RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780467|ref|YP_003064880.1| exodeoxyribonuclease VII small subunit [Candidatus Liberibacter asiaticus str. psy62] (86 letters) >gnl|CDD|145648 pfam02609, Exonuc_VII_S, Exonuclease VII small subunit. This family consist of exonuclease VII, small subunit EC:3.1.11.6 This enzyme catalyses exonucleolytic cleavage in either 5'->3' or 3'->5' direction to yield 5'-phosphomononucleotides. This exonuclease VII enzyme is composed of one large subunit and 4 small ones. Length = 53 Score = 62.5 bits (153), Expect = 3e-11 Identities = 26/53 (49%), Positives = 39/53 (73%) Query: 16 FEEAVSELENIIAKLERGDVTLDESISIYERGEALKSHCEFLLCSAEKRIEQI 68 FEEA++ELE I+ KLE G+++L+ES+ +YE G L HC+ L AE++IE + Sbjct: 1 FEEALAELEEIVEKLESGELSLEESLKLYEEGVKLLKHCQKKLEEAEQKIEIL 53 >gnl|CDD|31908 COG1722, XseB, Exonuclease VII small subunit [DNA replication, recombination, and repair]. Length = 81 Score = 53.8 bits (129), Expect = 9e-09 Identities = 26/67 (38%), Positives = 42/67 (62%) Query: 10 DLSHLPFEEAVSELENIIAKLERGDVTLDESISIYERGEALKSHCEFLLCSAEKRIEQIK 69 S L FEEA++ELE I+ LE G++ L+E++ +ERG AL C+ L AE+R+E++ Sbjct: 6 PKSALSFEEALAELEEIVESLESGELPLEEALKEFERGMALYKECQEKLQQAEQRVEKLL 65 Query: 70 LNRDNKI 76 + + Sbjct: 66 EEDEEED 72 >gnl|CDD|31167 COG0825, AccA, Acetyl-CoA carboxylase alpha subunit [Lipid metabolism]. Length = 317 Score = 27.9 bits (62), Expect = 0.63 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 4/39 (10%) Query: 11 LSHLPFEEAVSELENIIAKL----ERGDVTLDESISIYE 45 ++L FE+ ++ELE I +L E DV L + I E Sbjct: 2 ANYLDFEKPIAELEAKIDELKALAEENDVDLSDEIERLE 40 >gnl|CDD|112085 pfam03255, ACCA, Acetyl co-enzyme A carboxylase carboxyltransferase alpha subunit. Acetyl co-enzyme A carboxylase carboxyltransferase is composed of an alpha and beta subunit. Length = 145 Score = 27.3 bits (61), Expect = 0.93 Identities = 12/38 (31%), Positives = 20/38 (52%), Gaps = 4/38 (10%) Query: 13 HLPFEEAVSELENIIAKL----ERGDVTLDESISIYER 46 L FE+ ++ELE I +L + DV + + I E+ Sbjct: 2 LLEFEKPLAELEAKIDELRKLARKNDVDVSDEIHRLEK 39 >gnl|CDD|32398 COG2216, KdpB, High-affinity K+ transport system, ATPase chain B [Inorganic ion transport and metabolism]. Length = 681 Score = 26.3 bits (58), Expect = 1.7 Identities = 13/42 (30%), Positives = 23/42 (54%) Query: 35 VTLDESISIYERGEALKSHCEFLLCSAEKRIEQIKLNRDNKI 76 V L + + I R + L+SH EF+ +A+ R+ + L +I Sbjct: 351 VELAKKLGIELREDDLQSHAEFVPFTAQTRMSGVDLPGGREI 392 >gnl|CDD|177040 CHL00117, rpoC2, RNA polymerase beta'' subunit; Reviewed. Length = 1364 Score = 26.1 bits (58), Expect = 2.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Query: 57 LLCSAEKRIEQIKLNRDNKIQSV 79 L AE I Q +++ NKIQ V Sbjct: 1175 FLIGAELSIAQSQISLVNKIQKV 1197 >gnl|CDD|99919 cd05536, POLBc_B3, DNA polymerase type-B B3 subfamily catalytic domain. Archaeal proteins that are involved in DNA replication are similar to those from eukaryotes. Some members of the archaea also possess multiple family B DNA polymerases (B1, B2 and B3). So far there is no specific function(s) has been assigned for different members of the archaea type B DNA polymerases. Phylogenetic analyses of eubacterial, archaeal, and eukaryotic family B DNA polymerases are support independent gene duplications during the evolution of archaeal and eukaryotic family B DNA polymerases. Structural comparison of the thermostable DNA polymerase type B to its mesostable homolog suggests several adaptations to high temperature such as shorter loops, disulfide bridges, and increasing electrostatic interaction at subdomain interfaces.. Length = 371 Score = 25.7 bits (57), Expect = 2.6 Identities = 11/29 (37%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Query: 17 EEAVSELENIIAKLERGDVTLDESISIYE 45 EEAV ++ +I KL+RG+V ++ + I++ Sbjct: 253 EEAVKIVKEVIEKLKRGEVPPEKLV-IWK 280 >gnl|CDD|35560 KOG0339, KOG0339, KOG0339, ATP-dependent RNA helicase [RNA processing and modification]. Length = 731 Score = 25.4 bits (55), Expect = 3.3 Identities = 12/60 (20%), Positives = 27/60 (45%), Gaps = 4/60 (6%) Query: 15 PFEEAVSELENIIAKLERG----DVTLDESISIYERGEALKSHCEFLLCSAEKRIEQIKL 70 P E S++ + K + V + S +E+ + LK E ++ + + I+ +K+ Sbjct: 304 PTRELASQIFSEAKKFGKAYGLRVVAVYGGGSKWEQSKELKEGAEIVVATPGRLIDMVKM 363 >gnl|CDD|36764 KOG1551, KOG1551, KOG1551, Uncharacterized conserved protein [Function unknown]. Length = 371 Score = 25.1 bits (54), Expect = 4.3 Identities = 8/37 (21%), Positives = 16/37 (43%) Query: 15 PFEEAVSELENIIAKLERGDVTLDESISIYERGEALK 51 P E+ + LE + + G T+ E + ++ A Sbjct: 157 PEEQIIHMLEYVTDLFKMGRATIQEFVKLFTWSSADG 193 >gnl|CDD|144635 pfam01116, F_bP_aldolase, Fructose-bisphosphate aldolase class-II. Length = 283 Score = 24.3 bits (54), Expect = 6.8 Identities = 8/9 (88%), Positives = 8/9 (88%) Query: 10 DLSHLPFEE 18 D SHLPFEE Sbjct: 102 DGSHLPFEE 110 >gnl|CDD|30540 COG0191, Fba, Fructose/tagatose bisphosphate aldolase [Carbohydrate transport and metabolism]. Length = 286 Score = 24.0 bits (52), Expect = 8.6 Identities = 9/28 (32%), Positives = 16/28 (57%) Query: 10 DLSHLPFEEAVSELENIIAKLERGDVTL 37 D SHLPFEE ++ + ++ V++ Sbjct: 105 DGSHLPFEENIAITKEVVEFAHAYGVSV 132 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.313 0.133 0.360 Gapped Lambda K H 0.267 0.0660 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 960,638 Number of extensions: 39774 Number of successful extensions: 131 Number of sequences better than 10.0: 1 Number of HSP's gapped: 130 Number of HSP's successfully gapped: 24 Length of query: 86 Length of database: 6,263,737 Length adjustment: 55 Effective length of query: 31 Effective length of database: 5,075,242 Effective search space: 157332502 Effective search space used: 157332502 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 51 (23.6 bits)