BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780467|ref|YP_003064880.1| exodeoxyribonuclease VII small subunit [Candidatus Liberibacter asiaticus str. psy62] (86 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780467|ref|YP_003064880.1| exodeoxyribonuclease VII small subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 86 Score = 172 bits (437), Expect = 8e-46, Method: Compositional matrix adjust. Identities = 86/86 (100%), Positives = 86/86 (100%) Query: 1 MNDDSINLDDLSHLPFEEAVSELENIIAKLERGDVTLDESISIYERGEALKSHCEFLLCS 60 MNDDSINLDDLSHLPFEEAVSELENIIAKLERGDVTLDESISIYERGEALKSHCEFLLCS Sbjct: 1 MNDDSINLDDLSHLPFEEAVSELENIIAKLERGDVTLDESISIYERGEALKSHCEFLLCS 60 Query: 61 AEKRIEQIKLNRDNKIQSVKPFDEKN 86 AEKRIEQIKLNRDNKIQSVKPFDEKN Sbjct: 61 AEKRIEQIKLNRDNKIQSVKPFDEKN 86 >gi|254780979|ref|YP_003065392.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Candidatus Liberibacter asiaticus str. psy62] Length = 500 Score = 23.9 bits (50), Expect = 0.57, Method: Compositional matrix adjust. Identities = 9/28 (32%), Positives = 15/28 (53%) Query: 28 AKLERGDVTLDESISIYERGEALKSHCE 55 +E G + D ++S+ GEA + CE Sbjct: 209 GNMEEGSMRADVNVSVCRPGEAWGTRCE 236 >gi|254780653|ref|YP_003065066.1| phosphoglycerate kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 400 Score = 20.0 bits (40), Expect = 8.0, Method: Composition-based stats. Identities = 7/18 (38%), Positives = 12/18 (66%) Query: 15 PFEEAVSELENIIAKLER 32 PF+ A E+ + +AKL + Sbjct: 328 PFDRATVEVAHYVAKLTK 345 >gi|254780588|ref|YP_003065001.1| acetyl-CoA carboxylase carboxyltransferase subunit alpha [Candidatus Liberibacter asiaticus str. psy62] Length = 317 Score = 19.6 bits (39), Expect = 9.5, Method: Compositional matrix adjust. Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Query: 13 HLPFEEAVSELENII---AKLERGDVTLDES 40 +L FEE +S+LE I KL R D+ D S Sbjct: 4 YLDFEEPISDLEAKIHELKKLSREDINEDFS 34 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.313 0.133 0.360 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,972 Number of Sequences: 1233 Number of extensions: 1728 Number of successful extensions: 10 Number of sequences better than 100.0: 10 Number of HSP's better than 100.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of query: 86 length of database: 328,796 effective HSP length: 55 effective length of query: 31 effective length of database: 260,981 effective search space: 8090411 effective search space used: 8090411 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (20.5 bits) S2: 31 (16.5 bits)