Query gi|254780467|ref|YP_003064880.1| exodeoxyribonuclease VII small subunit [Candidatus Liberibacter asiaticus str. psy62] Match_columns 86 No_of_seqs 107 out of 1019 Neff 5.4 Searched_HMMs 39220 Date Sun May 29 16:58:38 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254780467.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 PRK00977 exodeoxyribonuclease 99.7 1.8E-17 4.6E-22 135.8 10.6 78 7-86 4-81 (82) 2 TIGR01280 xseB exodeoxyribonuc 99.7 9.1E-17 2.3E-21 131.2 8.9 64 13-76 2-65 (69) 3 COG1722 XseB Exonuclease VII s 99.6 1.2E-14 3.1E-19 117.3 10.4 66 10-75 6-71 (81) 4 pfam02609 Exonuc_VII_S Exonucl 99.4 2.6E-13 6.7E-18 108.6 7.1 53 16-68 1-53 (53) 5 pfam09862 DUF2089 Protein of u 57.9 11 0.00028 19.5 3.0 22 23-44 91-112 (113) 6 PRK06568 F0F1 ATP synthase sub 42.3 31 0.00079 16.6 5.4 38 36-73 43-80 (154) 7 pfam05659 RPW8 Arabidopsis bro 41.9 32 0.0008 16.5 4.3 45 12-56 28-87 (147) 8 pfam03518 consensus 39.5 34 0.00087 16.3 4.1 33 39-71 4-36 (349) 9 pfam10152 DUF2360 Predicted co 39.4 34 0.00088 16.3 3.4 22 48-69 13-34 (147) 10 PRK05244 hypothetical protein; 31.9 45 0.0011 15.5 4.2 53 13-73 92-144 (176) 11 COG3877 Uncharacterized protei 31.0 43 0.0011 15.6 2.5 20 25-44 101-120 (122) 12 pfam06738 DUF1212 Protein of u 30.0 48 0.0012 15.3 4.5 30 19-48 66-95 (193) 13 cd04776 HTH_GnyR Helix-Turn-He 28.7 51 0.0013 15.2 5.0 54 17-71 39-95 (118) 14 cd02679 MIT_spastin MIT: domai 28.5 51 0.0013 15.1 4.7 36 15-52 4-39 (79) 15 CHL00167 consensus 28.4 52 0.0013 15.1 5.1 37 36-72 65-101 (182) 16 COG4575 ElaB Uncharacterized c 27.5 53 0.0014 15.0 7.4 54 16-69 10-68 (104) 17 TIGR02923 AhaC ATP synthase A1 25.7 32 0.00082 16.5 1.1 40 20-60 140-181 (353) 18 KOG4281 consensus 24.0 32 0.00083 16.4 0.9 32 15-46 22-53 (236) 19 cd05099 PTKc_FGFR4 Catalytic D 23.7 34 0.00086 16.3 0.9 34 11-44 278-311 (314) 20 pfam06760 DUF1221 Protein of u 22.7 66 0.0017 14.4 2.3 23 34-56 46-68 (217) 21 KOG4496 consensus 22.0 68 0.0017 14.3 4.6 24 48-71 40-63 (194) 22 PRK08475 F0F1 ATP synthase sub 20.4 73 0.0019 14.1 5.5 43 22-71 56-98 (170) 23 CHL00019 atpF ATP synthase CF0 20.1 74 0.0019 14.1 5.1 37 36-72 63-99 (184) No 1 >PRK00977 exodeoxyribonuclease VII small subunit; Provisional Probab=99.74 E-value=1.8e-17 Score=135.81 Aligned_cols=78 Identities=41% Similarity=0.737 Sum_probs=70.4 Q ss_pred CHHHHHHCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCC Q ss_conf 81016628999999999999999877999999999999999999999999999999999999831588733468999998 Q gi|254780467|r 7 NLDDLSHLPFEEAVSELENIIAKLERGDVTLDESISIYERGEALKSHCEFLLCSAEKRIEQIKLNRDNKIQSVKPFDEKN 86 (86) Q Consensus 7 ~~~~~~~~sfEea~~~Le~Iv~~LE~g~l~Lees~~~ye~G~~L~~~C~~~L~~ae~ki~~l~~~~~~~~~~~~p~d~~~ 86 (86) +..++.++|||++|.+||+||++||+|++|||+|+++|++|++|+++|+++|+.|++||++|+.+.++. ...||+.++ T Consensus 4 ~~~~~~~lsFE~al~~LE~IV~~LE~g~l~Leesl~~fE~G~~L~~~C~~~L~~Ae~kI~~l~~~~~~~--~~~~f~~~~ 81 (82) T PRK00977 4 STSDVAPLSFEEALAELEEIVTRLENGDLSLEESLAAYERGEALARRCQKKLQQAEQRVEILLQDDEEA--PLEPFPPDT 81 (82) T ss_pred CCCCCCCCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC--CCCCCCCCC T ss_conf 778866589999999999999998579998999999999999999999999999999999999748999--899999888 No 2 >TIGR01280 xseB exodeoxyribonuclease VII, small subunit; InterPro: IPR003761 Exonuclease VII 3.1.11.6 from EC is composed of two non-identical subunits; one large subunit and 4 small ones . Exonuclease VII catalyses exonucleolytic cleavage in either 5'-3' or 3'-5' direction to yield 5'-phosphomononucleotides.; GO: 0008855 exodeoxyribonuclease VII activity, 0006308 DNA catabolic process, 0009318 exodeoxyribonuclease VII complex. Probab=99.70 E-value=9.1e-17 Score=131.20 Aligned_cols=64 Identities=44% Similarity=0.761 Sum_probs=60.4 Q ss_pred HCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC Q ss_conf 2899999999999999987799999999999999999999999999999999999983158873 Q gi|254780467|r 13 HLPFEEAVSELENIIAKLERGDVTLDESISIYERGEALKSHCEFLLCSAEKRIEQIKLNRDNKI 76 (86) Q Consensus 13 ~~sfEea~~~Le~Iv~~LE~g~l~Lees~~~ye~G~~L~~~C~~~L~~ae~ki~~l~~~~~~~~ 76 (86) ++|||++|.+||.||++||+|+++||+|+..|+||++|+++|+++|++||+||..|+...++.. T Consensus 2 ~~sFE~~l~eLE~iV~~LE~G~~~LE~al~~ferG~~L~~~C~~kL~~Ae~~v~~l~~~~~~~~ 65 (69) T TIGR01280 2 DISFEEALSELEQIVQKLESGDLALEEALNLFERGMALSRACEKKLEQAEQKVEKLLKENDEAV 65 (69) T ss_pred CCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCC T ss_conf 8768889999999998773589767889999888899999988999999999999852445656 No 3 >COG1722 XseB Exonuclease VII small subunit [DNA replication, recombination, and repair] Probab=99.59 E-value=1.2e-14 Score=117.32 Aligned_cols=66 Identities=39% Similarity=0.644 Sum_probs=60.5 Q ss_pred HHHHCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC Q ss_conf 166289999999999999998779999999999999999999999999999999999998315887 Q gi|254780467|r 10 DLSHLPFEEAVSELENIIAKLERGDVTLDESISIYERGEALKSHCEFLLCSAEKRIEQIKLNRDNK 75 (86) Q Consensus 10 ~~~~~sfEea~~~Le~Iv~~LE~g~l~Lees~~~ye~G~~L~~~C~~~L~~ae~ki~~l~~~~~~~ 75 (86) +++..|||+++++|++||.+||+|++|||+++..|++|+.|.++|+.+|.+|+++|..|..+.++. T Consensus 6 ~~~~~sfE~~l~eLE~IV~~LE~Gel~Le~sl~~~erG~~L~k~c~~~L~~Ae~~v~~l~~~~~~~ 71 (81) T COG1722 6 PKSALSFEEALAELEEIVESLESGELPLEEALKEFERGMALYKECQEKLQQAEQRVEKLLEEDEEE 71 (81) T ss_pred CCCHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC T ss_conf 865000999999999999999857565999999999999999999999999999999999832345 No 4 >pfam02609 Exonuc_VII_S Exonuclease VII small subunit. This family consist of exonuclease VII, small subunit EC:3.1.11.6 This enzyme catalyses exonucleolytic cleavage in either 5'-3' or 3'-5' direction to yield 5'-phosphomononucleotides. This exonuclease VII enzyme is composed of one large subunit and 4 small ones. Probab=99.44 E-value=2.6e-13 Score=108.56 Aligned_cols=53 Identities=49% Similarity=0.829 Sum_probs=51.6 Q ss_pred HHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 99999999999999877999999999999999999999999999999999999 Q gi|254780467|r 16 FEEAVSELENIIAKLERGDVTLDESISIYERGEALKSHCEFLLCSAEKRIEQI 68 (86) Q Consensus 16 fEea~~~Le~Iv~~LE~g~l~Lees~~~ye~G~~L~~~C~~~L~~ae~ki~~l 68 (86) ||+++.+|++||++||+|++|||+|+++|++|++|+++|+++|+.|+++|+.| T Consensus 1 fEeal~~Le~Iv~~LE~~~l~Le~sl~~ye~G~~L~~~c~~~L~~ae~~v~~l 53 (53) T pfam02609 1 FEEALAELEEIVEKLESGELSLEESLKLYEEGVKLLKHCQKKLEEAEQKIEIL 53 (53) T ss_pred CHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC T ss_conf 97789999999999847999899999999999999999999999999987659 No 5 >pfam09862 DUF2089 Protein of unknown function(DUF2089). This domain, found in various hypothetical prokaryotic proteins, has no known function. Probab=57.89 E-value=11 Score=19.53 Aligned_cols=22 Identities=27% Similarity=0.735 Sum_probs=14.9 Q ss_pred HHHHHHHHHCCCCCHHHHHHHH Q ss_conf 9999999877999999999999 Q gi|254780467|r 23 LENIIAKLERGDVTLDESISIY 44 (86) Q Consensus 23 Le~Iv~~LE~g~l~Lees~~~y 44 (86) =.+|+.+|+.|+++.|+++++. T Consensus 91 ~~eIL~~Le~GEIs~eEA~~~L 112 (113) T pfam09862 91 KKEILDKLEKGEISVEEALRLL 112 (113) T ss_pred HHHHHHHHHCCCCCHHHHHHHH T ss_conf 9999999984997999999974 No 6 >PRK06568 F0F1 ATP synthase subunit B; Validated Probab=42.30 E-value=31 Score=16.56 Aligned_cols=38 Identities=11% Similarity=0.010 Sum_probs=33.7 Q ss_pred CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC Q ss_conf 99999999999999999999999999999999983158 Q gi|254780467|r 36 TLDESISIYERGEALKSHCEFLLCSAEKRIEQIKLNRD 73 (86) Q Consensus 36 ~Lees~~~ye~G~~L~~~C~~~L~~ae~ki~~l~~~~~ 73 (86) .|+++-++.+++..|+..++.++..++..+.++..... T Consensus 43 ~ideAekLkeEAk~lL~e~ekKi~~~~~e~~emI~~Ak 80 (154) T PRK06568 43 KVLKAEKLKEDAALLFEQTNAQIKKLETLRSQMIEESN 80 (154) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 99899987899999999999999878999999999868 No 7 >pfam05659 RPW8 Arabidopsis broad-spectrum mildew resistance protein RPW8. This family consists of several broad-spectrum mildew resistance proteins from Arabidopsis thaliana. Plant disease resistance (R) genes control the recognition of specific pathogens and activate subsequent defence responses. The Arabidopsis thaliana locus Resistance To Powdery Mildew 8 (RPW8) contains two naturally polymorphic, dominant R genes, RPW8.1 and RPW8.2, which individually control resistance to a broad range of powdery mildew pathogens. They induce localized, salicylic acid-dependent defences similar to those induced by R genes that control specific resistance. Apparently, broad-spectrum resistance mediated by RPW8 uses the same mechanisms as specific resistance. Probab=41.87 E-value=32 Score=16.52 Aligned_cols=45 Identities=11% Similarity=0.141 Sum_probs=33.6 Q ss_pred HHCCHHHHHHHHHHHHHH--------------HHCC-CCCHHHHHHHHHHHHHHHHHHHH Q ss_conf 628999999999999999--------------8779-99999999999999999999999 Q gi|254780467|r 12 SHLPFEEAVSELENIIAK--------------LERG-DVTLDESISIYERGEALKSHCEF 56 (86) Q Consensus 12 ~~~sfEea~~~Le~Iv~~--------------LE~g-~l~Lees~~~ye~G~~L~~~C~~ 56 (86) +..+|...+.+|+..+.. ++.+ .-.++....++++|..|+..|.. T Consensus 28 k~~~F~~iL~rL~~Tl~~I~P~v~~I~kl~~e~d~~~~~e~e~L~~lLekg~~LV~kcsk 87 (147) T pfam05659 28 KSLTTRCILQRLDATIESITPLFDQIDKLSKESDDPFRKVIEDLKRLLEKAVSLVEKYAE 87 (147) T ss_pred HHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 998789999999999997242999999898775565068999999999999999999789 No 8 >pfam03518 consensus Probab=39.47 E-value=34 Score=16.28 Aligned_cols=33 Identities=21% Similarity=0.188 Sum_probs=18.8 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC Q ss_conf 999999999999999999999999999999831 Q gi|254780467|r 39 ESISIYERGEALKSHCEFLLCSAEKRIEQIKLN 71 (86) Q Consensus 39 es~~~ye~G~~L~~~C~~~L~~ae~ki~~l~~~ 71 (86) +....|+.-+.-.+...++.+.++.||.++... T Consensus 4 ~~~~~~~~~~~~~~~ad~k~~~~~kK~n~~q~~ 36 (349) T pfam03518 4 EATDDYEAQIKKLDNADSKIDAAAKKINQAQNK 36 (349) T ss_pred HHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHH T ss_conf 122579999884201668899999999999988 No 9 >pfam10152 DUF2360 Predicted coiled-coil domain-containing protein (DUF2360). This is the conserved 140 amino acid region of a family of proteins conserved from nematodes to humans. One C. elegans member is annotated as a Daf-16-dependent longevity protein 1 but this could not be confirmed. The function is unknown. Probab=39.36 E-value=34 Score=16.27 Aligned_cols=22 Identities=27% Similarity=0.540 Sum_probs=16.5 Q ss_pred HHHHHHHHHHHHHHHHHHHHHH Q ss_conf 9999999999999999999998 Q gi|254780467|r 48 EALKSHCEFLLCSAEKRIEQIK 69 (86) Q Consensus 48 ~~L~~~C~~~L~~ae~ki~~l~ 69 (86) -+.+..|..+|..++.+|++|. T Consensus 13 NrFs~~CE~KL~~~e~~LQ~lE 34 (147) T pfam10152 13 NRFSAVCESKLVEAERSLQQLE 34 (147) T ss_pred HHHHHHHHHHHHHHHHHHHHHH T ss_conf 9999999999999999999999 No 10 >PRK05244 hypothetical protein; Provisional Probab=31.93 E-value=45 Score=15.51 Aligned_cols=53 Identities=26% Similarity=0.316 Sum_probs=40.4 Q ss_pred HCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC Q ss_conf 2899999999999999987799999999999999999999999999999999999983158 Q gi|254780467|r 13 HLPFEEAVSELENIIAKLERGDVTLDESISIYERGEALKSHCEFLLCSAEKRIEQIKLNRD 73 (86) Q Consensus 13 ~~sfEea~~~Le~Iv~~LE~g~l~Lees~~~ye~G~~L~~~C~~~L~~ae~ki~~l~~~~~ 73 (86) .+|.|+-+..||. +--|..++..++.|..|...-+.+++.-=-||++|...-. T Consensus 92 ~lspeqEL~~LEn--------D~rL~~LLdrLe~Ge~Ls~~dQ~yvd~~ldRi~~Lm~~LG 144 (176) T PRK05244 92 KLSPEQELEKLEN--------DERLNALLDRLEAGETLSAEDQKWVDEKLDRIEELMEKLG 144 (176) T ss_pred CCCHHHHHHHHHC--------CHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHC T ss_conf 7897999999853--------3999999999867886788899999999999999999958 No 11 >COG3877 Uncharacterized protein conserved in bacteria [Function unknown] Probab=30.97 E-value=43 Score=15.64 Aligned_cols=20 Identities=35% Similarity=0.765 Sum_probs=12.3 Q ss_pred HHHHHHHCCCCCHHHHHHHH Q ss_conf 99999877999999999999 Q gi|254780467|r 25 NIIAKLERGDVTLDESISIY 44 (86) Q Consensus 25 ~Iv~~LE~g~l~Lees~~~y 44 (86) .|+.+||.|.++-|++++.. T Consensus 101 ~i~~qle~Gei~peeA~~~L 120 (122) T COG3877 101 KIIDQLEKGEISPEEAIKML 120 (122) T ss_pred HHHHHHHCCCCCHHHHHHHH T ss_conf 99999981787999999985 No 12 >pfam06738 DUF1212 Protein of unknown function (DUF1212). This family represents a conserved region within a number of hypothetical proteins of unknown function found in eukaryotes, bacteria and archaea. Some family members are membrane proteins. Probab=29.97 E-value=48 Score=15.30 Aligned_cols=30 Identities=20% Similarity=0.439 Sum_probs=25.0 Q ss_pred HHHHHHHHHHHHHCCCCCHHHHHHHHHHHH Q ss_conf 999999999998779999999999999999 Q gi|254780467|r 19 AVSELENIIAKLERGDVTLDESISIYERGE 48 (86) Q Consensus 19 a~~~Le~Iv~~LE~g~l~Lees~~~ye~G~ 48 (86) .+.++.++++++.++.+++++..+..++=. T Consensus 66 kl~~v~~ls~~i~~~~~~~~ea~~~L~~I~ 95 (193) T pfam06738 66 KLSEVNELSREVEAGEISLEEAHERLDEID 95 (193) T ss_pred HHHHHHHHHHHHHCCCCCHHHHHHHHHHHH T ss_conf 999999999999839999999999999998 No 13 >cd04776 HTH_GnyR Helix-Turn-Helix DNA binding domain of the regulatory protein GnyR. Putative helix-turn-helix (HTH) regulatory protein, GnyR, and other related proteins. GnyR belongs to the gnyRDBHAL cluster, which is involved in acyclic isoprenoid degradation in Pseudomonas aeruginosa. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules. Probab=28.74 E-value=51 Score=15.16 Aligned_cols=54 Identities=20% Similarity=0.274 Sum_probs=36.9 Q ss_pred HHHHHHHHHHHHHHHCCCCCHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHC Q ss_conf 99999999999998779999999999---99999999999999999999999999831 Q gi|254780467|r 17 EEAVSELENIIAKLERGDVTLDESIS---IYERGEALKSHCEFLLCSAEKRIEQIKLN 71 (86) Q Consensus 17 Eea~~~Le~Iv~~LE~g~l~Lees~~---~ye~G~~L~~~C~~~L~~ae~ki~~l~~~ 71 (86) +..+.+|.-|. .+-.-.+||++--. +|..+......|+..|..++.++..|... T Consensus 39 ~~~~~~l~~I~-~~r~~G~sL~eI~~~L~l~~~~~~~~~~l~~~l~~l~~~i~~Le~~ 95 (118) T cd04776 39 RRDRARLKLIL-RGKRLGFSLEEIRELLDLYDPPGGNRKQLEKMLEKIEKRRAELEQQ 95 (118) T ss_pred HHHHHHHHHHH-HHHHCCCCHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHH T ss_conf 99999999999-9998299899999999644699972999999999999999999999 No 14 >cd02679 MIT_spastin MIT: domain contained within Microtubule Interacting and Trafficking molecules. This MIT domain sub-family is found in the AAA protein spastin, a probable ATPase involved in the assembly or function of nuclear protein complexes; spastins might also be involved in microtubule dynamics. The molecular function of the MIT domain is unclear. Probab=28.46 E-value=51 Score=15.13 Aligned_cols=36 Identities=17% Similarity=0.327 Sum_probs=26.9 Q ss_pred CHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHH Q ss_conf 99999999999999987799999999999999999999 Q gi|254780467|r 15 PFEEAVSELENIIAKLERGDVTLDESISIYERGEALKS 52 (86) Q Consensus 15 sfEea~~~Le~Iv~~LE~g~l~Lees~~~ye~G~~L~~ 52 (86) -|..|+..++.-|+.=|.| .-++++..|+.|+..+- T Consensus 4 ~~~~Af~~I~kaL~~dE~g--~~~~Al~~Y~~gi~~L~ 39 (79) T cd02679 4 YYKQAFEEISKALRADEWG--DKEQALAHYRKGLRELE 39 (79) T ss_pred HHHHHHHHHHHHHHHCCCC--CHHHHHHHHHHHHHHHH T ss_conf 8999999999986111158--99999999999999999 No 15 >CHL00167 consensus Probab=28.37 E-value=52 Score=15.12 Aligned_cols=37 Identities=32% Similarity=0.275 Sum_probs=31.2 Q ss_pred CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC Q ss_conf 9999999999999999999999999999999998315 Q gi|254780467|r 36 TLDESISIYERGEALKSHCEFLLCSAEKRIEQIKLNR 72 (86) Q Consensus 36 ~Lees~~~ye~G~~L~~~C~~~L~~ae~ki~~l~~~~ 72 (86) +|.++=..++++...+...+..|.+|+.+++.|..+. T Consensus 65 ~I~eAE~r~~eA~~~L~eak~~L~qA~~eA~~Ir~~a 101 (182) T CHL00167 65 AIQESEERLEQANSRLSESEKQLAQAQIVIEQIKKEA 101 (182) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 9999999999999999999999999999999999999 No 16 >COG4575 ElaB Uncharacterized conserved protein [Function unknown] Probab=27.55 E-value=53 Score=15.02 Aligned_cols=54 Identities=19% Similarity=0.288 Sum_probs=44.3 Q ss_pred HHHHHHHHHHHHHHHH-----CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 9999999999999987-----79999999999999999999999999999999999998 Q gi|254780467|r 16 FEEAVSELENIIAKLE-----RGDVTLDESISIYERGEALKSHCEFLLCSAEKRIEQIK 69 (86) Q Consensus 16 fEea~~~Le~Iv~~LE-----~g~l~Lees~~~ye~G~~L~~~C~~~L~~ae~ki~~l~ 69 (86) .++.+.+|..++..+| +|+.+-++.-++-.++..+++..+++|....-.|.+=+ T Consensus 10 ~~~l~~el~~L~d~lEevL~ssg~~a~~e~~~lR~r~~~~Lk~~r~rl~~~~d~v~~~s 68 (104) T COG4575 10 IDQLLAELQELLDTLEEVLKSSGSLAGDEAEELRSKAESALKEARDRLGDTGDAVVQRS 68 (104) T ss_pred HHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 89999999999999999998606301568999999999999999999976137899999 No 17 >TIGR02923 AhaC ATP synthase A1, C subunit; InterPro: IPR014272 A-ATPases (or A1A0-ATPase) (3.6.3.14 from EC) are found exclusively in Archaea and display a close resemblance in structure and subunit composition to V-ATPases, although their function in both ATP synthesis and ATP hydrolysis is closer to that of F-ATPases . A-ATPases are composed of two linked complexes: the A1 complex, consisting of seven subunits, contains the catalytic core that synthesizes/hydrolyses ATP, while the A0 complex, consisting of at least two subunits, forms the membrane-spanning pore . The rotary motor in A-ATPases is composed of only two subunits, the stator subunit I and the rotor subunit C . A-ATPases may have arisen as an adaptation to the different cellular needs and the more extreme environmental conditions faced by Archaeal species. This entry represents subunit C of the A1 component. More information about this protein can be found at Protein of the Month: ATP Synthases .. Probab=25.68 E-value=32 Score=16.47 Aligned_cols=40 Identities=28% Similarity=0.380 Sum_probs=31.0 Q ss_pred HHHHHHHHHHHHCCCC--CHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 9999999999877999--9999999999999999999999999 Q gi|254780467|r 20 VSELENIIAKLERGDV--TLDESISIYERGEALKSHCEFLLCS 60 (86) Q Consensus 20 ~~~Le~Iv~~LE~g~l--~Lees~~~ye~G~~L~~~C~~~L~~ 60 (86) -+.+|+||..|+...= +|.+.+..||++..|+.. ...|+. T Consensus 140 ~~~~eEiV~~Le~T~Y~~~L~e~l~~YE~~~~l~~i-E~~Ldk 181 (353) T TIGR02923 140 AKSIEEIVEALEGTEYYGVLQEALAEYEESGDLSTI-ENELDK 181 (353) T ss_pred CCCHHHHHHHHCCCCCCCHHHHHHHHHCCCCCHHHH-HHHHHH T ss_conf 151556876625888840589997430588505488-779889 No 18 >KOG4281 consensus Probab=24.02 E-value=32 Score=16.44 Aligned_cols=32 Identities=28% Similarity=0.628 Sum_probs=28.8 Q ss_pred CHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHH Q ss_conf 99999999999999987799999999999999 Q gi|254780467|r 15 PFEEAVSELENIIAKLERGDVTLDESISIYER 46 (86) Q Consensus 15 sfEea~~~Le~Iv~~LE~g~l~Lees~~~ye~ 46 (86) +|++++..|..++.+|--.++.|++-+..+.. T Consensus 22 ~~~~nlqkLr~vLd~lkp~Dvgl~~~~~~~~~ 53 (236) T KOG4281 22 PFEENLQKLRSVLDELKPEDVGLEPEMQYFRP 53 (236) T ss_pred CCHHHHHHHHHHHHHCCHHHCCCCHHHHHCCC T ss_conf 53899999999985278866686711221157 No 19 >cd05099 PTKc_FGFR4 Catalytic Domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 4 (FGFR4); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR4 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to Probab=23.70 E-value=34 Score=16.31 Aligned_cols=34 Identities=18% Similarity=0.350 Sum_probs=21.7 Q ss_pred HHHCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHH Q ss_conf 6628999999999999999877999999999999 Q gi|254780467|r 11 LSHLPFEEAVSELENIIAKLERGDVTLDESISIY 44 (86) Q Consensus 11 ~~~~sfEea~~~Le~Iv~~LE~g~l~Lees~~~y 44 (86) -+-+||.+-+..|+.|+..++.+-++|-.-+..| T Consensus 278 ~~RPsf~eI~~~Le~il~~~~~~~~~~~~~~~~~ 311 (314) T cd05099 278 TQRPTFKQLVEALDKVLAAVSEEYLDLSMPFEQY 311 (314) T ss_pred HHCCCHHHHHHHHHHHHHHCCHHHHCCCCCHHCC T ss_conf 5791989999999999986888674605711016 No 20 >pfam06760 DUF1221 Protein of unknown function (DUF1221). This is a family of plant proteins, most of which are hypothetical and of unknown function. All members contain the pfam00069 domain, suggesting that they may possess kinase activity. Probab=22.68 E-value=66 Score=14.44 Aligned_cols=23 Identities=26% Similarity=0.414 Sum_probs=19.9 Q ss_pred CCCHHHHHHHHHHHHHHHHHHHH Q ss_conf 99999999999999999999999 Q gi|254780467|r 34 DVTLDESISIYERGEALKSHCEF 56 (86) Q Consensus 34 ~l~Lees~~~ye~G~~L~~~C~~ 56 (86) +-||-+....|.+|..++++|-+ T Consensus 46 E~PLREl~rvfkdgE~YVR~CLd 68 (217) T pfam06760 46 EQPLRELHRVFRDGEAYVRQCLD 68 (217) T ss_pred HHHHHHHHHHHHHHHHHHHHHCC T ss_conf 46899999998614999997067 No 21 >KOG4496 consensus Probab=21.95 E-value=68 Score=14.35 Aligned_cols=24 Identities=33% Similarity=0.524 Sum_probs=18.7 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHC Q ss_conf 999999999999999999999831 Q gi|254780467|r 48 EALKSHCEFLLCSAEKRIEQIKLN 71 (86) Q Consensus 48 ~~L~~~C~~~L~~ae~ki~~l~~~ 71 (86) ......|.++|..++++|+++... T Consensus 40 N~F~n~cEd~Lad~elridq~d~k 63 (194) T KOG4496 40 NNFGNKCEDILADAELRIDQADRK 63 (194) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 988689999999999879999889 No 22 >PRK08475 F0F1 ATP synthase subunit B; Validated Probab=20.40 E-value=73 Score=14.14 Aligned_cols=43 Identities=19% Similarity=0.173 Sum_probs=31.3 Q ss_pred HHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC Q ss_conf 99999999877999999999999999999999999999999999999831 Q gi|254780467|r 22 ELENIIAKLERGDVTLDESISIYERGEALKSHCEFLLCSAEKRIEQIKLN 71 (86) Q Consensus 22 ~Le~Iv~~LE~g~l~Lees~~~ye~G~~L~~~C~~~L~~ae~ki~~l~~~ 71 (86) |-+.|... |+++-..++++......++++|.+|+.+.+.|... T Consensus 56 R~~~I~~~-------L~eae~~~~eA~~~l~~~~~kLe~Ak~eA~~Iie~ 98 (170) T PRK08475 56 RINSISKR-------LEEIQAKLKESKEKKKDALKKLEEAKEKAELIVET 98 (170) T ss_pred HHHHHHHH-------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 99999999-------99999999999999999999999999999999999 No 23 >CHL00019 atpF ATP synthase CF0 B subunit Probab=20.07 E-value=74 Score=14.09 Aligned_cols=37 Identities=22% Similarity=0.159 Sum_probs=31.1 Q ss_pred CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC Q ss_conf 9999999999999999999999999999999998315 Q gi|254780467|r 36 TLDESISIYERGEALKSHCEFLLCSAEKRIEQIKLNR 72 (86) Q Consensus 36 ~Lees~~~ye~G~~L~~~C~~~L~~ae~ki~~l~~~~ 72 (86) +|+++=..++++.......+.+|.+|+.+.+.|..+. T Consensus 63 ~I~eAE~~~~eA~~~L~e~~~~L~~A~~eA~~I~~~A 99 (184) T CHL00019 63 TIRNSEERREEAIEKLEKARARLRQAEIEADEIRVNG 99 (184) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 9999999999999999999999999999999999999 Done!