RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780467|ref|YP_003064880.1| exodeoxyribonuclease VII small subunit [Candidatus Liberibacter asiaticus str. psy62] (86 letters) >1vp7_A Exodeoxyribonuclease VII small subunit; NP_881400.1, structural genomics, joint center for structural genomics, JCSG, PSI; 2.40A {Bordetella pertussis tohama I} SCOP: a.7.13.1 Length = 100 Score = 66.4 bits (162), Expect = 1e-12 Identities = 21/69 (30%), Positives = 41/69 (59%) Query: 16 FEEAVSELENIIAKLERGDVTLDESISIYERGEALKSHCEFLLCSAEKRIEQIKLNRDNK 75 FE A++ELE++++ +E G + L++S+S Y RG L C+ L AE++++ ++ + Sbjct: 32 FETALAELESLVSAMENGTLPLEQSLSAYRRGVELARVCQDRLAQAEQQVKVLEGDLLRP 91 Query: 76 IQSVKPFDE 84 + DE Sbjct: 92 LDPAALDDE 100 >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 28.0 bits (62), Expect = 0.53 Identities = 11/78 (14%), Positives = 20/78 (25%), Gaps = 19/78 (24%) Query: 3 DDSINLDDLSHLPFEEAVSELENIIAKLERGDVTLDESISIYERGEALKS-HCEFLLCSA 61 + DD P E L + + +E V + + L +L Sbjct: 45 TEGFAADDEPTTPAELVGKFLGYVSSLVEPSKVGQFDQVL----NLCLTEFENCYL---- 96 Query: 62 EKRIEQIKLNRDNKIQSV 79 N I ++ Sbjct: 97 ----------EGNDIHAL 104 >2f9y_A Acetyl-COA carboxylase, carboxyltransferase alpha chain; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4 Length = 339 Score = 25.0 bits (54), Expect = 3.8 Identities = 12/39 (30%), Positives = 19/39 (48%), Gaps = 7/39 (17%) Query: 14 LPFEEAVSELENIIAKL-------ERGDVTLDESISIYE 45 L FE+ ++ELE I L E+ D+ +DE + Sbjct: 26 LDFEQPIAELEAKIDSLTAGSRQDEKLDINIDEEVHRLR 64 >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} Length = 197 Score = 24.9 bits (54), Expect = 4.2 Identities = 2/17 (11%), Positives = 7/17 (41%) Query: 16 FEEAVSELENIIAKLER 32 +E + +L+ + Sbjct: 176 VDETLKKLQEAFDQACS 192 >2f9i_A Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus} Length = 327 Score = 24.7 bits (53), Expect = 5.4 Identities = 13/37 (35%), Positives = 19/37 (51%), Gaps = 4/37 (10%) Query: 14 LPFEEAVSELENIIAKL----ERGDVTLDESISIYER 46 L FE+ + E+ N I L ++ DV L E I + E Sbjct: 15 LDFEKPLFEIRNKIESLKESQDKNDVDLQEEIDMLEA 51 >2e3z_A Beta-glucosidase; TIM barrel, glycoside hydrolase family 1, CLAN GH-A, structural genomics, NPPSFA; 1.50A {Phanerochaete chrysosporium} PDB: 2e40_A* Length = 465 Score = 24.4 bits (52), Expect = 7.1 Identities = 7/35 (20%), Positives = 16/35 (45%) Query: 24 ENIIAKLERGDVTLDESISIYERGEALKSHCEFLL 58 EN D+ +++++ +R + + E LL Sbjct: 368 ENGFPVKGENDLPVEQAVDDTDRQAYYRDYTEALL 402 >3opy_B 6-phosphofructo-1-kinase beta-subunit; ATP binding, fructose-6-phosphate bindi magnesium binding, citrate binding, ADP binding; HET: ATP; 3.05A {Pichia pastoris} Length = 941 Score = 23.7 bits (51), Expect = 8.8 Identities = 6/30 (20%), Positives = 15/30 (50%) Query: 5 SINLDDLSHLPFEEAVSELENIIAKLERGD 34 +I D ++ +P +AV + + +E + Sbjct: 505 AIKEDQITRVPLVDAVELTQQVAKSIESRN 534 >3n9r_A Fructose-bisphosphate aldolase; FBP aldolase, class II, inhibitor, lyase; HET: TD3; 1.80A {Helicobacter pylori} PDB: 3c52_A* 3c56_A* 3c4u_A* 3n9s_A* Length = 307 Score = 23.8 bits (51), Expect = 9.1 Identities = 8/39 (20%), Positives = 15/39 (38%) Query: 10 DLSHLPFEEAVSELENIIAKLERGDVTLDESISIYERGE 48 D SH FEE + ++ V+++ + E Sbjct: 104 DASHHAFEENLELTSKVVKMAHNAGVSVEAELGRLMGIE 142 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.313 0.133 0.360 Gapped Lambda K H 0.267 0.0584 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 698,112 Number of extensions: 26981 Number of successful extensions: 129 Number of sequences better than 10.0: 1 Number of HSP's gapped: 128 Number of HSP's successfully gapped: 23 Length of query: 86 Length of database: 5,693,230 Length adjustment: 54 Effective length of query: 32 Effective length of database: 4,384,054 Effective search space: 140289728 Effective search space used: 140289728 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 50 (23.4 bits)