKDYGNDS----------DKLSG-EA 52

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           Y A++  W+ A    L  NG++++  ++     +  ML+     ++N+I+W +  P    
Sbjct: 53  YLAWSERWIEAVLPKLARNGSVYLFCTWQYAPELFVMLKR-RLAMINEIIWDRRVPSMGG 111

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAA--NEDVQMRS-------DWLIPICSG 191
             R+F + H+ + + + S   + Y F+ DA++     E  + RS        WL    + 
Sbjct: 112 STRKFSSVHDNIGFFAAS---RDYYFDVDAVRIPYDAETKKARSRKRFEGKKWLEVGYNP 168

Query: 192 SE-----RLRNKDGEKL-HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLR 245
            +     RL  +D E+  HPTQKP  L+ R++++S  PG ++LDPF GSGT+     +  
Sbjct: 169 KDVWSVSRLHRQDPERAEHPTQKPLELVERMVLASCPPGGLVLDPFLGSGTTAVACARRG 228

Query: 246 RSFIGIEMKQDY 257
           R F G E+  +Y
Sbjct: 229 RRFAGFEINAEY 240


>gi|261393408|emb|CAX51044.1| putative DNA modification methylase [Neisseria meningitidis 8013]
 gi|325205032|gb|ADZ00486.1| adenine-specific methyltransferase HpaI [Neisseria meningitidis
           M01-240355]
          Length = 255

 Score = 99.0 bits (245), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 76/277 (27%), Positives = 134/277 (48%), Gaps = 55/277 (19%)

Query: 9   INENQNSIFEWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLN---------GQLYR 59
           +N  ++++ E+++K +KG+S+ +++ +P+ S+DLI   PPYNL+ +         G  ++
Sbjct: 4   LNLEKDTLAEFRNKFLKGDSLEIMKSIPSGSIDLIVTSPPYNLKNSTGNGMKDGRGGKWK 63

Query: 60  PDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRI-GTML 118
            + SL++  +D  D     E Y  + R  L    R+LK +G ++    Y++ +R+ G +L
Sbjct: 64  -NASLINGYSDHNDCMPHHE-YVEWQRNCLSEMYRLLKDDGAIF----YNHKWRVQGGLL 117

Query: 119 QNLN-----FWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKA 173
           Q+ +     F +   I+WR+                             G  FN      
Sbjct: 118 QDRHDIVSGFPVRQIIIWRRKG---------------------------GINFNKGYFLP 150

Query: 174 ANEDVQMRSDWLIPICSGSERLRN-----KDGEKLHPTQKPEALLSRILVSSTKPGDIIL 228
             E + M       +C G+ +  +     ++ +  HP   P AL+ RI+ S+     +IL
Sbjct: 151 TYEVIYMICKPKFSLCPGANKYGDVWEFTQEMKNPHPAPFPVALIERIISSTN--AKVIL 208

Query: 229 DPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRI 265
           DPF GSGT+   AKKL R FIGIE+  +YI +A +R+
Sbjct: 209 DPFMGSGTTAIAAKKLYREFIGIEISAEYIALAQERL 245


>gi|218960497|ref|YP_001740272.1| Modification methylase (fragment) [Candidatus Cloacamonas
           acidaminovorans]
 gi|167729154|emb|CAO80065.1| Modification methylase (fragment) [Candidatus Cloacamonas
           acidaminovorans]
          Length = 114

 Score = 98.6 bits (244), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 43/80 (53%), Positives = 63/80 (78%)

Query: 186 IPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLR 245
           +PI  G ER++ ++G  LHPTQKPE L+  IL++S+   D+ILDPFFG+GT+G+VA +L+
Sbjct: 26  MPIVQGKERIKGENGRALHPTQKPEKLIELILLASSDENDLILDPFFGTGTTGSVASRLK 85

Query: 246 RSFIGIEMKQDYIDIATKRI 265
           R++IGIE+ +DY +IA  RI
Sbjct: 86  RNWIGIEINEDYCNIAHNRI 105


>gi|194290204|ref|YP_002006111.1| DNA-methyltransferase [Cupriavidus taiwanensis LMG 19424]
 gi|193224039|emb|CAQ70048.1| DNA-METHYLTRANSFERASE (DNA-MODIFICATION METHYLASE) PROTEIN;
           Adenine-specific methyltransferase,
           N4/N6-methyltransferase family [Cupriavidus taiwanensis
           LMG 19424]
          Length = 309

 Score = 98.6 bits (244), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 70/252 (27%), Positives = 121/252 (48%), Gaps = 35/252 (13%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           ++ + +    + +LP  SVDLI ADPPY L   G+ Y  D  L+           S +AY
Sbjct: 29  RLFQEDMFEGIARLPDGSVDLIVADPPYGL---GKDYGNDSDLL-----------SGQAY 74

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFR 141
             ++  W+ A    L P GTL++  ++     +  ML+     ++N+I+W +  P     
Sbjct: 75  LDWSERWMDAVVPKLAPKGTLYLFCTWQYSPELFVMLKR-RLTMINEIIWDRRVPSMGGT 133

Query: 142 GRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSE-------- 193
            R+F + H+ + + +   +A+ Y F+ D ++    D + +     P   G +        
Sbjct: 134 TRKFSSVHDNIGFFA---RARDYYFDLDPVRIPY-DPETKKARSRPRFEGKKWLEVGYNP 189

Query: 194 -------RLRNKDGEKL-HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLR 245
                  R+  +D E+  HPTQKP  ++ R+++SS  PG ++LDPF GSGT+     +  
Sbjct: 190 KDLWSVSRIHRQDPERANHPTQKPLEIVERMVLSSCPPGGLVLDPFAGSGTTAVACLRHG 249

Query: 246 RSFIGIEMKQDY 257
           R F G E+  +Y
Sbjct: 250 RRFAGFEINPEY 261


>gi|73541991|ref|YP_296511.1| DNA methylase N-4/N-6 [Ralstonia eutropha JMP134]
 gi|72119404|gb|AAZ61667.1| DNA methylase N-4/N-6 [Ralstonia eutropha JMP134]
          Length = 304

 Score = 98.6 bits (244), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 68/254 (26%), Positives = 123/254 (48%), Gaps = 35/254 (13%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           ++ + +    + +LP  SVDL+ ADPPY L   G+ Y  D  L+           S +AY
Sbjct: 30  QLFQEDMFEGIARLPDGSVDLVVADPPYGL---GKDYGNDSDLL-----------SGDAY 75

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFR 141
             ++  W+ A    L P GTL++  ++     +  ML+     ++N+I+W +  P     
Sbjct: 76  LEWSERWMDAVCPKLAPKGTLYLFCTWQYSPELFVMLKR-RLTMINEIIWDRRVPSMGGT 134

Query: 142 GRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSE-------- 193
            R++ + H+ + + +   +A+ Y F+ D ++    D + +     P   G +        
Sbjct: 135 TRKYSSVHDNIGFFA---RARDYYFDLDPVRIPY-DPETKKARSRPRFEGKKWLEMGYNP 190

Query: 194 -------RLRNKDGEKL-HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLR 245
                  R+  +D E+  HPTQKP  ++ R+++SS  PG ++LDPF GSGT+     +  
Sbjct: 191 KDLWSISRIHRQDPERANHPTQKPLEIVERMVLSSCPPGGLVLDPFAGSGTTAVACLRHG 250

Query: 246 RSFIGIEMKQDYID 259
           R F G E+  +Y++
Sbjct: 251 RRFAGFEINPEYVE 264


>gi|161528827|ref|YP_001582653.1| DNA methylase N-4/N-6 domain-containing protein [Nitrosopumilus
           maritimus SCM1]
 gi|160340128|gb|ABX13215.1| DNA methylase N-4/N-6 domain protein [Nitrosopumilus maritimus
           SCM1]
          Length = 258

 Score = 98.2 bits (243), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 66/259 (25%), Positives = 122/259 (47%), Gaps = 32/259 (12%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDA-VTDSWDKFSSFE 79
           +KI   N I  +  +P   +DL+  DPP+ +    +  + +++   + V   +++    +
Sbjct: 7   NKIYNQNCIDGMSSIPKNKIDLVITDPPFAINFKAK--KANYNRTSSRVLSGYNEIKPED 64

Query: 80  AYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPN 139
            YD FT +W+    R+LK +G+++V   ++N+  I   L ++ F  +N I+W+    +  
Sbjct: 65  YYD-FTFSWMTEVYRILKDSGSMYVFSGWNNLKDILRALDDVGFVTINHIIWKYQFGVVT 123

Query: 140 FRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKD 199
              ++F  +H   ++     K + + F +   K  ++    RS            L  KD
Sbjct: 124 --KKKFVTSHYHCLYVCKDDKKRKF-FPFSRFKKEDKTKDGRS------------LHYKD 168

Query: 200 -------------GEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRR 246
                        G++  PT+ P  L+ +IL  S++  DI+LDPF GSG    V+K L R
Sbjct: 169 KEDVWDIKREYWTGDEKTPTKLPSELIQKILEYSSEKKDIVLDPFIGSGQVAVVSKSLGR 228

Query: 247 SFIGIEMKQDYIDIATKRI 265
            ++G E+  DY   A KR+
Sbjct: 229 RYLGFEIVPDYYKFAKKRL 247


>gi|296123807|ref|YP_003631585.1| DNA methylase N-4/N-6 domain protein [Planctomyces limnophilus DSM
           3776]
 gi|296016147|gb|ADG69386.1| DNA methylase N-4/N-6 domain protein [Planctomyces limnophilus DSM
           3776]
          Length = 306

 Score = 98.2 bits (243), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 82/296 (27%), Positives = 133/296 (44%), Gaps = 64/296 (21%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           ++++  + I+ L + PA SVDL FADPP+N+   G  Y       D   DS +     + 
Sbjct: 2   NQLLLEDCITGLAQQPAGSVDLAFADPPFNI---GYTY-------DVYADSKES----QQ 47

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           Y A+   W+ A  R L+P+GT W+         +    Q + F   + +VW  +  + N 
Sbjct: 48  YLAWCEEWIAAVYRALRPDGTFWLAIGDEYAAELKVAAQKIGFHTRSWVVWYYTFGV-NC 106

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYD--------------ALKAANEDVQMRSD-WL 185
           +  +F  +H  + +       + +TFN +              A K AN   ++  D W+
Sbjct: 107 K-FKFTRSHAHIFYFVKD--REKFTFNSEDPANRIPSARQLVYADKRANPKGRLPDDTWI 163

Query: 186 IPIC--------SGSERLRNKD-----------------------GEKLHPTQKPEALLS 214
           IP          S +  LR +D                        E  H  Q PE LL 
Sbjct: 164 IPPTVEEMARQTSATWVLRPQDLADRFTPTEDTWYFPRVAGTFKEREGFHGCQMPEQLLG 223

Query: 215 RILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQP 270
           RI+   + PG+++LDPF GS T+ AVAKKL R+++G ++ + Y+    KR+ S++P
Sbjct: 224 RIIRMCSNPGELVLDPFSGSATTLAVAKKLGRNYLGFDISEQYVTHGLKRLESIEP 279


>gi|308177941|ref|YP_003917347.1| site-specific DNA-methyltransferase [Arthrobacter arilaitensis
           Re117]
 gi|307745404|emb|CBT76376.1| site-specific DNA-methyltransferase [Arthrobacter arilaitensis
           Re117]
          Length = 308

 Score = 98.2 bits (243), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 75/280 (26%), Positives = 129/280 (46%), Gaps = 52/280 (18%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDK-------- 74
           +  G+++S+L  LP +S  LI+ DPP+N     +  R   ++V A     D+        
Sbjct: 30  VYHGDNLSILGSLPDQSFTLIYVDPPFNT--GRKQTRAQRTMVRAAEGEGDRTGFKGREY 87

Query: 75  ----------FSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNL--N 122
                       +F+ Y +F    L    R+L  +GTL+V   Y  +  +  +L  +   
Sbjct: 88  NTELGIARSYHDTFDDYLSFIEPRLREAHRLLAEDGTLYVHLDYREVHYVKVLLDQIFGR 147

Query: 123 FWILNDIVWRKSNPMPNFRGR---RFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQ 179
              LN+++W       ++  R   R+   H+T++     PK     +++D+ +   E   
Sbjct: 148 DCFLNELIWAY-----DYGARAKSRWPAKHDTILVYVKDPK----QYHFDSAEVDREPY- 197

Query: 180 MRSDWLIPICSGSERL--------------RNKDGEKLHPTQKPEALLSRILVSSTKPGD 225
           M    + P      +L              + K G   +PTQKPE +L RI+ +S++PGD
Sbjct: 198 MAPGLVTPEKRALGKLPTDVWWHTIVSPTGKEKTG---YPTQKPEGVLRRIVAASSRPGD 254

Query: 226 IILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRI 265
           ++LD F GSGT+GAVA KL R F+ I+   + I++   R+
Sbjct: 255 LVLDFFAGSGTTGAVAAKLGRQFVLIDQNPEAIEVMKARL 294


>gi|148990531|ref|ZP_01821666.1| type II DNA modification methyltransferase, putative [Streptococcus
           pneumoniae SP6-BS73]
 gi|147924219|gb|EDK75317.1| type II DNA modification methyltransferase, putative [Streptococcus
           pneumoniae SP6-BS73]
          Length = 325

 Score = 98.2 bits (243), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 80/289 (27%), Positives = 139/289 (48%), Gaps = 63/289 (21%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           ++KG+++ +L+ + + S+DLI+ DPP+  Q   +L   + +++ +  D+W   +S E Y 
Sbjct: 3   VLKGDNLEILKTIESSSIDLIYMDPPFFTQKTQKL-SNNKNIMYSFEDTW---TSIEDYK 58

Query: 83  AFTRAWLLACRRVLKPNGTLWV----IGSYH------NIFRIGTMLQNLNFWILNDIVWR 132
            F    L  C+RVLK +G+++V    I ++H      NIF +  M Q+       +I+W 
Sbjct: 59  EFLSVRLEECKRVLKNSGSIFVHCDKIANHHIRLILDNIFGVD-MFQS-------EIIWN 110

Query: 133 KSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANED---VQMRSD------ 183
                 + +G    N H+ + + S S   K  T   +     N D   V+ + D      
Sbjct: 111 YKRWSNSKKG--LLNNHQNIYFYSKSKDFKFNTIFTEYSSTTNIDQILVERKRDGNSKTI 168

Query: 184 -----------------------WLIPICSGSERLRNKDGEKL-HPTQKPEALLSRILVS 219
                                  W IP       L  K  E++ +PTQKP  LL +I+  
Sbjct: 169 YKVDNNGNYILAKEKNGVPLSDVWNIPF------LNPKAKERVGYPTQKPILLLEQIIKI 222

Query: 220 STKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASV 268
           +T   DI+LDPF GSGT+   +K L R+++GI++ ++ I+I  +R+ +V
Sbjct: 223 ATDKNDIVLDPFCGSGTTLVASKILNRNYMGIDLSEEAINITQQRLENV 271


>gi|163816174|ref|ZP_02207542.1| hypothetical protein COPEUT_02358 [Coprococcus eutactus ATCC 27759]
 gi|158448594|gb|EDP25589.1| hypothetical protein COPEUT_02358 [Coprococcus eutactus ATCC 27759]
          Length = 321

 Score = 98.2 bits (243), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 87/287 (30%), Positives = 128/287 (44%), Gaps = 55/287 (19%)

Query: 15  SIFEWKDKIIKGNSIS----VLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTD 70
           S FE   +I   +SIS     L++LP KS+ LI  DPPYNL+L G               
Sbjct: 31  SDFEMPAEIKLLHSISDCGVFLKQLPDKSIQLICIDPPYNLELAG--------------- 75

Query: 71  SWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFR----------IGTMLQN 120
            WD    +E Y  +   W+    RVL  NG++ + G     FR          I  + +N
Sbjct: 76  -WD---IYENYIEWASKWIYEAYRVLSDNGSMVIFGGIQ--FRDAKSGDLLDIIQYIRKN 129

Query: 121 LNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKA--ANED- 177
             F ++N I+W   N M   R   F N HE  IW     K+  Y F+ D+++   + ED 
Sbjct: 130 TKFKLVNTIIWHYKNGMSAHRF--FANRHEEAIWLV---KSNDYYFDLDSVRVPYSEEDL 184

Query: 178 -VQMRSDWLIPICSGSE----------RLRNKDGEKL-HPTQKPEALLSRILVSSTKPGD 225
            V +R   L P  +             RL     E++ HPTQKP A++ R + + + PG 
Sbjct: 185 KVALRDKRLNPETTRKGKNPTNVWEIGRLNGNSKERVGHPTQKPVAIIERFIKALSYPGA 244

Query: 226 IILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLG 272
            +LD F GSGT G V     R+ +  +     ++   K I+ ++ LG
Sbjct: 245 TVLDFFAGSGTVGRVCINEGRNCLMCDSDNKSLEYFAKHISLMEELG 291


>gi|296142048|gb|ADG95998.1| N6-adenine methyltransferase [Helicobacter pylori]
          Length = 214

 Score = 98.2 bits (243), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 70/207 (33%), Positives = 93/207 (44%), Gaps = 23/207 (11%)

Query: 40  VDLIFADPPYNLQLNGQLYRPDHSLVDAVT-DSWDK-FSSFEAYDAFTRAWLLACRRVLK 97
           VD I  DPPYN+ +         +    +    WDK F   E        W+     ++ 
Sbjct: 23  VDAIITDPPYNISVKNHFSTLKSAKRQGIDFGEWDKNFRLLE--------WIARYAPLVN 74

Query: 98  PNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASP 157
           PNG + +  SY  I  I   L+   F + + I W KSNPMP    RR+    E  +WA  
Sbjct: 75  PNGCMVIFCSYRFISYIADFLEENGFVVKDFIQWVKSNPMPRNLNRRYVQDTEFALWAVK 134

Query: 158 SPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRIL 217
             K   + FN    K  NE          P+ SG ER++       HPTQK  AL+ +I+
Sbjct: 135 --KKARWVFN----KPKNEKYLRPLILKSPVVSGLERVK-------HPTQKSLALMEKII 181

Query: 218 VSSTKPGDIILDPFFGSGTSGAVAKKL 244
              T P DI+LDPF GSGT+G   K L
Sbjct: 182 SIHTNPNDIVLDPFMGSGTTGLACKNL 208


>gi|88604170|ref|YP_504348.1| DNA methylase N-4/N-6 [Methanospirillum hungatei JF-1]
 gi|88189632|gb|ABD42629.1| DNA methylase N-4/N-6 [Methanospirillum hungatei JF-1]
          Length = 329

 Score = 97.8 bits (242), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 72/255 (28%), Positives = 124/255 (48%), Gaps = 24/255 (9%)

Query: 26  GNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFT 85
           G+ I     +P  +VDLI  DPPY ++   +L+R  +     VTD + +  + E Y++FT
Sbjct: 14  GDCIKGAALIPDNTVDLIITDPPYGIE-GDKLHRHYNRDESFVTDGYVEIPA-EEYESFT 71

Query: 86  RAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRF 145
           R W+L   R+L+P G+L+++  Y ++  I   L   +   +N I+WR +  +  F   ++
Sbjct: 72  RDWILQAERILRPGGSLYIVSGYTHLRHILNALYETSLEEVNHIIWRYNFGV--FTSLKY 129

Query: 146 QNAH-ETLIWASPSPKAKGYTFNYDALKAANE--------DVQMRSD-WLIPICSGSERL 195
            ++H   L +A P  K    TFN +   + +E        + Q R D W+I       ++
Sbjct: 130 VSSHYHILFYAKPGGKR---TFNTECRFSLSEKDENGGSLNYQDREDVWIINREYKPGKV 186

Query: 196 RNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQ 255
           +NK+       + P ALLS+I+  S+  GD++ D F G  ++   A  L R   G E+  
Sbjct: 187 KNKN-------ELPTALLSKIIQYSSNEGDLVCDLFLGGFSTAKTAIGLLRRATGFEISP 239

Query: 256 DYIDIATKRIASVQP 270
              D     + +V P
Sbjct: 240 VMYDAKIDEMMAVVP 254


>gi|295108399|emb|CBL22352.1| DNA modification methylase [Ruminococcus obeum A2-162]
          Length = 321

 Score = 97.8 bits (242), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 87/287 (30%), Positives = 128/287 (44%), Gaps = 55/287 (19%)

Query: 15  SIFEWKDKIIKGNSIS----VLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTD 70
           S FE   +I   +SIS     L++LP KS+ LI  DPPYNL+L G               
Sbjct: 31  SDFEMPAEIKLLHSISDCGDFLKQLPDKSIQLICIDPPYNLELAG--------------- 75

Query: 71  SWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFR----------IGTMLQN 120
            WD    +E Y  +   W+    RVL  NG++ + G     FR          I  + +N
Sbjct: 76  -WD---IYENYIEWASKWIDEAYRVLSDNGSMVIFGGIQ--FRDAKSGDLLDIIQYIRKN 129

Query: 121 LNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKA--ANED- 177
             F ++N I+W   N M   R   F N HE  IW     K+  Y F+ D+++   + ED 
Sbjct: 130 TKFKLVNTIIWHYKNGMSAHRF--FANRHEEAIWLV---KSNNYYFDLDSVRVPYSEEDL 184

Query: 178 -VQMRSDWLIPICSGSE----------RLRNKDGEKL-HPTQKPEALLSRILVSSTKPGD 225
            V +R   L P  +             RL     E++ HPTQKP A++ R + + + PG 
Sbjct: 185 KVALRDKRLNPETTRKGKNPTNVWEIGRLNGNSKERVGHPTQKPVAIIERFIKALSYPGA 244

Query: 226 IILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLG 272
            +LD F GSGT G V     R+ +  +     +D   K ++ ++ LG
Sbjct: 245 TVLDFFAGSGTVGRVCINEGRNCLMCDSDNKSLDYFAKHLSLMEELG 291


>gi|212639015|ref|YP_002315535.1| adenine specific DNA methylase Mod [Anoxybacillus flavithermus WK1]
 gi|212560495|gb|ACJ33550.1| Adenine specific DNA methylase Mod [Anoxybacillus flavithermus WK1]
          Length = 589

 Score = 97.8 bits (242), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 104/409 (25%), Positives = 167/409 (40%), Gaps = 94/409 (22%)

Query: 19  WKDKIIKGNSISVLEKLPAK---SVDLIFADPPYN--------LQLNGQLYRPDHSLVDA 67
           W +KI  G+++ V+  L  +    + LI+ DPP++        +Q+ G      +SL + 
Sbjct: 53  WMNKIFWGDNLQVMSHLLKEFRGKIKLIYIDPPFDSKADYKKRIQVRGNSTVSHNSLFEE 112

Query: 68  --VTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNL---- 121
              TD W    S + Y  F    L+  R +L  +G+++V   +H    I  +L  +    
Sbjct: 113 KQYTDIW----SNDEYLQFLYERLILMRELLAEDGSIFVHTDWHKSHHIRCLLDEVFGDS 168

Query: 122 -----NFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANE 176
                      +I+W  S  +     ++F+  HE + W +   K+  Y FN D ++    
Sbjct: 169 GDEMKKAGFKGEIIWYFS--LIGGNAKKFEKNHENIYWYT---KSSEYIFNKDDVR---- 219

Query: 177 DVQMRSDWLIPICSGSERLR-------NKDGEKL-------------------------- 203
             Q  S   +  C   E  R        +DGEKL                          
Sbjct: 220 --QPYSKEFLEQCKRDEEGRLYYTRGMGRDGEKLNRKHISYIHPLGKAPSDVWTDIKNYS 277

Query: 204 --------HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQ 255
                   +PTQKPEAL+ RI+ +++ PGDI+ D F GSGT+ AVA KL R FIG ++  
Sbjct: 278 PTGKERLGYPTQKPEALIERIIKAASNPGDIVFDCFMGSGTTQAVAMKLGRRFIGSDINL 337

Query: 256 DYIDIATKRIASV---QPLGNIELTVLTGKRTE----PRVAFNLLVERGLIQPGQILTNA 308
             +   TKR+ ++    P       V      E    P  A  LL+E   IQP    +  
Sbjct: 338 GAVQTTTKRLLNILREDPDLKTGFEVYNVNNYEFFRNPVQAKELLIEALEIQPLPNNSLY 397

Query: 309 QGNISATVCADGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGE 357
            G +      DG ++   ++   +R+  K    E    +++  FEK  E
Sbjct: 398 DGEL------DGRMV---KIMPTNRIATKADLGELIQNFDYRLFEKRRE 437


>gi|15901283|ref|NP_345887.1| type II DNA modification methyltransferase, putative [Streptococcus
           pneumoniae TIGR4]
 gi|14972920|gb|AAK75527.1| putative type II DNA modification methyltransferase [Streptococcus
           pneumoniae TIGR4]
          Length = 396

 Score = 97.8 bits (242), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 80/289 (27%), Positives = 139/289 (48%), Gaps = 63/289 (21%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           ++KG+++ +L+ + + S+DLI+ DPP+  Q   +L   + +++ +  D+W   +S E Y 
Sbjct: 3   VLKGDNLEILKTIESSSIDLIYMDPPFFTQKTQKLSN-NKNIMYSFEDTW---TSIEDYK 58

Query: 83  AFTRAWLLACRRVLKPNGTLWV----IGSYH------NIFRIGTMLQNLNFWILNDIVWR 132
            F    L  C+RVLK +G+++V    I ++H      NIF +  M Q+       +I+W 
Sbjct: 59  EFLSVRLEECKRVLKNSGSIFVHCDKIANHHIRLILDNIFGVD-MFQS-------EIIWN 110

Query: 133 KSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANED---VQMRSD------ 183
                 + +G    N H+ + + S S   K  T   +     N D   V+ + D      
Sbjct: 111 YKRWSNSKKG--LLNNHQNIYFYSKSKDFKFNTIFTEYSSTTNIDQILVERKRDGNSKTI 168

Query: 184 -----------------------WLIPICSGSERLRNKDGEKL-HPTQKPEALLSRILVS 219
                                  W IP       L  K  E++ +PTQKP  LL +I+  
Sbjct: 169 YKVDNNGNYILAKEKNGVPLSDVWNIPF------LNPKAKERVGYPTQKPILLLEQIIKI 222

Query: 220 STKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASV 268
           +T   DI+LDPF GSGT+   +K L R+++GI++ ++ I+I  +R+ +V
Sbjct: 223 ATDKNDIVLDPFCGSGTTLVASKILNRNYMGIDLSEEAINITQQRLENV 271


>gi|32477674|ref|NP_870668.1| adenine-specific methyltransferase [Rhodopirellula baltica SH 1]
 gi|32448228|emb|CAD77745.1| adenine-specific methyltransferase [Rhodopirellula baltica SH 1]
          Length = 608

 Score = 97.8 bits (242), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 75/282 (26%), Positives = 120/282 (42%), Gaps = 57/282 (20%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           +I   + I  + +LPA  +DL FADPP+N+   G  Y           D +D     + Y
Sbjct: 14  QIHVSDCIDGMAELPAGCIDLAFADPPFNI---GYTY-----------DVYDDSLESDEY 59

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFR 141
             ++ +W+    RVL  +G  W+         +  + Q + F   + ++W  +  +    
Sbjct: 60  IQWSESWIRGVHRVLADDGAFWLAIGDEYAAELKVLAQQIGFQCRSWVIWYYTFGV--HC 117

Query: 142 GRRFQNAHETLIW------------ASPS---PKAKGYTFNYDALKAANEDVQMRSD--- 183
             +F  +H  L                PS   P A+   +N    + AN   +M  D   
Sbjct: 118 KYKFTRSHAHLFHFVKDEKHFKFNADDPSVRVPSARQLVYND---RRANSKGRMPDDTWI 174

Query: 184 ----------------WLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDII 227
                           W  P  +G+ + R       H  Q PE LL RI+ + + PGD +
Sbjct: 175 LRPQDLPYGFTADEDIWYFPRVAGTFKERAG----FHGCQMPEQLLGRIIRACSDPGDKV 230

Query: 228 LDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQ 269
           LDPF GS T+ AVAKKL R FI  EM ++Y+ + T+R+  ++
Sbjct: 231 LDPFSGSATTVAVAKKLGREFISFEMSEEYVSLGTERLEQIR 272


>gi|262199051|ref|YP_003270260.1| DNA methylase N-4/N-6 domain protein [Haliangium ochraceum DSM
           14365]
 gi|262082398|gb|ACY18367.1| DNA methylase N-4/N-6 domain protein [Haliangium ochraceum DSM
           14365]
          Length = 319

 Score = 97.8 bits (242), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 75/278 (26%), Positives = 136/278 (48%), Gaps = 41/278 (14%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSW-DKFSSFE 79
           D++I  +++ V+++L    +DL++ DPP+     G+L R   +  DA   ++ D   + E
Sbjct: 25  DRLIHADNLKVMDELGDGCIDLVYIDPPF---ATGKLRRGREAADDAPALAFRDVPDNPE 81

Query: 80  AYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNL--NFWILNDIVWRKSNPM 137
            + A+    L+ACRR+L  +G+L+V   Y  +  +   L  +      +N+I+W  S  +
Sbjct: 82  DFVAWLEPRLVACRRLLAGHGSLFVHLDYRTVHYVKVCLDRIFGRSRFVNEIIWCYS--V 139

Query: 138 PNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANED--------------VQMRSD 183
                RRF   H+T++W +   ++  Y F  DA++   +               VQ ++D
Sbjct: 140 GGKSRRRFARKHDTILWYT---RSGDYAFFPDAVRVPRKGGSHMRVVRDESGALVQEKTD 196

Query: 184 ------WLIPICSGS---------ERLRNKDGEKLH-PTQKPEALLSRILVSSTKPGDII 227
                 +  P+ +G          E L   D E+   PTQKPE LL RI+ ++  P  ++
Sbjct: 197 RRTGKVYRYPVAAGKIPEDWWADIELLNRGDRERTGWPTQKPERLLERIIGATAGPDAVV 256

Query: 228 LDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRI 265
            D F G+GT+ AVA++L R F+  ++    +  A +R+
Sbjct: 257 ADWFCGAGTTAAVAQRLGRRFLTTDIASSAVACAEQRL 294


>gi|315154648|gb|EFT98664.1| DNA (cytosine-5-)-methyltransferase [Enterococcus faecalis TX0043]
          Length = 393

 Score = 97.8 bits (242), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 77/277 (27%), Positives = 136/277 (49%), Gaps = 39/277 (14%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           +I G++++ L+K+ + S+DLI+ DPP+  Q   +L   ++    +  DSW+   S   Y 
Sbjct: 3   LILGDNLNELKKIESDSIDLIYLDPPFFTQKKQKLKNKENKEY-SFDDSWE---SIAEYT 58

Query: 83  AFTRAWLLACRRVLKPNGTLWV---IGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPN 139
            F +  L  C+RVLK  G++++     + H +      +  +N +  ++I+W       +
Sbjct: 59  TFIKDRLFECKRVLKETGSIFLHCDKTASHYLRVCLDEVFGMNMF-QSEIIWNYKRWSNS 117

Query: 140 FRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKD 199
            +G    N H+ + + S + K K  T   D     N D Q+ +D +    S ++   +++
Sbjct: 118 KKG--LLNNHQNIYFYSKTGKFKFNTIYTDYSSTTNID-QILADRIKDENSKTKYKLDEN 174

Query: 200 GEKL----------------------------HPTQKPEALLSRILVSSTKPGDIILDPF 231
           GE L                            +PTQKP  LL +I+  +T+  DIILDPF
Sbjct: 175 GEPLIGKEKKGVPLSDVWNIPYLNPKAKERTGYPTQKPILLLEQIIKLTTEENDIILDPF 234

Query: 232 FGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASV 268
            GSGT+   +K L+R +IGI+  +D I +A +R+ +V
Sbjct: 235 CGSGTTLVASKILKRRYIGIDQSKDAIKLAEERLKNV 271


>gi|154150048|ref|YP_001403666.1| DNA methylase N-4/N-6 domain-containing protein [Candidatus
           Methanoregula boonei 6A8]
 gi|153998600|gb|ABS55023.1| DNA methylase N-4/N-6 domain protein [Methanoregula boonei 6A8]
          Length = 239

 Score = 97.8 bits (242), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 73/245 (29%), Positives = 126/245 (51%), Gaps = 28/245 (11%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDA-VTDSWDKFSSFE 79
           D + +G++ ++L+KLPA SVDLI  DPP+ +    Q  R +++     V + + +  + E
Sbjct: 10  DTLYEGDACALLKKLPAGSVDLIVTDPPFAIDFTAQ--RLNYNRTGGNVIEGYREIPAAE 67

Query: 80  AYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPN 139
            Y  FTR W+    R L P+G+++V   ++ +  I   +       +N ++W+    +  
Sbjct: 68  -YGKFTRRWIKQATRALSPSGSMYVFSGWNRLRDILEGIDAAGLVTINHLIWKYQFGV-- 124

Query: 140 FRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKD 199
           F   ++  +H  +++     K   YTFN   L    EDV     W+I          N++
Sbjct: 125 FTKNKYVTSHYHILFVVKDRKR--YTFN--KLDHYPEDV-----WVI----------NRE 165

Query: 200 ---GEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQD 256
              G+K  PT+ P+ L+ +I+  S+ PGD++LDPF GSGT   VA+   R F+G E+  +
Sbjct: 166 YWKGKKKTPTKLPKELVQKIIRYSSNPGDLVLDPFLGSGTVAVVARNECRHFLGFEVVPE 225

Query: 257 YIDIA 261
           Y+  A
Sbjct: 226 YVSFA 230


>gi|288800806|ref|ZP_06406263.1| DNA (cytosine-5-)-methyltransferase [Prevotella sp. oral taxon 299
           str. F0039]
 gi|288332267|gb|EFC70748.1| DNA (cytosine-5-)-methyltransferase [Prevotella sp. oral taxon 299
           str. F0039]
          Length = 317

 Score = 97.8 bits (242), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 80/300 (26%), Positives = 137/300 (45%), Gaps = 55/300 (18%)

Query: 4   KNSLAINENQNSIFEWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHS 63
           +  L++  +++S+ +  DK    +   V++  P    DLI  DPPYNL  +   ++    
Sbjct: 23  RKELSMLSDKSSVDDVIDKTFNQDLFDVIDFFPKHFADLIIIDPPYNLSKDFAGFK---- 78

Query: 64  LVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNF 123
              A  D+        +Y ++ ++WL     +LKPNG+++V   + +   I  +L     
Sbjct: 79  -FKATDDN--------SYISYIKSWLPKVLELLKPNGSVYVCCDWKSTSAIYQVLSEYTI 129

Query: 124 WILNDIVWRKSNPMPNFRGRR--FQNAHETLIWASPSPKAKGYTFNYDALK--------- 172
            + N I W++       RG +  ++NA E + +   +   K Y F+ D++          
Sbjct: 130 -VKNRITWQREKG----RGAKTNWKNAMEDIWFGVLN--EKNYFFDVDSVMQKRKVFAPY 182

Query: 173 ---------AANEDVQMR--------SDWLIPICSGSERLRNKDGEKLHPTQKPEALLSR 215
                       E+   R         D  +P  S SE   N D    HPTQKPE L+++
Sbjct: 183 KVDGTPKDWEETEEGNFRMTYPSNFWDDISVPYWSMSE---NTD----HPTQKPEKLIAK 235

Query: 216 ILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIE 275
           ++++S   G ++ DPF GSGT+  VAKKL R + GIE  ++Y  +  KR+       NI+
Sbjct: 236 LILASCPKGGVVFDPFLGSGTTSVVAKKLGRHYCGIEFNEEYALLTQKRLNMADRNRNIQ 295


>gi|327539140|gb|EGF25770.1| adenine-specific methyltransferase [Rhodopirellula baltica WH47]
          Length = 608

 Score = 97.8 bits (242), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 75/282 (26%), Positives = 120/282 (42%), Gaps = 57/282 (20%)

Query: 22  KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAY 81
           +I   + I  + +LPA  +DL FADPP+N+   G  Y           D +D     + Y
Sbjct: 14  QIHVSDCIDGMAELPAGCIDLAFADPPFNI---GYTY-----------DVYDDSLESDEY 59

Query: 82  DAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFR 141
             ++ +W+    RVL  +G  W+         +  + Q + F   + ++W  +  +    
Sbjct: 60  IQWSESWIRGVHRVLADDGAFWLAIGDEYAAELKVLAQQIGFQCRSWVIWYYTFGV--HC 117

Query: 142 GRRFQNAHETLIW------------ASPS---PKAKGYTFNYDALKAANEDVQMRSD--- 183
             +F  +H  L                PS   P A+   +N    + AN   +M  D   
Sbjct: 118 KYKFTRSHAHLFHFVKDEKHFKFNADDPSVRVPSARQLVYND---RRANSKGRMPDDTWI 174

Query: 184 ----------------WLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDII 227
                           W  P  +G+ + R       H  Q PE LL RI+ + + PGD +
Sbjct: 175 LRPQDLPYGFTADEDIWYFPRVAGTFKERAG----FHGCQMPEQLLGRIIRACSDPGDKV 230

Query: 228 LDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQ 269
           LDPF GS T+ AVAKKL R FI  EM ++Y+ + T+R+  ++
Sbjct: 231 LDPFSGSATTVAVAKKLGREFISFEMSEEYVSLGTERLEQIR 272


>gi|320159894|ref|YP_004173118.1| methyltransferase [Anaerolinea thermophila UNI-1]
 gi|319993747|dbj|BAJ62518.1| methyltransferase [Anaerolinea thermophila UNI-1]
          Length = 391

 Score = 97.4 bits (241), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 91/275 (33%), Positives = 124/275 (45%), Gaps = 60/275 (21%)

Query: 18  EWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSS 77
           E  ++I  G+S+ VL+K+P  S+DLIF  PPYN  L  +     H         WD +  
Sbjct: 145 EMTNQIFCGDSLEVLKKIPDNSIDLIFTSPPYNFGLEYERQDDAHK--------WDLY-- 194

Query: 78  FEAYDAFTRAWLLACRRVLKPNGTLWV---------IGSYH---NIFRIGTMLQNLNFWI 125
           FE   A        C RVLK  G + V         I S+H   N F    M+     W 
Sbjct: 195 FEKLFAI----FDECIRVLKFGGRIAVNIQPLFSDYIPSHHLISNFFISRRMI-----W- 244

Query: 126 LNDIVWRKSNPMPNFRGRRFQNAHETL--IWASPSPKAKGYTFNYDALKAA--------- 174
             +I+W K+N           N   T    W SPS     YT+ +  + A          
Sbjct: 245 KGEILWEKNN----------YNCKYTAWGSWKSPSNPYLKYTWEFIEIFAKGTLKKSGDP 294

Query: 175 -NEDVQMRS--DWLIPICS-GSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDP 230
            N D+      +W++   S   ER   + G   HP   PE L  R++   +  GDI+LDP
Sbjct: 295 KNADITSDEFKEWVVAKWSIAPERKMKEFG---HPAMFPEKLAERVIKLFSFVGDIVLDP 351

Query: 231 FFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRI 265
           F G GT+ AVA+KL R FIGI++ Q+Y DIA KR+
Sbjct: 352 FNGVGTTTAVAQKLGRKFIGIDISQEYCDIAQKRL 386


>gi|149002824|ref|ZP_01827750.1| type II DNA modification methyltransferase, putative [Streptococcus
           pneumoniae SP14-BS69]
 gi|147759118|gb|EDK66112.1| type II DNA modification methyltransferase, putative [Streptococcus
           pneumoniae SP14-BS69]
          Length = 325

 Score = 97.4 bits (241), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 80/289 (27%), Positives = 138/289 (47%), Gaps = 63/289 (21%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           ++KG+++ +L+ + + S+DLI+ DPP+  Q   +L   + +++ +  D+W   +S E Y 
Sbjct: 3   VLKGDNLEILKTIESSSIDLIYMDPPFFTQKTQKL-SNNKNIMYSFEDTW---TSIEDYK 58

Query: 83  AFTRAWLLACRRVLKPNGTLWV----IGSYH------NIFRIGTMLQNLNFWILNDIVWR 132
            F    L  C+RVLK +G+++V    I ++H      NIF    M Q+       +I+W 
Sbjct: 59  EFLSVRLEECKRVLKNSGSIFVHCDKIANHHIRLILDNIFG-ADMFQS-------EIIWN 110

Query: 133 KSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANED---VQMRSD------ 183
                 + +G    N H+ + + S S   K  T   +     N D   V+ + D      
Sbjct: 111 YKRWSNSKKG--LLNNHQNIYFYSKSKDFKFNTIFTEYSSTTNIDQILVERKRDGNSKTI 168

Query: 184 -----------------------WLIPICSGSERLRNKDGEKL-HPTQKPEALLSRILVS 219
                                  W IP       L  K  E++ +PTQKP  LL +I+  
Sbjct: 169 YKVDNNGNYILAKEKNGVPLSDVWNIPF------LNPKAKERVGYPTQKPILLLEQIIKI 222

Query: 220 STKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASV 268
           +T   DI+LDPF GSGT+   +K L R+++GI++ ++ I+I  +R+ +V
Sbjct: 223 ATDKNDIVLDPFCGSGTTLVASKILNRNYMGIDLSEEAINITQQRLENV 271


>gi|149007299|ref|ZP_01830957.1| type II DNA modification methyltransferase, putative [Streptococcus
           pneumoniae SP18-BS74]
 gi|237650442|ref|ZP_04524694.1| DNA modification methyltransferase M.XbaI [Streptococcus pneumoniae
           CCRI 1974]
 gi|237821039|ref|ZP_04596884.1| DNA modification methyltransferase M.XbaI [Streptococcus pneumoniae
           CCRI 1974M2]
 gi|147761103|gb|EDK68071.1| type II DNA modification methyltransferase, putative [Streptococcus
           pneumoniae SP18-BS74]
 gi|332200872|gb|EGJ14944.1| DNA methylase family protein [Streptococcus pneumoniae GA41317]
 gi|332201882|gb|EGJ15952.1| DNA methylase family protein [Streptococcus pneumoniae GA47368]
          Length = 325

 Score = 97.1 bits (240), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 80/289 (27%), Positives = 138/289 (47%), Gaps = 63/289 (21%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           ++KG+++ +L+ + + S+DLI+ DPP+  Q   +L   + +++ +  D+W   +S E Y 
Sbjct: 3   VLKGDNLEILKTIESSSIDLIYMDPPFFTQKTQKL-SNNKNIMYSFEDTW---TSIEDYK 58

Query: 83  AFTRAWLLACRRVLKPNGTLWV----IGSYH------NIFRIGTMLQNLNFWILNDIVWR 132
            F    L  C+RVLK +G+++V    I ++H      NIF    M Q+       +I+W 
Sbjct: 59  EFLSVRLEECKRVLKNSGSIFVHCDKIANHHIRLILDNIFG-ADMFQS-------EIIWN 110

Query: 133 KSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANED---VQMRSD------ 183
                 + +G    N H+ + + S S   K  T   +     N D   V+ + D      
Sbjct: 111 YKRWSNSKKG--LLNNHQNIYFYSKSKDFKFNTIFTEYSSTTNIDQILVERKRDGNSKTI 168

Query: 184 -----------------------WLIPICSGSERLRNKDGEKL-HPTQKPEALLSRILVS 219
                                  W IP       L  K  E++ +PTQKP  LL +I+  
Sbjct: 169 YKVDNNGNYILAKEKNGVPLSDVWNIPF------LNPKAKERVGYPTQKPILLLEQIIKI 222

Query: 220 STKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASV 268
           +T   DI+LDPF GSGT+   +K L R+++GI++ ++ I+I  +R+ +V
Sbjct: 223 ATDKNDIVLDPFCGSGTTLVASKILNRNYMGIDLSEEAINITQQRLENV 271


>gi|269925476|ref|YP_003322099.1| Site-specific DNA-methyltransferase (adenine- specific)
           [Thermobaculum terrenum ATCC BAA-798]
 gi|269789136|gb|ACZ41277.1| Site-specific DNA-methyltransferase (adenine- specific)
           [Thermobaculum terrenum ATCC BAA-798]
          Length = 289

 Score = 97.1 bits (240), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 83/285 (29%), Positives = 127/285 (44%), Gaps = 54/285 (18%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYN-----------LQLNGQLYRPDHSLVDAVT 69
           +KI  G+++ VLE LP+ SV+LI+ DPP+N           +  + Q  R        +T
Sbjct: 5   NKIFFGDNLRVLESLPSNSVNLIYIDPPFNTGRRQVRISMSVDRDDQGDRKGFGGYKYLT 64

Query: 70  DSWDKFSSFEAYD---AFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNL----N 122
               K S  + YD   AF    L    RVL  NG L+    Y  +     +L ++    N
Sbjct: 65  KVLGKLSFDDIYDDYLAFLEPRLREAHRVLTANGALYFHIDYREVHYCKILLDSIFGRDN 124

Query: 123 FWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRS 182
           F  LN+I+W  +        R++   H+ +++         Y FN D +         R 
Sbjct: 125 F--LNEIIW--AYDYGGRSKRKWPTKHDNILYYVKD--RNNYVFNADEID--------RL 170

Query: 183 DWLIPICSGSERLR-------------------NKDGEKLHPTQKPEALLSRILVSSTKP 223
            ++ P   G ++ +                    K G   +PTQKP A+L RI+ +S+ P
Sbjct: 171 PYMAPSLVGGDKAKLGKLPTDVWWQTIVSPTGKEKTG---YPTQKPLAILERIIRASSCP 227

Query: 224 GDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASV 268
           GDI+LD F GSGT+G  A KL RSFI ++  ++ I +   R   V
Sbjct: 228 GDIVLDFFAGSGTTGVAAHKLGRSFILVDNNEEAIRVMRSRFRDV 272


>gi|1171049|sp|P14243|MTC9_CITFR RecName: Full=Modification methylase Cfr9I; Short=M.Cfr9I; AltName:
           Full=N(4)- cytosine-specific methyltransferase Cfr9I
 gi|40464|emb|CAA34887.1| DNA (Cytosine-4)-Methyltransferase [Citrobacter freundii]
          Length = 300

 Score = 97.1 bits (240), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 76/284 (26%), Positives = 129/284 (45%), Gaps = 65/284 (22%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPY----NLQLNGQLYRPDHSLVDAVTDSWDKFSSF 78
           + +G+++SVL +LP+ SV  I   PPY    +  ++ Q+      L  ++T   ++  + 
Sbjct: 28  LFEGDALSVLRRLPSGSVRCIVTSPPYWGLRDYGIDEQI-----GLESSMTQFLNRLVTI 82

Query: 79  EAYDAFTRAWLLACRRVLKPNGTLWV-IGSYHN--------------------------- 110
                F+ A     +RVL  +GTLWV IG  +                            
Sbjct: 83  -----FSEA-----KRVLTDDGTLWVNIGDGYTSGNRGYRAPDKKNPARAMAVRPDTPEG 132

Query: 111 ---------IFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKA 161
                     +R+   LQ   +++ +DIVW K N MP     R   +HE L   +   K+
Sbjct: 133 LKPKDLIGIPWRLAFALQEDGWYLRSDIVWNKPNAMPESVKDRPTRSHEFLFMLT---KS 189

Query: 162 KGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSST 221
           + Y ++++A++   +    R+   +        +  K     H    P  L+   +++ST
Sbjct: 190 EKYYYDWEAVREEKDSGGFRNRRTV------WNVNTKPFAGAHFATFPTELIRPCILAST 243

Query: 222 KPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRI 265
           KPGD +LDPFFGSGT G V ++  R ++GIE+  +Y+DIA  R+
Sbjct: 244 KPGDYVLDPFFGSGTVGVVCQQEDRQYVGIELNPEYVDIAVNRL 287


>gi|22091198|ref|NP_666012.1| adenine methyltransferase [Natrialba phage PhiCh1]
 gi|289594309|ref|YP_003482316.1| DNA methylase N-4/N-6 domain protein [Natrialba magadii ATCC 43099]
 gi|6118090|gb|AAF04014.1|AF172444_1 adenine methyltransferase [Natrialba phage PhiCh1]
 gi|289533406|gb|ADD07754.1| DNA methylase N-4/N-6 domain protein [Natrialba magadii ATCC 43099]
          Length = 419

 Score = 97.1 bits (240), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 76/246 (30%), Positives = 120/246 (48%), Gaps = 40/246 (16%)

Query: 33  EKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLAC 92
           ++L   SVDL+  DPPY + ++        S+  + T + D      A   F R      
Sbjct: 183 QRLEGDSVDLVLTDPPYGIDIDLSETLGSRSVQHSGTVANDDLDG--ALSVF-RDAAKEM 239

Query: 93  RRVLKPNGTLWVIGSY--HNIFRIGTMLQNLNFWILNDIVWRKSNP--MPNFR--GRRFQ 146
           RRV+KP G ++V  S+  +++FR   +L +  F + N IVW K+ P   PNF   G  + 
Sbjct: 240 RRVVKPGGHVYVFASWKTYDLFR--DILVDEEFTVRNCIVWCKTVPNNQPNFGTGGTNWG 297

Query: 147 NAHETLIWAS-PSPKAKGYTFNYDALKAANEDVQMRSDWLIP--ICSGSERLRNKDGEKL 203
             HE +I+A+  SP+   +T               R D ++     SG+E          
Sbjct: 298 LQHEFVIYATLDSPRPLKHT---------------RPDIIVHKHSTSGNE---------- 332

Query: 204 HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQD-YIDIAT 262
           HPTQKP  LL   +  S++PGD++LDPF GSG++   + +  R  IG E++ D Y ++  
Sbjct: 333 HPTQKPVGLLEEFIEQSSQPGDVVLDPFAGSGSTAVASVQTDRECIGFELEGDVYQEVVD 392

Query: 263 KRIASV 268
           +RI+  
Sbjct: 393 RRISEA 398


>gi|237740968|ref|ZP_04571449.1| modification methylase HinfI [Fusobacterium sp. 4_1_13]
 gi|229431012|gb|EEO41224.1| modification methylase HinfI [Fusobacterium sp. 4_1_13]
          Length = 90

 Score = 97.1 bits (240), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 43/77 (55%), Positives = 55/77 (71%)

Query: 21 DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
          +KI KG+SI VL+  P++SVD IFADPPY +Q  G+L R D +  + V D WDKF SF+ 
Sbjct: 10 NKIYKGDSIEVLKTFPSESVDFIFADPPYYMQTEGELLRTDGTKFNGVEDEWDKFWSFQD 69

Query: 81 YDAFTRAWLLACRRVLK 97
          YD FT+ WL  C+RVLK
Sbjct: 70 YDNFTKQWLGECKRVLK 86


>gi|15903330|ref|NP_358880.1| type II DNA modification (methyltransferase [Streptococcus
           pneumoniae R6]
 gi|116516980|ref|YP_816726.1| type II DNA modification methyltransferase, putative [Streptococcus
           pneumoniae D39]
 gi|15458929|gb|AAL00091.1| DNA modification methyltransferase [Streptococcus pneumoniae R6]
 gi|116077556|gb|ABJ55276.1| type II DNA modification methyltransferase, putative [Streptococcus
           pneumoniae D39]
          Length = 392

 Score = 97.1 bits (240), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 80/289 (27%), Positives = 138/289 (47%), Gaps = 63/289 (21%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           ++KG+++ +L+ + + S+DLI+ DPP+  Q   +L   + +++ +  D+W   +S E Y 
Sbjct: 3   VLKGDNLEILKTIESSSIDLIYMDPPFFTQKTQKLSN-NKNIMYSFEDTW---TSIEDYK 58

Query: 83  AFTRAWLLACRRVLKPNGTLWV----IGSYH------NIFRIGTMLQNLNFWILNDIVWR 132
            F    L  C+RVLK +G+++V    I ++H      NIF    M Q+       +I+W 
Sbjct: 59  EFLSVRLEECKRVLKNSGSIFVHCDKIANHHIRLILDNIFG-ADMFQS-------EIIWN 110

Query: 133 KSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANED---VQMRSD------ 183
                 + +G    N H+ + + S S   K  T   +     N D   V+ + D      
Sbjct: 111 YKRWSNSKKG--LLNNHQNIYFYSKSKDFKFNTIFTEYSSTTNIDQILVERKRDGNSKTI 168

Query: 184 -----------------------WLIPICSGSERLRNKDGEKL-HPTQKPEALLSRILVS 219
                                  W IP       L  K  E++ +PTQKP  LL +I+  
Sbjct: 169 YKVDNNGNYILAKEKNGVPLSDVWNIPF------LNPKAKERVGYPTQKPILLLEQIIKI 222

Query: 220 STKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASV 268
           +T   DI+LDPF GSGT+   +K L R+++GI++ ++ I+I  +R+ +V
Sbjct: 223 ATDKNDIVLDPFCGSGTTLVASKILNRNYMGIDLSEEAINITQQRLENV 271


>gi|148984771|ref|ZP_01818024.1| type II DNA modification methyltransferase, putative [Streptococcus
           pneumoniae SP3-BS71]
 gi|149011671|ref|ZP_01832867.1| nicotinate phosphoribosyltransferase [Streptococcus pneumoniae
           SP19-BS75]
 gi|168483942|ref|ZP_02708894.1| DNA modification methyltransferase M.XbaI [Streptococcus pneumoniae
           CDC1873-00]
 gi|168486127|ref|ZP_02710635.1| DNA modification methyltransferase M.XbaI [Streptococcus pneumoniae
           CDC1087-00]
 gi|182684389|ref|YP_001836136.1| type II DNA modification methyltransferase, putative [Streptococcus
           pneumoniae CGSP14]
 gi|194398500|ref|YP_002038079.1| type II DNA modification methyltransferase [Streptococcus
           pneumoniae G54]
 gi|221232165|ref|YP_002511318.1| DNA modification methylase [Streptococcus pneumoniae ATCC 700669]
 gi|225859198|ref|YP_002740708.1| DNA modification methyltransferase M.XbaI [Streptococcus pneumoniae
           70585]
 gi|225860791|ref|YP_002742300.1| DNA modification methyltransferase M.XbaI [Streptococcus pneumoniae
           Taiwan19F-14]
 gi|298229942|ref|ZP_06963623.1| DNA modification methyltransferase M.XbaI [Streptococcus pneumoniae
           str. Canada MDR_19F]
 gi|298255682|ref|ZP_06979268.1| DNA modification methyltransferase M.XbaI [Streptococcus pneumoniae
           str. Canada MDR_19A]
 gi|298502615|ref|YP_003724555.1| type II DNA modification methyltransferase [Streptococcus
           pneumoniae TCH8431/19A]
 gi|303253831|ref|ZP_07339960.1| putative DNA modification methylase [Streptococcus pneumoniae
           BS455]
 gi|303259027|ref|ZP_07345006.1| type II DNA modification methyltransferase, putative [Streptococcus
           pneumoniae SP-BS293]
 gi|303261711|ref|ZP_07347658.1| type II DNA modification methyltransferase, putative [Streptococcus
           pneumoniae SP14-BS292]
 gi|303264380|ref|ZP_07350300.1| type II DNA modification methyltransferase, putative [Streptococcus
           pneumoniae BS397]
 gi|303267450|ref|ZP_07353303.1| type II DNA modification methyltransferase, putative [Streptococcus
           pneumoniae BS457]
 gi|303269308|ref|ZP_07355081.1| type II DNA modification methyltransferase, putative [Streptococcus
           pneumoniae BS458]
 gi|307127001|ref|YP_003879032.1| DNA modification methyltransferase M.XbaI [Streptococcus pneumoniae
           670-6B]
 gi|18699604|gb|AAL78652.1|AF469000_1 XbaI methylase [Streptococcus pneumoniae]
 gi|147764102|gb|EDK71034.1| nicotinate phosphoribosyltransferase [Streptococcus pneumoniae
           SP19-BS75]
 gi|147922793|gb|EDK73909.1| type II DNA modification methyltransferase, putative [Streptococcus
           pneumoniae SP3-BS71]
 gi|172042720|gb|EDT50766.1| DNA modification methyltransferase M.XbaI [Streptococcus pneumoniae
           CDC1873-00]
 gi|182629723|gb|ACB90671.1| type II DNA modification methyltransferase, putative [Streptococcus
           pneumoniae CGSP14]
 gi|183570735|gb|EDT91263.1| DNA modification methyltransferase M.XbaI [Streptococcus pneumoniae
           CDC1087-00]
 gi|194358167|gb|ACF56615.1| type II DNA modification methyltransferase, putative [Streptococcus
           pneumoniae G54]
 gi|220674626|emb|CAR69192.1| putative DNA modification methylase [Streptococcus pneumoniae ATCC
           700669]
 gi|225722056|gb|ACO17910.1| DNA modification methyltransferase M.XbaI [Streptococcus pneumoniae
           70585]
 gi|225727628|gb|ACO23479.1| DNA modification methyltransferase M.XbaI [Streptococcus pneumoniae
           Taiwan19F-14]
 gi|298238210|gb|ADI69341.1| type II DNA modification methyltransferase [Streptococcus
           pneumoniae TCH8431/19A]
 gi|301800290|emb|CBW32913.1| putative DNA modification methylase [Streptococcus pneumoniae
           OXC141]
 gi|301802166|emb|CBW34907.1| putative DNA moodification methylase [Streptococcus pneumoniae
           INV200]
 gi|302599204|gb|EFL66221.1| putative DNA modification methylase [Streptococcus pneumoniae
           BS455]
 gi|302637291|gb|EFL67779.1| type II DNA modification methyltransferase, putative [Streptococcus
           pneumoniae SP14-BS292]
 gi|302639970|gb|EFL70426.1| type II DNA modification methyltransferase, putative [Streptococcus
           pneumoniae SP-BS293]
 gi|302641138|gb|EFL71512.1| type II DNA modification methyltransferase, putative [Streptococcus
           pneumoniae BS458]
 gi|302643011|gb|EFL73305.1| type II DNA modification methyltransferase, putative [Streptococcus
           pneumoniae BS457]
 gi|302646192|gb|EFL76419.1| type II DNA modification methyltransferase, putative [Streptococcus
           pneumoniae BS397]
 gi|306484063|gb|ADM90932.1| DNA modification methyltransferase M.XbaI [Streptococcus pneumoniae
           670-6B]
 gi|327389617|gb|EGE87962.1| DNA methylase family protein [Streptococcus pneumoniae GA04375]
 gi|332074753|gb|EGI85227.1| DNA methylase family protein [Streptococcus pneumoniae GA17545]
          Length = 396

 Score = 97.1 bits (240), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 80/289 (27%), Positives = 138/289 (47%), Gaps = 63/289 (21%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           ++KG+++ +L+ + + S+DLI+ DPP+  Q   +L   + +++ +  D+W   +S E Y 
Sbjct: 3   VLKGDNLEILKTIESSSIDLIYMDPPFFTQKTQKLSN-NKNIMYSFEDTW---TSIEDYK 58

Query: 83  AFTRAWLLACRRVLKPNGTLWV----IGSYH------NIFRIGTMLQNLNFWILNDIVWR 132
            F    L  C+RVLK +G+++V    I ++H      NIF    M Q+       +I+W 
Sbjct: 59  EFLSVRLEECKRVLKNSGSIFVHCDKIANHHIRLILDNIFG-ADMFQS-------EIIWN 110

Query: 133 KSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANED---VQMRSD------ 183
                 + +G    N H+ + + S S   K  T   +     N D   V+ + D      
Sbjct: 111 YKRWSNSKKG--LLNNHQNIYFYSKSKDFKFNTIFTEYSSTTNIDQILVERKRDGNSKTI 168

Query: 184 -----------------------WLIPICSGSERLRNKDGEKL-HPTQKPEALLSRILVS 219
                                  W IP       L  K  E++ +PTQKP  LL +I+  
Sbjct: 169 YKVDNNGNYILAKEKNGVPLSDVWNIPF------LNPKAKERVGYPTQKPILLLEQIIKI 222

Query: 220 STKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASV 268
           +T   DI+LDPF GSGT+   +K L R+++GI++ ++ I+I  +R+ +V
Sbjct: 223 ATDKNDIVLDPFCGSGTTLVASKILNRNYMGIDLSEEAINITQQRLENV 271


>gi|321156960|emb|CBW38949.1| Cytosine specific DNA methyltransferase [Streptococcus phage V22]
 gi|321157075|emb|CBW39062.1| Cytosine specific DNA methyltransferase [Streptococcus phage 34117]
 gi|321157225|emb|CBW39209.1| Cytosine specific DNA methyltransferase [Streptococcus phage 8140]
          Length = 231

 Score = 96.7 bits (239), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 65/247 (26%), Positives = 109/247 (44%), Gaps = 30/247 (12%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           DKIIK + +  +E +P   +DLI  DPPY +       +  H   + + +  +       
Sbjct: 4   DKIIKKDVLEFMETIPDNKIDLIVTDPPYLINYKTNWRKEKHKFSNVIKNDNNP------ 57

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
                + ++  C R+LK +  +++  S+  +      ++   F + N I+WRK+N     
Sbjct: 58  --ELIKEYIKECYRILKDDTAIYIFCSFDKVDFFKKEIEKY-FSVKNIIIWRKNNHTAGD 114

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSDWLIPICSGSERLRNKDG 200
              +F   +E +I A+   K     FN + L    +  ++ SD L               
Sbjct: 115 LEAQFGKQYEMIILANKGRKK----FNGERLTDVWDFKRVSSDEL--------------- 155

Query: 201 EKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDI 260
             LH  QKP  L+ R +V  +  GD + D F GSGT+   A +  R FIG E+ + Y  I
Sbjct: 156 --LHQNQKPIELIKRCIVKHSDVGDTVFDGFMGSGTTALAALETDRHFIGTEIDEYYFGI 213

Query: 261 ATKRIAS 267
           A +RI +
Sbjct: 214 AEERIKN 220


>gi|148993008|ref|ZP_01822602.1| type II DNA modification methyltransferase, putative [Streptococcus
           pneumoniae SP9-BS68]
 gi|169834116|ref|YP_001694863.1| DNA modification methyltransferase M.XbaI [Streptococcus pneumoniae
           Hungary19A-6]
 gi|225857062|ref|YP_002738573.1| DNA modification methyltransferase M.XbaI [Streptococcus pneumoniae
           P1031]
 gi|147928209|gb|EDK79226.1| type II DNA modification methyltransferase, putative [Streptococcus
           pneumoniae SP9-BS68]
 gi|168996618|gb|ACA37230.1| DNA modification methyltransferase M.XbaI [Streptococcus pneumoniae
           Hungary19A-6]
 gi|225725859|gb|ACO21711.1| DNA modification methyltransferase M.XbaI [Streptococcus pneumoniae
           P1031]
          Length = 396

 Score = 96.7 bits (239), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 80/289 (27%), Positives = 138/289 (47%), Gaps = 63/289 (21%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           ++KG+++ +L+ + + S+DLI+ DPP+  Q   +L   + +++ +  D+W   +S E Y 
Sbjct: 3   VLKGDNLEILKTIESSSIDLIYMDPPFFTQKTQKLSN-NKNIMYSFEDTW---TSIEDYK 58

Query: 83  AFTRAWLLACRRVLKPNGTLWV----IGSYH------NIFRIGTMLQNLNFWILNDIVWR 132
            F    L  C+RVLK +G+++V    I ++H      NIF    M Q+       +I+W 
Sbjct: 59  EFLSVRLEECKRVLKNSGSIFVHCDKIANHHIRLILDNIFG-ADMFQS-------EIIWN 110

Query: 133 KSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANED---VQMRSD------ 183
                 + +G    N H+ + + S S   K  T   +     N D   V+ + D      
Sbjct: 111 YKRWSNSKKG--LLNNHQNIYFYSKSKDFKFNTIFTEYSSTTNIDQILVERKRDGNSKTI 168

Query: 184 -----------------------WLIPICSGSERLRNKDGEKL-HPTQKPEALLSRILVS 219
                                  W IP       L  K  E++ +PTQKP  LL +I+  
Sbjct: 169 YKVDNNGNYILAKEKNGVPLSDVWNIPF------LNPKAKERVGYPTQKPILLLEQIIKI 222

Query: 220 STKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASV 268
           +T   DI+LDPF GSGT+   +K L R+++GI++ ++ I+I  +R+ +V
Sbjct: 223 ATDKNDIVLDPFCGSGTTLVASKILNRNYMGIDLSEEAINITQQRLENV 271


>gi|148997514|ref|ZP_01825119.1| type II DNA modification methyltransferase, putative [Streptococcus
           pneumoniae SP11-BS70]
 gi|168489597|ref|ZP_02713796.1| DNA modification methyltransferase M.XbaI [Streptococcus pneumoniae
           SP195]
 gi|168575894|ref|ZP_02721809.1| DNA modification methyltransferase M.XbaI [Streptococcus pneumoniae
           MLV-016]
 gi|307068084|ref|YP_003877050.1| adenine specific DNa methylase Mod [Streptococcus pneumoniae AP200]
 gi|147756569|gb|EDK63610.1| type II DNA modification methyltransferase, putative [Streptococcus
           pneumoniae SP11-BS70]
 gi|183571882|gb|EDT92410.1| DNA modification methyltransferase M.XbaI [Streptococcus pneumoniae
           SP195]
 gi|183578247|gb|EDT98775.1| DNA modification methyltransferase M.XbaI [Streptococcus pneumoniae
           MLV-016]
 gi|301794465|emb|CBW36902.1| putative DNA modification methylase [Streptococcus pneumoniae
           INV104]
 gi|306409621|gb|ADM85048.1| Adenine specific DNA methylase Mod [Streptococcus pneumoniae AP200]
 gi|332073737|gb|EGI84216.1| DNA methylase family protein [Streptococcus pneumoniae GA17570]
 gi|332203261|gb|EGJ17329.1| DNA methylase family protein [Streptococcus pneumoniae GA47901]
          Length = 396

 Score = 96.7 bits (239), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 81/290 (27%), Positives = 137/290 (47%), Gaps = 65/290 (22%)

Query: 23  IIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYD 82
           ++KG+++ +L+ + + S+DLI+ DPP+  Q   +L   + +++ +  D+W   +S E Y 
Sbjct: 3   VLKGDNLEILKTIESSSIDLIYMDPPFFTQKTQKLSN-NKNIMYSFEDTW---TSIEDYK 58

Query: 83  AFTRAWLLACRRVLKPNGTLWV----IGSYH------NIFRIGTMLQNLNFWILNDIVWR 132
            F    L  C+RVLK +G+++V    I ++H      NIF    M Q+       +I+W 
Sbjct: 59  EFLSVRLEECKRVLKNSGSIFVHCDKIANHHIRLILDNIFG-ADMFQS-------EIIWN 110

Query: 133 KSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTF-------------------------- 166
                 + +G    N H+ + + S S   K  T                           
Sbjct: 111 YKRWSNSKKG--LLNNHQNIYFYSKSKDFKFNTIFTEYSSTTNIDQILVERKRNGNSKTI 168

Query: 167 -------NYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKL-HPTQKPEALLSRILV 218
                  NY   K  N  V +   W IP       L  K  E++ +PTQKP  LL +I+ 
Sbjct: 169 YKVDNNGNYILAKEKN-GVPLSDVWNIPF------LNPKAKERVGYPTQKPILLLEQIIK 221

Query: 219