RPSBLAST alignment for GI: 254780466 and conserved domain: COG0863

>gnl|CDD|31203 COG0863, COG0863, DNA modification methylase [DNA replication, recombination, and repair]. Length = 302
 Score =  216 bits (550), Expect = 9e-57
 Identities = 101/287 (35%), Positives = 147/287 (51%), Gaps = 9/287 (3%)

Query: 18  EWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSS 77
           +   KI KG+ + +L+ LP  SVDLIF DPPYN    G+        +DA  D WD    
Sbjct: 14  DELSKIYKGDCLEILKSLPENSVDLIFTDPPYNNVKAGRKLGFLKRWLDAW-DGWDSRGI 72

Query: 78  FEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPM 137
           +  +      WL   +RVLKP G+L+VI  + N+ RI  + + L F IL  I+W+K +P 
Sbjct: 73  YLKFILL--QWLAEQKRVLKPGGSLYVIDPFSNLARIEDIAKKLGFEILGKIIWKKPSPR 130

Query: 138 PNFRGRRFQNAHETLIWAS-PSPKAKGYTFNYDALKAANEDVQMRSDWLI----PICSGS 192
            +   +     +E LIWA+  S K     F  D +    ED+++R  +      P   G+
Sbjct: 131 NSRIAKYLLFDYEPLIWANNKSDKLNVDKFKEDIVLDPFEDLRIREPYNKLIRLPDKKGN 190

Query: 193 ERLRNKD-GEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGI 251
                   G+KLHP QKP AL+ R++   + PGDI+LDPF GSGT+G  AK L R FIGI
Sbjct: 191 WSNPIDSYGKKLHPAQKPLALIERLIRDYSFPGDIVLDPFAGSGTTGIAAKNLGRRFIGI 250

Query: 252 EMKQDYIDIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGL 298
           E+  +Y+++A KR+        I +     +R    +    L E  +
Sbjct: 251 EINPEYVEVALKRLQEGLNRIPILIKNRVEERGSFVIESFYLEEGVI 297