RPSBLAST alignment for GI: 254780466 and conserved domain: pfam01555

>gnl|CDD|144957 pfam01555, N6_N4_Mtase, DNA methylase. Members of this family are DNA methylases. The family contains both N-4 cytosine-specific DNA methylases and N-6 Adenine-specific DNA methylases. Length = 221
 Score =  234 bits (600), Expect = 2e-62
 Identities = 100/239 (41%), Positives = 132/239 (55%), Gaps = 33/239 (13%)

Query: 40  VDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPN 99
           VDLI  DPPYNL  +                 WD   S+E Y  +   WL   RRVLKP 
Sbjct: 1   VDLIVTDPPYNLGKDY--------------GQWDDKDSYEEYLEWLEEWLKEVRRVLKPG 46

Query: 100 GTLWVIGSYHNIF-RIGTMLQNLN-FWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASP 157
           G++++      I       L+ L  F +LNDI+WRK N MPN  G RF  AHE ++W S 
Sbjct: 47  GSIFINIGDKYIKSLKALALEILGIFKLLNDIIWRKPNGMPNSNGERFTPAHEYILWFSK 106

Query: 158 SPKAKGYTFNYDALKAANEDVQMRSD-------------WLIPICSGSERLRNKDGEKLH 204
           + K   YTFNYDA+K   ++                   W  P    SE+     G   H
Sbjct: 107 TKKY--YTFNYDAIKVPYDEKDKLKKRGSEPNGKPIGDVWDFPRVQPSEK--ESGGNGAH 162

Query: 205 PTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATK 263
           PTQKPEALL R++++ST PGDI+LDPF GSGT+GA AK+L R+FIGIE++++Y++IA +
Sbjct: 163 PTQKPEALLERLILASTNPGDIVLDPFAGSGTTGAAAKELGRNFIGIEIEEEYVEIAKE 221