RPSBLAST alignment of GI: 254780466 and protein with PDBid: 2zig

>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Length = 297
 Score =  166 bits (420), Expect = 7e-42
 Identities = 62/290 (21%), Positives = 94/290 (32%), Gaps = 34/290 (11%)

Query: 19  WKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSF 78
              ++  G++  VL   P  SV L+   PPY                +           +
Sbjct: 20  GVHRLHVGDAREVLASFPEASVHLVVTSPPYWTLKR----------YEDTPGQLGHIEDY 69

Query: 79  EAYDAFTRAWLLACRRVLKPNGTLWVIGS--------------YHNIFRIGTMLQNLNFW 124
           EA+            R+L P G L ++                +     I    + L F 
Sbjct: 70  EAFLDELDRVWREVFRLLVPGGRLVIVVGDVAVARRRFGRHLVFPLHADIQVRCRKLGFD 129

Query: 125 ILNDIVWRKSNPMP-NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSD 183
            LN I+W K         GR           A    + +                + R  
Sbjct: 130 NLNPIIWHKHTNASLEVEGRGVFLGKPYEPGAIIKTEIEYILMQRKPGGYRKPTQEQREK 189

Query: 184 WLIPICSGSERLRN------KDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTS 237
             +P        R        +  K HP   P  L  R++   +  GD++LDPF G+GT+
Sbjct: 190 SRLPKEDFHRFFRQIWDDIPGESTKDHPAPFPLELAERLVRMFSFVGDVVLDPFAGTGTT 249

Query: 238 GAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRTEPR 287
              A +  R  +G+E+   Y  +A +R A   P     L VL G  T PR
Sbjct: 250 LIAAARWGRRALGVELVPRYAQLAKERFAREVP--GFSLEVLDGA-THPR 296