RPS-BLAST 2.2.22 [Sep-27-2009]

Database: pdb70 
           24,244 sequences; 5,693,230 total letters

Searching..................................................done

Query= gi|254780466|ref|YP_003064879.1| putative modification
methylase [Candidatus Liberibacter asiaticus str. psy62]
         (375 letters)



>1eg2_A Modification methylase RSRI; rossmann fold, exocyclic amino DNA
           methyltransferase RSRI, DNA binding, DNA modification,
           DNA methylation; HET: MTA; 1.75A {Rhodobacter
           sphaeroides} SCOP: c.66.1.11 PDB: 1nw5_A* 1nw6_A*
           1nw7_A* 1nw8_A
          Length = 319

 Score =  198 bits (505), Expect = 1e-51
 Identities = 81/321 (25%), Positives = 128/321 (39%), Gaps = 50/321 (15%)

Query: 2   SQKNSLAINENQNSIFEW-KDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRP 60
           S +   + ++  +S     +      + +  L KLP  SV LI  DPPYN+ L       
Sbjct: 20  SGQKHSSESQLGSSEIGTTRHVYDVCDCLDTLAKLPDDSVQLIICDPPYNIMLAD----- 74

Query: 61  DHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGT---- 116
                      WD       Y  + + WL    RVL P G++ + G        G+    
Sbjct: 75  -----------WDDHMD---YIGWAKRWLAEAERVLSPTGSIAIFGGLQYQGEAGSGDLI 120

Query: 117 -----MLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDAL 171
                M QN    + N I+W   N M   R   F N HE + W +   K K Y F+ DA+
Sbjct: 121 SIISHMRQNSKMLLANLIIWNYPNGMSAQR--FFANRHEEIAWFA---KTKKYFFDLDAV 175

Query: 172 KAANED----VQMRSDWLIP-----------ICSGSERLRNKDGEKLHPTQKPEALLSRI 216
           +   ++      M+   L P           +   S    N      HPTQKP A++ R+
Sbjct: 176 REPYDEETKAAYMKDKRLNPESVEKGRNPTNVWRMSRLNGNSLERVGHPTQKPAAVIERL 235

Query: 217 LVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIEL 276
           + + + PG  +LD F GSG +  VA +  R+ I  +    + +   K++  +Q  G I+ 
Sbjct: 236 VRALSHPGSTVLDFFAGSGVTARVAIQEGRNSICTDAAPVFKEYYQKQLTFLQDDGLID- 294

Query: 277 TVLTGKRTEPRVAFNLLVERG 297
              + +  E    F   ++RG
Sbjct: 295 KARSYEIVEGAANFGAALQRG 315


>1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA
           methylation, S- adenosylmethionine, PSI, protein
           structure initiative; HET: SAM; 1.74A {Moraxella bovis}
           SCOP: c.66.1.11
          Length = 260

 Score =  188 bits (477), Expect = 2e-48
 Identities = 79/274 (28%), Positives = 119/274 (43%), Gaps = 45/274 (16%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
           +KI + N    L+++  KSV L   DPPYNL                    WD F S   
Sbjct: 5   NKIHQMNCFDFLDQVENKSVQLAVIDPPYNLS----------------KADWDSFDSHNE 48

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
           + AFT  W+      L  +G+L++  +  N   I   L +      N I W K + M + 
Sbjct: 49  FLAFTYRWIDKVLDKLDKDGSLYIFNTPFNCAFICQYLVSKGMIFQNWITWDKRDGMGSA 108

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQ--------------------- 179
           + RRF    ET+++ S S   K +TFNYD ++   E                        
Sbjct: 109 K-RRFSTGQETILFFSKS---KNHTFNYDEVRVPYESTDRIKHASEKGILKNGKRWFPNP 164

Query: 180 ----MRSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSG 235
                   W        E++  K  +  H T KP  L+ RI+ +S+ P D++LD F GSG
Sbjct: 165 NGRLCGEVWHFSSQRHKEKVNGKTVKLTHITPKPRDLIERIIRASSNPNDLVLDCFMGSG 224

Query: 236 TSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQ 269
           T+  VAKKL R+FIG +M  +Y++ A   +  ++
Sbjct: 225 TTAIVAKKLGRNFIGCDMNAEYVNQANFVLNQLE 258


>2zig_A TTHA0409, putative modification methylase; methyltransferase, S-
           adenosylmethionine, structural genomics, NPPSFA; 2.10A
           {Thermus thermophilus} PDB: 2zie_A* 2zif_A
          Length = 297

 Score =  166 bits (420), Expect = 7e-42
 Identities = 62/290 (21%), Positives = 94/290 (32%), Gaps = 34/290 (11%)

Query: 19  WKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSF 78
              ++  G++  VL   P  SV L+   PPY                +           +
Sbjct: 20  GVHRLHVGDAREVLASFPEASVHLVVTSPPYWTLKR----------YEDTPGQLGHIEDY 69

Query: 79  EAYDAFTRAWLLACRRVLKPNGTLWVIGS--------------YHNIFRIGTMLQNLNFW 124
           EA+            R+L P G L ++                +     I    + L F 
Sbjct: 70  EAFLDELDRVWREVFRLLVPGGRLVIVVGDVAVARRRFGRHLVFPLHADIQVRCRKLGFD 129

Query: 125 ILNDIVWRKSNPMP-NFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMRSD 183
            LN I+W K         GR           A    + +                + R  
Sbjct: 130 NLNPIIWHKHTNASLEVEGRGVFLGKPYEPGAIIKTEIEYILMQRKPGGYRKPTQEQREK 189

Query: 184 WLIPICSGSERLRN------KDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTS 237
             +P        R        +  K HP   P  L  R++   +  GD++LDPF G+GT+
Sbjct: 190 SRLPKEDFHRFFRQIWDDIPGESTKDHPAPFPLELAERLVRMFSFVGDVVLDPFAGTGTT 249

Query: 238 GAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRTEPR 287
              A +  R  +G+E+   Y  +A +R A   P     L VL G  T PR
Sbjct: 250 LIAAARWGRRALGVELVPRYAQLAKERFAREVP--GFSLEVLDGA-THPR 296


>1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II
           DNA-(cytosine N4) methyltransferase, amino methylation,
           selenomethionine; HET: SAH; 2.80A {Proteus vulgaris}
           SCOP: c.66.1.11
          Length = 323

 Score =  165 bits (417), Expect = 2e-41
 Identities = 59/331 (17%), Positives = 115/331 (34%), Gaps = 54/331 (16%)

Query: 9   INENQNSIFEWKD-KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDA 67
           +N  +   +   +  +  G+S+ +LE  P +S+ L+   PP+ LQ   +    +      
Sbjct: 2   LNFGKKPAYTTSNGSMYIGDSLELLESFPEESISLVMTSPPFALQRKKEYGNLEQ----- 56

Query: 68  VTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIG----SYHNIFRIGTMLQNLNF 123
                +    F ++       L      +   G  ++ G    S +N   +  M+  + F
Sbjct: 57  ----HEYVDWFLSFAKVVNKKLKPDGSFVVDFGGAYMKGVPARSIYNFRVLIRMIDEVGF 112

Query: 124 WILNDIVWRKSNPMP------NFRGRRFQNAHETLIWASPSPKAKGYT------FNYDAL 171
           ++  D  W   + +P      N R  R ++A  T+ W S +   K         ++    
Sbjct: 113 FLAEDFYWFNPSKLPSPIEWVNKRKIRVKDAVNTVWWFSKTEWPKSDITKVLAPYSDRMK 172

Query: 172 KAANEDVQMRSDWLIPICSGSERLRNK----------------------------DGEKL 203
           K   +  +  +    P      +  +K                             G K 
Sbjct: 173 KLIEDPDKFYTPKTRPSGHDIGKSFSKDNGGSIPPNLLQISNSESNGQYLANCKLMGIKA 232

Query: 204 HPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATK 263
           HP + P  L    +   T+P D+++D F GS T+G VA++  R +I  EMK +Y+  +  
Sbjct: 233 HPARFPAKLPEFFIRMLTEPDDLVVDIFGGSNTTGLVAERESRKWISFEMKPEYVAASAF 292

Query: 264 RIASVQPLGNIELTVLTGKRTEPRVAFNLLV 294
           R             +         +  N ++
Sbjct: 293 RFLDNNISEEKITDIYNRILNGESLDLNSII 323


>2pff_B Fatty acid synthase subunit beta; fatty acid synthase,
           acyl-carrier-protein, beta-ketoacyl reductase,
           beta-ketoacyl synthase, dehydratase; 4.00A
           {Saccharomyces cerevisiae}
          Length = 2006

 Score = 48.8 bits (116), Expect = 2e-06
 Identities = 56/263 (21%), Positives = 79/263 (30%), Gaps = 110/263 (41%)

Query: 62  HS--LVDAV----TDSWDKFSSFEAYDAFTRA-----WL-LAC-----RRVLKP------ 98
           HS  LV AV    TDSW+   SF  + +  +A     ++ + C        L P      
Sbjct: 273 HSQGLVTAVAIAETDSWE---SF--FVSVRKAITVLFFIGVRCYEAYPNTSLPPSILEDS 327

Query: 99  ----NGT----LWVIG-------SYHNIF--------RIGTMLQN--LNFWI-------- 125
                G     L +          Y N          ++   L N   N  +        
Sbjct: 328 LENNEGVPSPMLSISNLTQEQVQDYVNKTNSHLPAGKQVEISLVNGAKNLVVSGPPQSLY 387

Query: 126 -LNDIVWRKSNPM-------PNFRGR--RFQNAHETLIWASP--SP---KAKGYTFNYDA 170
            LN  + +   P        P F  R  +F   +  L  ASP  S     A       D 
Sbjct: 388 GLNLTLRKAKAPSGLDQSRIP-FSERKLKFS--NRFLPVASPFHSHLLVPA------SDL 438

Query: 171 LKA--ANEDVQMRSDWL-IPICS---GSERLRNKDGEKLHP-----TQKP---EALLSRI 216
           +       +V   +  + IP+     GS+ LR   G           + P   E      
Sbjct: 439 INKDLVKNNVSFNAKDIQIPVYDTFDGSD-LRVLSGSISERIVDCIIRLPVKWETTTQ-- 495

Query: 217 LVSSTKPGDIILDPFFGSG-TSG 238
              +T     ILD  FG G  SG
Sbjct: 496 -FKATH----ILD--FGPGGASG 511



 Score = 35.3 bits (81), Expect = 0.026
 Identities = 41/220 (18%), Positives = 63/220 (28%), Gaps = 88/220 (40%)

Query: 184 WLIPICSGS--ERLRNK--------------DGEKLHPTQKPEALLSRIL------VSST 221
            L+P  S     +L+ +              D E   PT   E L+ + L      V  +
Sbjct: 20  LLVPTASFFIASQLQEQFNKILPEPTEGFAADDE---PTTPAE-LVGKFLGYVSSLVEPS 75

Query: 222 KPGD------IILDPF---FGSGTS--GAVAKKLRRSFIGIEMKQDYIDIATK-RIASVQ 269
           K G       + L  F   +  G       AK L+ +   +   ++ I      RI + +
Sbjct: 76  KVGQFDQVLNLCLTEFENCYLEGNDIHALAAKLLQENDTTLVKTKELIKNYITARIMAKR 135

Query: 270 PLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTLISGTELG 329
           P      + L          F   V  G  Q   I    QGN                  
Sbjct: 136 PFDKKSNSAL----------FRA-VGEGNAQLVAIF-GGQGNT----------------- 166

Query: 330 SIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVR 369
                       +        YFE+L +L+   T  +LV 
Sbjct: 167 ------------DD-------YFEELRDLY--QTYHVLVG 185



 Score = 29.5 bits (66), Expect = 1.4
 Identities = 37/185 (20%), Positives = 73/185 (39%), Gaps = 39/185 (21%)

Query: 40   VDLIFADPPYNLQLN-----GQLYRPDHS------LVDAVTDSWDKFSSFE----AYDAF 84
            +D++  +P  NL ++     G+  R ++S      +VD    +   F        +Y   
Sbjct: 1662 LDIVINNP-VNLTIHFGGEKGKRIRENYSAMIFETIVDGKLKTEKIFKEINEHSTSYTFR 1720

Query: 85   TRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFW-----------ILNDIVWRK 133
            +   LL+  +  +P  TL    ++ ++   G +  +  F             L D++  +
Sbjct: 1721 SEKGLLSATQFTQPALTLMEKAAFEDLKSKGLIPADATFAGHSLGEYAALASLADVMSIE 1780

Query: 134  S-NPMPNFRGRRFQNA---------HETLIWASPSPKAKGYTFNYDALKAANEDVQMRSD 183
            S   +  +RG   Q A         +  +I  +P   A   +F+ +AL+   E V  R+ 
Sbjct: 1781 SLVEVVFYRGMTMQVAVPRDELGRSNYGMIAINPGRVAA--SFSQEALQYVVERVGKRTG 1838

Query: 184  WLIPI 188
            WL+ I
Sbjct: 1839 WLVEI 1843


>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein
           structure initiative, MCSG, midwest center for
           structural genomics; 2.19A {Deinococcus radiodurans}
          Length = 226

 Score = 38.5 bits (89), Expect = 0.003
 Identities = 14/114 (12%), Positives = 32/114 (28%), Gaps = 19/114 (16%)

Query: 37  AKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVL 96
           A   D+   +        G+L     +    +       S          + +L    + 
Sbjct: 90  APHADVYEWN------GKGELPAGLGAPFGLI------VSRRGP-----TSVILRLPELA 132

Query: 97  KPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHE 150
            P+     +G   N+  +   L  + + I+ +         P +    +Q   E
Sbjct: 133 APDAHFLYVGPRLNVPEVPERLAAVGWDIVAEDHVSVLAHAPTW--EDWQMRGE 184



 Score = 31.9 bits (72), Expect = 0.23
 Identities = 9/61 (14%), Positives = 16/61 (26%)

Query: 209 PEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASV 268
           PE      L     P   +L+   G G   A        +   +   + + +A       
Sbjct: 34  PELTFDLWLSRLLTPQTRVLEAGCGHGPDAARFGPQAARWAAYDFSPELLKLARANAPHA 93

Query: 269 Q 269
            
Sbjct: 94  D 94


>3dmg_A Probable ribosomal RNA small subunit methyltransferase;
           monomethyltranserase, 16S rRNA methyltransferase, N2
           G1207 methyltransferase; HET: SAH; 1.55A {Thermus
           thermophilus} PDB: 3dmf_A* 3dmh_A*
          Length = 381

 Score = 36.8 bits (84), Expect = 0.008
 Identities = 13/100 (13%), Positives = 26/100 (26%), Gaps = 33/100 (33%)

Query: 35  LPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRR 94
                 D+I  +PP+            H     + D    F             +     
Sbjct: 294 TEEARFDIIVTNPPF------------HVGGAVILDVAQAF-------------VNVAAA 328

Query: 95  VLKPNGTLWVIGSYH--------NIFRIGTMLQNLNFWIL 126
            L+P G  +++ +            F     L+   + +L
Sbjct: 329 RLRPGGVFFLVSNPFLKYEPLLEEKFGAFQTLKVAEYKVL 368



 Score = 31.8 bits (71), Expect = 0.23
 Identities = 36/220 (16%), Positives = 67/220 (30%), Gaps = 29/220 (13%)

Query: 51  LQLNGQLYRPDHSLVDAVTDSWDK---FSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGS 107
           L  +G   R      +A   ++D            A+ +A L+A  R L+  G L++ G 
Sbjct: 82  LTASGLQARLALPW-EAAAGAYDLVVLALPAGRGTAYVQASLVAAARALRMGGRLYLAGD 140

Query: 108 Y-HNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTF 166
                 R     + L  +    +V R+         +  +      +W + S +  G  +
Sbjct: 141 KNKGFERYFKEARALLGY--GVVVRREGPYRVALLEKEKEAPPLPSLWRAFSARILGAEY 198

Query: 167 NYDALKAANEDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDI 226
            +           + S   +     S  L     E L     PE +           G  
Sbjct: 199 TFHH------LPGVFSAGKVDP--ASLLLL----EALQERLGPEGV----------RGRQ 236

Query: 227 ILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIA 266
           +LD   G G       ++    +G+E     +    K + 
Sbjct: 237 VLDLGAGYGALTLPLARMGAEVVGVEDDLASVLSLQKGLE 276


>3lpm_A Putative methyltransferase; structural genomics, protein structure
           initiative, NEW YORK structural genomix research
           consortium, nysgxrc; 2.40A {Listeria monocytogenes}
          Length = 259

 Score = 36.5 bits (84), Expect = 0.010
 Identities = 23/108 (21%), Positives = 41/108 (37%), Gaps = 17/108 (15%)

Query: 176 EDVQMRSDWLIPICSGSERLRNKDGEKLHPTQKPE-------ALLSRILVSSTKPGDIIL 228
           E +++  D         ERL     E L   Q P        A+L             I+
Sbjct: 4   EKLKLIGD---------ERLDYLLAENLRIIQSPSVFSFSIDAVLLAKFSYLPIRKGKII 54

Query: 229 DPFFGSGTSG-AVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIE 275
           D   G+G     ++ + +   +G+E+++   D+A + +A  Q    IE
Sbjct: 55  DLCSGNGIIPLLLSTRTKAKIVGVEIQERLADMAKRSVAYNQLEDQIE 102



 Score = 35.3 bits (81), Expect = 0.021
 Identities = 14/107 (13%), Positives = 34/107 (31%), Gaps = 10/107 (9%)

Query: 17  FEWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFS 76
            E + +II+ +   + + +P +  D++  +PPY    +  L   +     A         
Sbjct: 97  LEDQIEIIEYDLKKITDLIPKERADIVTCNPPYFATPDTSLKNTNEHFRIAR-------- 148

Query: 77  SFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNF 123
                       +     +LK  G    +     +  I  +++    
Sbjct: 149 --HEVMCTLEDTIRVAASLLKQGGKANFVHRPERLLDIIDIMRKYRL 193


>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication,
           RNA modification, SAM binding; 2.10A {Escherichia coli}
          Length = 343

 Score = 34.3 bits (78), Expect = 0.040
 Identities = 10/89 (11%), Positives = 26/89 (29%), Gaps = 9/89 (10%)

Query: 54  NGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGS----YH 109
              ++       D +  +       +      +  +    R L   G L ++ +    Y 
Sbjct: 251 ASNVFSEVKGRFDMIISNPPFHDGMQTSLDAAQTLIRGAVRHLNSGGELRIVANAFLPYP 310

Query: 110 NIFR-----IGTMLQNLNFWILNDIVWRK 133
           ++          + Q   F +   I+ R+
Sbjct: 311 DVLDETFGFHEVIAQTGRFKVYRAIMTRQ 339


>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics,
           midwest cente structural genomics, protein structure
           initiative; 1.95A {Streptococcus thermophilus}
          Length = 185

 Score = 33.5 bits (76), Expect = 0.080
 Identities = 10/62 (16%), Positives = 25/62 (40%), Gaps = 4/62 (6%)

Query: 205 PTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKR 264
           P       L+ +L        I++D   G+G   A    L +     ++++  +   ++R
Sbjct: 8   PIHMSHDFLAEVL----DDESIVVDATMGNGNDTAFLAGLSKKVYAFDVQEQALGKTSQR 63

Query: 265 IA 266
           ++
Sbjct: 64  LS 65


>1nw3_A Histone methyltransferase DOT1L; HDOT1, histone lysine
           methyltransferase,; HET: SAM; 2.50A {Homo sapiens} SCOP:
           c.66.1.31
          Length = 416

 Score = 33.2 bits (75), Expect = 0.097
 Identities = 7/51 (13%), Positives = 12/51 (23%), Gaps = 2/51 (3%)

Query: 222 KPGDIILDPFFGSGTSGAVAKKLR--RSFIGIEMKQDYIDIATKRIASVQP 270
              D+ +D   G G            +   G+E        A       + 
Sbjct: 154 TDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRK 204


>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone
           methyltransferase, nucleosome; HET: SAH; 2.20A
           {Saccharomyces cerevisiae} SCOP: c.66.1.31
          Length = 433

 Score = 32.0 bits (72), Expect = 0.20
 Identities = 13/71 (18%), Positives = 22/71 (30%), Gaps = 2/71 (2%)

Query: 222 KPGDIILDPFFGSGTSGAVAKKLR--RSFIGIEMKQDYIDIATKRIASVQPLGNIELTVL 279
           K GD  +D   G G     A          G E+  D  D+   +   ++    +    L
Sbjct: 241 KKGDTFMDLGSGVGNCVVQAALECGCALSFGCEIMDDASDLTILQYEELKKRCKLYGMRL 300

Query: 280 TGKRTEPRVAF 290
                  + +F
Sbjct: 301 NNVEFSLKKSF 311


>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase,
           S-adenosylmethionine, structural genomics, NPPSFA; HET:
           SAM; 2.20A {Aquifex aeolicus VF5}
          Length = 248

 Score = 31.6 bits (71), Expect = 0.28
 Identities = 9/43 (20%), Positives = 17/43 (39%)

Query: 223 PGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRI 265
               +L+   GSG   AV  ++       E  +++   A K +
Sbjct: 91  KEKRVLEFGTGSGALLAVLSEVAGEVWTFEAVEEFYKTAQKNL 133


>2avn_A Ubiquinone/menaquinone biosynthesis methyltransferase-related
           protein; TM1389, structural genomics; HET: SAI; 2.35A
           {Thermotoga maritima MSB8} SCOP: c.66.1.41
          Length = 260

 Score = 31.2 bits (69), Expect = 0.40
 Identities = 10/96 (10%), Positives = 27/96 (28%)

Query: 66  DAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWI 125
           D +  ++D       +  + R         LK    +  +G     + +    +     +
Sbjct: 22  DRIARAYDSMYETPKWKLYHRLIGSFLEEYLKNPCRVLDLGGGTGKWSLFLQERGFEVVL 81

Query: 126 LNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKA 161
           ++                  +   E L + S + +A
Sbjct: 82  VDPSKEMLEVAREKGVKNVVEAKAEDLPFPSGAFEA 117


>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural
           genomics, beta barrel, rossmann fold, tetramer; HET:
           SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP:
           c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A*
          Length = 192

 Score = 31.2 bits (70), Expect = 0.41
 Identities = 9/55 (16%), Positives = 16/55 (29%)

Query: 222 KPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIEL 276
              D+ +D   G+G          R    I+   + I      +       N+ L
Sbjct: 32  GKNDVAVDVGCGTGGVTLELAGRVRRVYAIDRNPEAISTTEMNLQRHGLGDNVTL 86


>2qfm_A Spermine synthase; spermidine aminopropyltransferase, SPMSY,
           structural genomics, structural genomics consortium,
           SGC; HET: SPD MTA; 1.80A {Homo sapiens} PDB: 3c6k_A*
           3c6m_A*
          Length = 364

 Score = 30.8 bits (69), Expect = 0.47
 Identities = 11/62 (17%), Positives = 23/62 (37%)

Query: 59  RPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTML 118
             D+ + D            ++   F R  L    +VLK +G  +  G+  N+    ++ 
Sbjct: 267 EFDYVINDLTAVPISTSPEEDSTWEFLRLILDLSMKVLKQDGKYFTQGNCVNLTEALSLY 326

Query: 119 QN 120
           + 
Sbjct: 327 EE 328


>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase,
           usnRNA, snoRNA, telomerase, cytoplasm,
           methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo
           sapiens} PDB: 3egi_A*
          Length = 241

 Score = 30.9 bits (69), Expect = 0.48
 Identities = 14/60 (23%), Positives = 23/60 (38%), Gaps = 2/60 (3%)

Query: 209 PEALLSRI--LVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIA 266
           PE +   I   VS +   D+++D F G G +           I I++    I +A     
Sbjct: 62  PEKIAEHIAGRVSQSFKCDVVVDAFCGVGGNTIQFALTGMRVIAIDIDPVKIALARNNAE 121


>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics
           consortium (NESG), PSI-2, protein structure initiative,
           unknown function; NMR {Synechocystis} PDB: 3mer_A
          Length = 202

 Score = 31.0 bits (70), Expect = 0.49
 Identities = 12/54 (22%), Positives = 21/54 (38%), Gaps = 2/54 (3%)

Query: 53  LNGQLYRPDHSLVDAVTDSWD-KFSSFEAYDAFTRAWLLA-CRRVLKPNGTLWV 104
           +     + + +  D V D+W+   S F    +  R  L     + LKP G   +
Sbjct: 76  VKITTVQSNLADFDIVADAWEGIVSIFCHLPSSLRQQLYPKVYQGLKPGGVFIL 129


>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA
           binding, structural genomics, BSGC structure funded by
           NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB:
           2nnw_B 1pry_A
          Length = 227

 Score = 30.8 bits (69), Expect = 0.50
 Identities = 20/116 (17%), Positives = 34/116 (29%), Gaps = 8/116 (6%)

Query: 222 KPGDIILDPFFGSG-TSGAVAKKLRRS--FIGIEMKQDYIDIATKRIASVQPLGNIELTV 278
           KPG  +L     SG T+  V+  +       GIE     +         V+   NI   +
Sbjct: 72  KPGKSVLYLGIASGTTASHVSDIVGWEGKIFGIEFSPRVLRELVPI---VEERRNIVPIL 128

Query: 279 LTGKRTE--PRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTLISGTELGSIH 332
               + E    +   + V    +           N    +   G  +   +  SI 
Sbjct: 129 GDATKPEEYRALVPKVDVIFEDVAQPTQAKILIDNAEVYLKRGGYGMIAVKSRSID 184


>3g5l_A Putative S-adenosylmethionine dependent methyltransferase;
           structural genomics, PSI-2, protein structure
           initiative; 2.35A {Listeria monocytogenes str}
          Length = 253

 Score = 30.2 bits (67), Expect = 0.74
 Identities = 8/65 (12%), Positives = 19/65 (29%), Gaps = 5/65 (7%)

Query: 86  RAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRF 145
                     LK +G+  +    H +F           W  ++   +   P+  +     
Sbjct: 125 DDICKKVYINLKSSGSF-IFSVEHPVF----TADGRQDWYTDETGNKLHWPVDRYFNESM 179

Query: 146 QNAHE 150
           + +H 
Sbjct: 180 RTSHF 184


>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target
           base partner, 5- methylpyrimidin-2(1H)-ONE, base
           flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus}
           SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A*
           2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A*
           1g38_A*
          Length = 421

 Score = 30.2 bits (67), Expect = 0.79
 Identities = 9/43 (20%), Positives = 17/43 (39%), Gaps = 3/43 (6%)

Query: 222 KPGDIILDPFFGSGT-SGAVAKKLRR--SFIGIEMKQDYIDIA 261
             G  +L+P    G    A  +       F+G+E+    +D+ 
Sbjct: 38  PRGGRVLEPACAHGPFLRAFREAHGTAYRFVGVEIDPKALDLP 80


>3id6_C Fibrillarin-like rRNA/TRNA 2'-O- methyltransferase; C/D guide RNA,
           2'-O-methylation, coiled-coil, RNA-binding, rRNA
           processing; HET: SAM; 2.60A {Sulfolobus solfataricus}
           PDB: 3id5_B*
          Length = 232

 Score = 29.7 bits (66), Expect = 1.1
 Identities = 8/58 (13%), Positives = 17/58 (29%), Gaps = 3/58 (5%)

Query: 222 KPGDIILDPFFGSG-TSGAVAKKLRRS--FIGIEMKQDYIDIATKRIASVQPLGNIEL 276
           + G  +L     SG T   V+  +  +    G+E     +            +  +  
Sbjct: 75  RKGTKVLYLGAASGTTISHVSDIIELNGKAYGVEFSPRVVRELLLVAQRRPNIFPLLA 132


>1xva_A Glycine N-methyltransferase; HET: SAM; 2.20A {Escherichia coli}
           SCOP: c.66.1.5 PDB: 1d2c_A 1kia_A* 1nbh_A* 1bhj_A*
           2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A
           1r74_A* 2azt_A*
          Length = 292

 Score = 29.8 bits (65), Expect = 1.1
 Identities = 12/67 (17%), Positives = 25/67 (37%), Gaps = 1/67 (1%)

Query: 64  LVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWV-IGSYHNIFRIGTMLQNLN 122
            V  + +S+      +   +  R  L     +++P G L +   +Y  I   G      N
Sbjct: 132 AVICLGNSFAHLPDSKGDQSEHRLALKNIASMVRPGGLLVIDHRNYDYILSTGCAPPGKN 191

Query: 123 FWILNDI 129
            +  +D+
Sbjct: 192 IYYKSDL 198


>2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics,
           PSI-2, protein structure initiative; HET: SAH; 2.00A
           {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A
           2pkw_A
          Length = 258

 Score = 29.6 bits (66), Expect = 1.1
 Identities = 16/95 (16%), Positives = 32/95 (33%), Gaps = 9/95 (9%)

Query: 4   KNSLAINENQNSIFEW---KDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRP 60
            + LA       I  W   + ++I  +S++ L  +      +++ DP +  +        
Sbjct: 127 DDGLARGYADAEIGGWLQERLQLIHASSLTALTDI-TPRPQVVYLDPMFPHKQKSA---- 181

Query: 61  DHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRV 95
                +            +A      A LLA +RV
Sbjct: 182 -LVKKEMRVFQSLVGPDLDADGLLEPARLLATKRV 215


>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250,
           NESG, structural genomics, PSI-2; HET: SAM; 1.68A
           {Bacteroides fragilis nctc 9343} PDB: 3e7p_A
          Length = 267

 Score = 29.5 bits (65), Expect = 1.1
 Identities = 18/104 (17%), Positives = 29/104 (27%), Gaps = 6/104 (5%)

Query: 75  FSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKS 134
           +S    Y+      L   R+ LK  G L V  S  + F      +  +FW   D      
Sbjct: 119 WSEGAIYNIGFERGLNEWRKYLKKGGYLAV--SECSWFTDERPAEINDFW--MDAYPEID 174

Query: 135 NPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDV 178
                    +   A    +     P+       +    AA +  
Sbjct: 175 TIPNQV--AKIHKAGYLPVATFILPENCWTDHYFTPKVAAQKIF 216


>1ne2_A Hypothetical protein TA1320; structural genomics, conserved
           hypothetical protein, PSI, protein structure initiative;
           1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32
          Length = 200

 Score = 29.6 bits (66), Expect = 1.1
 Identities = 15/85 (17%), Positives = 28/85 (32%), Gaps = 15/85 (17%)

Query: 201 EKLHPTQKPEALL----------SRILVSSTKPGDI----ILDPFFGSGTSGAVAKKL-R 245
           +KL      +  L          +  L+     G+I    ++D   G+G     +  L  
Sbjct: 15  QKLQQQGNFKNYLEQYPTDASTAAYFLIEIYNDGNIGGRSVIDAGTGNGILACGSYLLGA 74

Query: 246 RSFIGIEMKQDYIDIATKRIASVQP 270
            S    ++  D I+ A +    V  
Sbjct: 75  ESVTAFDIDPDAIETAKRNCGGVNF 99


>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD
           factor, fixation, symbiosis, alpha/beta structure; HET:
           SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A*
          Length = 216

 Score = 29.5 bits (66), Expect = 1.2
 Identities = 8/25 (32%), Positives = 12/25 (48%), Gaps = 1/25 (4%)

Query: 86  RAWLLACRRVLKPNGTLWVIGSYHN 110
           R  +    ++L P G L V GS  +
Sbjct: 134 RTAIDNMVKMLAPGGHL-VFGSARD 157


>2qm3_A Predicted methyltransferase; putative methyltransferase, structural
           genomics, PSI-2, protein structure initiative; HET: MSE;
           2.05A {Pyrococcus furiosus dsm 3638}
          Length = 373

 Score = 29.5 bits (65), Expect = 1.3
 Identities = 6/57 (10%), Positives = 14/57 (24%), Gaps = 1/57 (1%)

Query: 211 ALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLR-RSFIGIEMKQDYIDIATKRIA 266
           A +  +          I        TS A+      +    +++ +       K   
Sbjct: 160 ARVILMHTRGDLENKDIFVLGDDDLTSIALMLSGLPKRIAVLDIDERLTKFIEKAAN 216



 Score = 27.9 bits (61), Expect = 3.8
 Identities = 21/158 (13%), Positives = 37/158 (23%), Gaps = 37/158 (23%)

Query: 21  DKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEA 80
            +I   +    L        D    DPP  L+                            
Sbjct: 223 IEIFTFDLRKPLPDYALHKFDTFITDPPETLE---------------------------- 254

Query: 81  YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNF 140
                RA++      LK        G       +    +     +LN+     ++ + NF
Sbjct: 255 ---AIRAFVGRGIATLKGPRCAGYFGITRRESSLDKWREIQK-LLLNEFNVVITDIIRNF 310

Query: 141 R-----GRRFQNAHETLIWASPSPKAKGYTFNYDALKA 173
                 G   +     LI     P+   Y      ++ 
Sbjct: 311 NEYVNWGYAEETRAWKLIPIKKLPEYNWYKSYMFRIET 348


>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI,
           intermolecular contacts, R specificity, tetramer,
           disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB:
           3lga_A* 3lhd_C*
          Length = 255

 Score = 29.5 bits (66), Expect = 1.3
 Identities = 11/60 (18%), Positives = 24/60 (40%), Gaps = 3/60 (5%)

Query: 222 KPGDIILDPFFGSGTSGAVAKKLRRS---FIGIEMKQDYIDIATKRIASVQPLGNIELTV 278
            PGD I++   GSG        +       +  E+++D+  +A + I        + + +
Sbjct: 92  SPGDFIVEAGVGSGALTLFLANIVGPEGRVVSYEIREDFAKLAWENIKWAGFDDRVTIKL 151


>2yxd_A Probable cobalt-precorrin-6Y C(15)- methyltransferase
           [decarboxylating]; alpha and beta protein (A/B) class;
           HET: MES; 2.30A {Methanocaldococcus jannaschii DSM2661}
          Length = 183

 Score = 29.3 bits (65), Expect = 1.4
 Identities = 10/57 (17%), Positives = 22/57 (38%), Gaps = 1/57 (1%)

Query: 222 KPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQPLGNIELTV 278
              D+++D   GSG       K  +    I+     I++  + +A    + N ++  
Sbjct: 34  NKDDVVVDVGCGSGGMTVEIAKRCKFVYAIDYLDGAIEVTKQNLAKFN-IKNCQIIK 89


>3fho_A ATP-dependent RNA helicase DBP5; mRNA export, ATPase, translation
           termination, ATP-binding, cytoplasm, hydrolase,
           membrane; 2.80A {Schizosaccharomyces pombe}
          Length = 508

 Score = 29.3 bits (65), Expect = 1.4
 Identities = 30/111 (27%), Positives = 46/111 (41%), Gaps = 22/111 (19%)

Query: 196 RNKDGEKLHPTQKPEA----LLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGI 251
           RN  G+    T K  A    +LSR+  S  KP  I L P          +++L R  + +
Sbjct: 159 RNMIGQSQSGTGKTAAFALTMLSRVDASVPKPQAICLAP----------SRELARQIMDV 208

Query: 252 --EMKQDYIDIATK-RIASVQPLG-NIELTVLTGKRTEPRVAFNLLVERGL 298
             EM + Y ++ T   I    P G  I+  ++ G    P    +L+  R L
Sbjct: 209 VTEMGK-YTEVKTAFGIKDSVPKGAKIDAQIVIGT---PGTVMDLMKRRQL 255


>1dus_A MJ0882; hypothetical protein, structural genomics, BSGC structure
           funded by NIH, protein structure initiative, PSI; 1.80A
           {Methanococcus jannaschii} SCOP: c.66.1.4
          Length = 194

 Score = 29.2 bits (64), Expect = 1.6
 Identities = 8/52 (15%), Positives = 16/52 (30%)

Query: 78  FEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDI 129
             A        +   + +LK NG +WV+       +         F  +  +
Sbjct: 129 IRAGKEVLHRIIEEGKELLKDNGEIWVVIQTKQGAKSLAKYMKDVFGNVETV 180


>1p3d_A UDP-N-acetylmuramate--alanine ligase; alpha/beta protein; HET: UMA
           ANP; 1.70A {Haemophilus influenzae} SCOP: c.5.1.1
           c.59.1.1 c.72.2.1 PDB: 1gqq_A* 1p31_A* 1gqy_A*
          Length = 475

 Score = 29.0 bits (64), Expect = 1.7
 Identities = 11/52 (21%), Positives = 20/52 (38%), Gaps = 3/52 (5%)

Query: 193 ERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKL 244
             +RN              L   +L    + GD+IL    G+G+   +++ L
Sbjct: 421 RSIRNLGKVDPILVSDTSQLG-DVLDQIIQDGDLIL--AQGAGSVSKISRGL 469


>1yb2_A Hypothetical protein TA0852; structural genomics,
           methyltransferase, midwest center for structural
           genomics, MCSG; 2.01A {Thermoplasma acidophilum dsm
           1728} SCOP: c.66.1.13
          Length = 275

 Score = 28.8 bits (64), Expect = 1.8
 Identities = 14/60 (23%), Positives = 25/60 (41%), Gaps = 3/60 (5%)

Query: 222 KPGDIILDPFFGSG-TSGAVAKKLRRS--FIGIEMKQDYIDIATKRIASVQPLGNIELTV 278
           +PG  IL+   GSG  S  +   L        +E  +D +  A   ++    +GN+  + 
Sbjct: 109 RPGMDILEVGVGSGNMSSYILYALNGKGTLTVVERDEDNLKKAMDNLSEFYDIGNVRTSR 168


>3hn7_A UDP-N-acetylmuramate-L-alanine ligase; YP_263340.1, structural
           genomics, joint center for structural genomics, JCSG;
           HET: MSE; 1.65A {Psychrobacter arcticus 273-4}
          Length = 524

 Score = 29.1 bits (64), Expect = 1.9
 Identities = 7/53 (13%), Positives = 20/53 (37%), Gaps = 3/53 (5%)

Query: 192 SERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKL 244
           +  + N            + ++ + + +  K GD I+     +G    + ++L
Sbjct: 464 NATIANPSIGSQQVLSSVDDII-KHICTHAKAGDAIV--IMSNGGFEGIHQRL 513


>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics,
           structural genomics consortium, SGC; HET: MTA; 1.82A
           {Homo sapiens}
          Length = 233

 Score = 28.9 bits (64), Expect = 1.9
 Identities = 11/68 (16%), Positives = 19/68 (27%), Gaps = 3/68 (4%)

Query: 211 ALLSRILVSSTKPGDIILDPFFGSG-TSGAVAKKLRRS--FIGIEMKQDYIDIATKRIAS 267
           A+L  +     KPG  +L     SG T   V+  +        +E               
Sbjct: 65  AILGGVDQIHIKPGAKVLYLGAASGTTVSHVSDIVGPDGLVYAVEFSHRSGRDLINLAKK 124

Query: 268 VQPLGNIE 275
              +  + 
Sbjct: 125 RTNIIPVI 132


>2f00_A UDP-N-acetylmuramate--L-alanine ligase; amide bond ligase, ATPase,
           bacterial cell WALL; 2.50A {Escherichia coli}
          Length = 491

 Score = 28.7 bits (63), Expect = 2.1
 Identities = 11/52 (21%), Positives = 19/52 (36%), Gaps = 3/52 (5%)

Query: 193 ERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKL 244
             +R +          P  +   +L       D+IL    G+G  G +A+ L
Sbjct: 427 RTIRGRGKIDPILVPDPARVA-EMLAPVLTGNDLIL--VQGAGNIGKIARSL 475


>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative,
           structural genomics, NEW YORK SGX research center for
           structural genomics; 1.86A {Methanosarcina mazei}
          Length = 276

 Score = 28.9 bits (64), Expect = 2.1
 Identities = 11/38 (28%), Positives = 17/38 (44%), Gaps = 2/38 (5%)

Query: 70  DSWDKFSSFEA--YDAFTRAWLLACRRVLKPNGTLWVI 105
            S+D         +       L + ++VLKP GT+ VI
Sbjct: 104 SSFDHIFVCFVLEHLQSPEEALKSLKKVLKPGGTITVI 141


>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing,
           snoRNP, structural genomics, BSGC structure funded by
           NIH; 1.60A {Methanocaldococcus jannaschii} SCOP:
           c.66.1.3 PDB: 1g8s_A
          Length = 230

 Score = 28.1 bits (62), Expect = 3.0
 Identities = 7/46 (15%), Positives = 12/46 (26%), Gaps = 2/46 (4%)

Query: 222 KPGDIILDPFFGSGTSGAVAKKLRRS--FIGIEMKQDYIDIATKRI 265
           K    IL     +GT+ +    +        IE     +       
Sbjct: 73  KRDSKILYLGASAGTTPSHVADIADKGIVYAIEYAPRIMRELLDAC 118


>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural
           genomics, joint center for structural genomics, JCSG;
           HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15}
          Length = 243

 Score = 28.1 bits (61), Expect = 3.3
 Identities = 16/154 (10%), Positives = 40/154 (25%), Gaps = 16/154 (10%)

Query: 56  QLYRPDHSLVDAVTDSWDKFSSFEA--YDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFR 113
                +  L + V        S      +A  +    +  R+L   G   ++   H+ ++
Sbjct: 85  VQDMRELELPEPVDAITILCDSLNYLQTEADVKQTFDSAARLLTDGG--KLLFDVHSPYK 142

Query: 114 IGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNY----- 168
           + T+     +    +         P        +     I        +    ++     
Sbjct: 143 METLFNGKTYATHAEQSSYIWFADPGEEPLSVVHELTFFIEGEDGRYDRVDETHHQRTYP 202

Query: 169 -----DALKAAN-EDVQMRSDW-LIPICSGSERL 195
                  L+ A      +  D+        +ER+
Sbjct: 203 PEQYITWLREAGFRVCAVTGDFKSDAPTETAERI 236


>1r18_A Protein-L-isoaspartate(D-aspartate)-O- methyltransferase;
           isomerization, protein repair, S- adenosyl homocysteine;
           HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7
          Length = 227

 Score = 28.1 bits (62), Expect = 3.4
 Identities = 15/65 (23%), Positives = 25/65 (38%), Gaps = 8/65 (12%)

Query: 211 ALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSF--------IGIEMKQDYIDIAT 262
           A     L    KPG  ILD   GSG   A   +  ++         +GIE + + +  + 
Sbjct: 72  AFALEYLRDHLKPGARILDVGSGSGYLTACFYRYIKAKGVDADTRIVGIEHQAELVRRSK 131

Query: 263 KRIAS 267
             + +
Sbjct: 132 ANLNT 136


>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline,
           methyltransferase, polyketide, tailoring enzymes,
           structural proteomics in europe; HET: SAM; 2.10A
           {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12
           PDB: 1r00_A* 1xds_A* 1xdu_A*
          Length = 374

 Score = 27.9 bits (61), Expect = 3.5
 Identities = 9/24 (37%), Positives = 11/24 (45%)

Query: 82  DAFTRAWLLACRRVLKPNGTLWVI 105
           D      L  C R L+P G L V+
Sbjct: 263 DEDALTILRGCVRALEPGGRLLVL 286


>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein
           structure initiative, northeast structural genomics
           consortium, NESG; 2.90A {Escherichia coli} SCOP:
           c.66.1.21
          Length = 256

 Score = 28.0 bits (61), Expect = 3.6
 Identities = 26/177 (14%), Positives = 50/177 (28%), Gaps = 18/177 (10%)

Query: 201 EKLHPTQKP--EALLSRIL-VSSTKPGDIILDPFFGSGTSGAVAKKLRRSF----IGIEM 253
           E  H    P  E   + +  V   KPG  ILD   GSG+ G +     R       GI+M
Sbjct: 11  ESEHRIHNPFTEEKYATLGRVLRMKPGTRILD--LGSGS-GEMLCTWARDHGITGTGIDM 67

Query: 254 KQDYIDIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNIS 313
              +   A +R   +     +                ++    G          A+  ++
Sbjct: 68  SSLFTAQAKRRAEELGVSERVHFIHNDAAGYVANEKCDVAACVGATWIAGGFAGAEELLA 127

Query: 314 ATVCADGTLISGTELGSIHRVGAKVSGSETCNGWNFWYFEKLGELHSINTLRILVRK 370
            ++   G ++    +G  +      +                 +  ++  L      
Sbjct: 128 QSLKPGGIML----IGEPYWRQLPATE----EIAQACGVSSTSDFLTLPGLVGAFDD 176


>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S
           rRNA, NESG, structural genomics, PSI, protein structure
           initiative; HET: SAM; 2.80A {Escherichia coli} SCOP:
           c.66.1.33
          Length = 269

 Score = 27.8 bits (61), Expect = 3.8
 Identities = 7/29 (24%), Positives = 11/29 (37%), Gaps = 1/29 (3%)

Query: 77  SFEA-YDAFTRAWLLACRRVLKPNGTLWV 104
           S +A    +         RV+KP G +  
Sbjct: 148 SMDAIIRIYAPCKAEELARVVKPGGWVIT 176


>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo
           sapiens}
          Length = 302

 Score = 28.0 bits (61), Expect = 4.1
 Identities = 15/108 (13%), Positives = 31/108 (28%), Gaps = 16/108 (14%)

Query: 71  SWDKFSSFEAYDAFTRAWL----LACRR------VLKPNGTLWVIGSYHNIFRIGTMLQN 120
           +     S E YD     W     L  RR       +   G ++ +G ++        ++ 
Sbjct: 25  APKAIRSVECYDFKEERWHQVAELPSRRCRAGMVYM--AGLVFAVGGFNG----SLRVRT 78

Query: 121 LNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNY 168
           ++ +      W     M + R          L++A           + 
Sbjct: 79  VDSYDPVKDQWTSVANMRDRRSTLGAAVLNGLLYAVGGFDGSTGLSSV 126


>3is6_A Putative permease protein, ABC transporter; domain, PSI, MCSG,
           structural genomics, midwest center for structural
           genomics; 1.95A {Porphyromonas gingivalis W83}
          Length = 244

 Score = 27.8 bits (61), Expect = 4.2
 Identities = 10/80 (12%), Positives = 23/80 (28%), Gaps = 1/80 (1%)

Query: 2   SQKNSLAINENQNSIFEWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPD 61
               +  I+E+            +              +  +F D P+N  +   +  P 
Sbjct: 105 RDNMTCLISESLARKMGGDVLGKRLRPAESKSDRAIT-IGGVFEDLPHNSSIQADMLLPI 163

Query: 62  HSLVDAVTDSWDKFSSFEAY 81
             +     ++W     + AY
Sbjct: 164 TWMPAESLNNWIGNDRYIAY 183


>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues,
           protein repair, deamidation, post-translational
           modification; HET: SAH; 1.80A {Thermotoga maritima}
           SCOP: c.66.1.7 d.197.1.1
          Length = 317

 Score = 27.7 bits (61), Expect = 4.3
 Identities = 10/60 (16%), Positives = 24/60 (40%), Gaps = 4/60 (6%)

Query: 222 KPGDIILDPFFGSGTSGAVAKKLRR---SFIGIEMKQDYIDIATKRIASVQPLGNIELTV 278
             G  +L+   G+G + AV  ++       + +E  +   +IA + +     + N+    
Sbjct: 74  DKGMRVLEIGGGTGYNAAVMSRVVGEKGLVVSVEYSRKICEIAKRNVER-LGIENVIFVC 132


>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent
           methyltransfer structural genomics, PSI-2; HET: MSE;
           1.90A {Burkholderia thailandensis}
          Length = 352

 Score = 27.6 bits (61), Expect = 4.4
 Identities = 7/37 (18%), Positives = 14/37 (37%), Gaps = 1/37 (2%)

Query: 70  DSWDKFSSFEAYDAFTRAWLLA-CRRVLKPNGTLWVI 105
           D          +DA     ++     ++KP G L ++
Sbjct: 250 DVVMLNDCLHYFDAREAREVIGHAAGLVKPGGALLIL 286


>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural genomics,
           joint center for structural genomics, JCSG; HET: SAH;
           2.11A {Anabaena variabilis atcc 29413}
          Length = 245

 Score = 27.5 bits (59), Expect = 5.4
 Identities = 4/24 (16%), Positives = 9/24 (37%)

Query: 82  DAFTRAWLLACRRVLKPNGTLWVI 105
                    + R +L   G +++I
Sbjct: 139 VEKRELLGQSLRILLGKQGAMYLI 162


>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2,
           protein structure initiative; 2.80A {Bacillus
           thuringiensis serovarkonkukian}
          Length = 220

 Score = 27.2 bits (59), Expect = 5.6
 Identities = 7/71 (9%), Positives = 18/71 (25%), Gaps = 4/71 (5%)

Query: 82  DAFTRAWLLACRRVLKPNGTL----WVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPM 137
           D      +    ++L   G +     +        +     +   F  L + +  +    
Sbjct: 121 DDEKNVAIAKYSQLLNKGGKIVFADTIFADQDAYDKTVEAAKQRGFHQLANDLQTEYYTR 180

Query: 138 PNFRGRRFQNA 148
                  F+N 
Sbjct: 181 IPVMQTIFENN 191


>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM,
           structural genomics consortium, SGC; HET: SAM; 2.50A
           {Homo sapiens} SCOP: c.66.1.13
          Length = 336

 Score = 27.4 bits (60), Expect = 5.7
 Identities = 15/48 (31%), Positives = 22/48 (45%), Gaps = 3/48 (6%)

Query: 222 KPGDIILDPFFGSGTSGAVAKKLRRS---FIGIEMKQDYIDIATKRIA 266
            PGD +L+   GSG       K   S    I  E+++D+ D+A K   
Sbjct: 104 NPGDTVLEAGSGSGGMSLFLSKAVGSQGRVISFEVRKDHHDLAKKNYK 151


>1rw7_A YDR533CP; alpha-beta sandwich, DJ-1/THIJ/PFPI superfamily, unknown
           function; 1.80A {Saccharomyces cerevisiae} SCOP:
           c.23.16.2 PDB: 1qvv_A* 1qvz_A 1qvw_A
          Length = 243

 Score = 27.5 bits (60), Expect = 5.8
 Identities = 11/60 (18%), Positives = 18/60 (30%)

Query: 279 LTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATVCADGTLISGTELGSIHRVGAKV 338
           + G  +  +      VE    + G       G        DG L++G    S H    + 
Sbjct: 172 ILGVDSILKAKNLATVEDVAKKYGAKYLAPVGPWDDYSITDGRLVTGVNPASAHSTAVRS 231


>3mvn_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamayl-M diaminopimelate
           ligase; structural genomics, MCSG, PSI-2; 1.90A
           {Haemophilus ducreyi}
          Length = 163

 Score = 27.4 bits (60), Expect = 5.8
 Identities = 11/32 (34%), Positives = 15/32 (46%), Gaps = 2/32 (6%)

Query: 213 LSRILVSSTKPGDIILDPFFGSGTSGAVAKKL 244
           L   +V   KP D IL     +G  G + +KL
Sbjct: 128 LVMRIVQQAKPNDHIL--IMSNGAFGGIHQKL 157


>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted
           transferase, predicted O-methyltransferase, PFAM
           PF05175, PSI-2; HET: MSE; 1.70A {Agrobacterium
           tumefaciens str}
          Length = 260

 Score = 27.4 bits (60), Expect = 6.0
 Identities = 14/57 (24%), Positives = 28/57 (49%), Gaps = 4/57 (7%)

Query: 212 LLSRILVSSTKPGDIILDPFFGSGTSG-AVAKKLRRSFI-GIEMKQDYIDIATKRIA 266
           LL+ ++  +      I D   G+G +G AVA +L ++ +   E  Q+  + A + + 
Sbjct: 27  LLASLV--ADDRACRIADLGAGAGAAGMAVAARLEKAEVTLYERSQEMAEFARRSLE 81


>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence
           form, precursor of copper enzyme., oxidoreductase; 1.40A
           {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB:
           1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A
           2eib_A 1t2x_A 2eid_A
          Length = 656

 Score = 27.1 bits (59), Expect = 6.1
 Identities = 8/67 (11%), Positives = 17/67 (25%), Gaps = 10/67 (14%)

Query: 54  NGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAW-----LLACRR-----VLKPNGTLW 103
           +G  +           +      + E Y      +         R      +L P+G ++
Sbjct: 466 DGSTFITGGQRRGIPFEDSTPVFTPEIYVPEQDTFYKQNPNSIVRVYHSISLLLPDGRVF 525

Query: 104 VIGSYHN 110
             G    
Sbjct: 526 NGGGGLC 532


>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine,
           phosphorylation, M7G, spout MT, tRNA processing; HET:
           SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E
          Length = 246

 Score = 27.2 bits (59), Expect = 6.4
 Identities = 8/44 (18%), Positives = 14/44 (31%), Gaps = 2/44 (4%)

Query: 226 IILDPFFGSGTSGAVAKKLRRS--FIGIEMKQDYIDIATKRIAS 267
            I D   G G               +G+E++    +    RI +
Sbjct: 52  TIADIGCGFGGLMIDLSPAFPEDLILGMEIRVQVTNYVEDRIIA 95


>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision
           repair, xeroderma pigmentosum, cytoplasm, DNA repair;
           HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B*
          Length = 383

 Score = 27.3 bits (59), Expect = 6.5
 Identities = 8/56 (14%), Positives = 17/56 (30%)

Query: 69  TDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFW 124
           +  W K      +       L   +    P   L V G Y +   +    + ++ +
Sbjct: 280 SYDWSKPDQIIIHPHRQFQHLTPIKATWHPMYDLIVAGRYPDDQLLLNDKRTIDIY 335


>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl
           homocysteine, protein repair; HET: SAH; 1.50A {Homo
           sapiens} SCOP: c.66.1.7 PDB: 1kr5_A*
          Length = 226

 Score = 26.9 bits (59), Expect = 6.6
 Identities = 14/63 (22%), Positives = 23/63 (36%), Gaps = 3/63 (4%)

Query: 211 ALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKL---RRSFIGIEMKQDYIDIATKRIAS 267
           A    +L      G   LD   GSG   A   ++       IGI+  ++ +D +   +  
Sbjct: 65  AYALELLFDQLHEGAKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSVNNVRK 124

Query: 268 VQP 270
             P
Sbjct: 125 DDP 127


>1f60_A Elongation factor EEF1A; protein-protein complex, translation;
           1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1
           c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A
          Length = 458

 Score = 27.3 bits (60), Expect = 6.8
 Identities = 12/40 (30%), Positives = 19/40 (47%), Gaps = 11/40 (27%)

Query: 277 TVLTGKRTEPRVAFNLLVERGLIQPGQILTNAQGNISATV 316
           TV  G+           VE G+I+PG ++T A   ++  V
Sbjct: 259 TVPVGR-----------VETGVIKPGMVVTFAPAGVTTEV 287


>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research center for
           structural genomics, protein structure initiative,
           PSI-2; 2.20A {Pyrococcus furiosus}
          Length = 230

 Score = 26.9 bits (58), Expect = 7.0
 Identities = 5/34 (14%), Positives = 11/34 (32%)

Query: 72  WDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVI 105
            +     +  + F+   L      L P G + + 
Sbjct: 145 REAIGGGKYGEEFSVKLLEEAFDHLNPGGKVALY 178


>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET:
           SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A*
          Length = 218

 Score = 27.1 bits (59), Expect = 7.3
 Identities = 5/24 (20%), Positives = 10/24 (41%)

Query: 82  DAFTRAWLLACRRVLKPNGTLWVI 105
           D    A+  + R  + P G +  +
Sbjct: 122 DDRFEAFWESVRSAVAPGGVVEFV 145


>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase;
           NP_988299.1, structural genomics, joint center for
           structural genomics; HET: MSE SAM; 1.15A {Methanococcus
           maripaludis}
          Length = 219

 Score = 26.8 bits (58), Expect = 7.4
 Identities = 6/25 (24%), Positives = 10/25 (40%)

Query: 86  RAWLLACRRVLKPNGTLWVIGSYHN 110
                   R+LK  G  ++ G + N
Sbjct: 128 ATAFREIYRILKSGGKTYIGGGFGN 152


>3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A
           {Arachis hypogaea}
          Length = 510

 Score = 26.9 bits (59), Expect = 7.9
 Identities = 10/52 (19%), Positives = 17/52 (32%), Gaps = 7/52 (13%)

Query: 68  VTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQ 119
             ++W+          F  A +   R VL+ N        Y N  +   + Q
Sbjct: 32  YIETWN-----PNNQEFECAGVALSRLVLRRNALR--RPFYSNAPQEIFIQQ 76


>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein
           structure initiative; 2.46A {Archaeoglobus fulgidus}
          Length = 240

 Score = 26.8 bits (58), Expect = 8.0
 Identities = 7/36 (19%), Positives = 12/36 (33%), Gaps = 1/36 (2%)

Query: 70  DSWDKFSSFEAYDAFTRAWLLA-CRRVLKPNGTLWV 104
           D        E  D      LL+ C   +K +  + +
Sbjct: 103 DGVMISHFVEHLDPERLFELLSLCYSKMKYSSYIVI 138


>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent
           methyltransferase fold; 2.00A {Escherichia coli K12}
          Length = 396

 Score = 27.0 bits (59), Expect = 8.0
 Identities = 7/62 (11%), Positives = 17/62 (27%), Gaps = 1/62 (1%)

Query: 52  QLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNI 111
               +  + D  ++D      +K     A   +     +   ++L   G L        +
Sbjct: 286 TYRDRGEKFDVIVMDPPKFVENKSQLMGACRGYKDI-NMLAIQLLNEGGILLTFSCSGLM 344

Query: 112 FR 113
             
Sbjct: 345 TS 346


>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding
           motif, coiled coil, RNA binding protein; HET: SAM; 2.90A
           {Archaeoglobus fulgidus dsm 4304} SCOP: c.66.1.3
          Length = 210

 Score = 27.0 bits (59), Expect = 8.2
 Identities = 7/55 (12%), Positives = 18/55 (32%), Gaps = 2/55 (3%)

Query: 222 KPGDIILDPFFGSG-TSGAVAKKLRRSFI-GIEMKQDYIDIATKRIASVQPLGNI 274
           +  + +L     SG T   +A  +    I  +E      +   + +     +  +
Sbjct: 56  RGDERVLYLGAASGTTVSHLADIVDEGIIYAVEYSAKPFEKLLELVRERNNIIPL 110


>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomics,
           JCSG, PSI, protein structure initiative; 1.65A
           {Thermotoga maritima} SCOP: c.66.1.13
          Length = 277

 Score = 26.9 bits (59), Expect = 8.5
 Identities = 14/60 (23%), Positives = 25/60 (41%), Gaps = 3/60 (5%)

Query: 222 KPGDIILDPFFGSGTSGAVAKKLRRS---FIGIEMKQDYIDIATKRIASVQPLGNIELTV 278
           K GD I+D   GSG   AV  +   S       E ++++  +A   +     +  + + V
Sbjct: 111 KEGDRIIDTGVGSGAMCAVLARAVGSSGKVFAYEKREEFAKLAESNLTKWGLIERVTIKV 170


>2ie4_C PP2A-alpha;, serine/threonine-protein phosphatase 2A catalytic
           subunit alpha isoform; protein-protein complex, heat
           repeat, signaling protein; HET: OKA; 2.60A {Homo
           sapiens} SCOP: d.159.1.3 PDB: 2npp_C* 3dw8_C* 3c5w_C
           2ie3_C* 3fga_C* 2iae_C* 2nym_C* 2nyl_C*
          Length = 309

 Score = 26.5 bits (58), Expect = 9.2
 Identities = 17/105 (16%), Positives = 35/105 (33%), Gaps = 17/105 (16%)

Query: 72  WDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVW 131
           W  F+  + +D      L+  +      G    I +  +I  +  + +  +   + D++W
Sbjct: 143 WKYFT--DLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLW 200

Query: 132 RKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANE 176
              +    +                 SP+  GYTF  D  +  N 
Sbjct: 201 SDPDDRGGW---------------GISPRGAGYTFGQDISETFNH 230


>3biy_A Histone acetyltransferase P300; P300 HAT, bisubstrate inhibitor,
           protein-inhibitor complex; HET: 01K; 1.70A {Homo
           sapiens}
          Length = 380

 Score = 26.7 bits (59), Expect = 9.7
 Identities = 7/27 (25%), Positives = 11/27 (40%), Gaps = 3/27 (11%)

Query: 141 RGRRFQNAHETLIWASPSPKAKGYTFN 167
           +   +   H   IWA P  +   Y F+
Sbjct: 140 KKLGYTTGH---IWACPPSEGDDYIFH 163


  Database: pdb70
    Posted date:  Jan 26, 2011 11:21 AM
  Number of letters in database: 5,693,230
  Number of sequences in database:  24,244
  
Lambda     K      H
   0.319    0.136    0.415 

Gapped
Lambda     K      H
   0.267   0.0491    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 24244
Number of Hits to DB: 3,325,818
Number of extensions: 156287
Number of successful extensions: 615
Number of sequences better than 10.0: 1
Number of HSP's gapped: 600
Number of HSP's successfully gapped: 93
Length of query: 375
Length of database: 5,693,230
Length adjustment: 94
Effective length of query: 281
Effective length of database: 3,414,294
Effective search space: 959416614
Effective search space used: 959416614
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 57 (26.3 bits)