BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254780469|ref|YP_003064882.1| zinc-binding protein [Candidatus Liberibacter asiaticus str. psy62] (63 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done Results from round 1 >gi|254780469|ref|YP_003064882.1| zinc-binding protein [Candidatus Liberibacter asiaticus str. psy62] gi|254040146|gb|ACT56942.1| zinc-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 63 Score = 131 bits (330), Expect = 3e-29, Method: Compositional matrix adjust. Identities = 63/63 (100%), Positives = 63/63 (100%) Query: 1 MQTSDFRSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK 60 MQTSDFRSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK Sbjct: 1 MQTSDFRSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK 60 Query: 61 DIL 63 DIL Sbjct: 61 DIL 63 >gi|315122075|ref|YP_004062564.1| zinc-binding protein [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495477|gb|ADR52076.1| zinc-binding protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 62 Score = 73.2 bits (178), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 34/58 (58%), Positives = 41/58 (70%) Query: 1 MQTSDFRSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 MQ SD ++ +CPECRK S+ FYPFCST+CRSIDLSRWL YVI E+E +E Sbjct: 1 MQKSDCELVRCLCPECRKDSVSAFYPFCSTRCRSIDLSRWLSDGYVIVRTENEAFNKE 58 >gi|325291922|ref|YP_004277786.1| hypothetical protein AGROH133_03916 [Agrobacterium sp. H13-3] gi|325059775|gb|ADY63466.1| hypothetical protein AGROH133_03916 [Agrobacterium sp. H13-3] Length = 75 Score = 63.5 bits (153), Expect = 1e-08, Method: Compositional matrix adjust. Identities = 26/46 (56%), Positives = 33/46 (71%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CPEC + S E YPFCS +CRS+DL+RWL+G Y I +DE S +E Sbjct: 21 CPECGRPSTREDYPFCSDRCRSLDLARWLNGSYAIPVADDESSADE 66 >gi|110632547|ref|YP_672755.1| zinc-binding protein [Mesorhizobium sp. BNC1] gi|110283531|gb|ABG61590.1| protein of unknown function DUF329 [Chelativorans sp. BNC1] Length = 70 Score = 62.4 bits (150), Expect = 2e-08, Method: Compositional matrix adjust. Identities = 28/49 (57%), Positives = 33/49 (67%) Query: 10 KSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 K CPEC K S EFYPFCS +C+ IDL+RWL G YVI E+ E+E Sbjct: 17 KRPCPECGKPSSREFYPFCSKRCKDIDLNRWLSGSYVIPGRPAEEEEDE 65 >gi|190890287|ref|YP_001976829.1| hypothetical protein RHECIAT_CH0000661 [Rhizobium etli CIAT 652] gi|254806566|sp|B3PNT8|Y661_RHIE6 RecName: Full=UPF0243 zinc-binding protein RHECIAT_CH0000661 gi|190695566|gb|ACE89651.1| hypothetical conserved protein [Rhizobium etli CIAT 652] Length = 70 Score = 62.0 bits (149), Expect = 3e-08, Method: Compositional matrix adjust. Identities = 26/41 (63%), Positives = 28/41 (68%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDE 53 CPEC K S E YPFCS +CR +DLSRWL G Y I EDE Sbjct: 20 CPECGKPSNREHYPFCSNRCREVDLSRWLTGSYAIPVAEDE 60 >gi|319899329|ref|YP_004159426.1| hypothetical protein BARCL_1184 [Bartonella clarridgeiae 73] gi|319403297|emb|CBI76856.1| conserved protein of unknown function [Bartonella clarridgeiae 73] Length = 74 Score = 61.2 bits (147), Expect = 4e-08, Method: Compositional matrix adjust. Identities = 27/58 (46%), Positives = 39/58 (67%), Gaps = 1/58 (1%) Query: 1 MQTSDFRSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 +Q ++ RS + CPEC K S + YPFCS++CR++DL+RWL G YV+ + EEE Sbjct: 18 LQKNNLRSSRP-CPECGKISQQDSYPFCSSRCRAVDLNRWLSGAYVLPPPPQKTDEEE 74 >gi|319782084|ref|YP_004141560.1| hypothetical protein Mesci_2363 [Mesorhizobium ciceri biovar biserrulae WSM1271] gi|317167972|gb|ADV11510.1| protein of unknown function DUF329 [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 65 Score = 61.2 bits (147), Expect = 4e-08, Method: Compositional matrix adjust. Identities = 26/44 (59%), Positives = 32/44 (72%) Query: 10 KSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDE 53 K CPEC K S + +PFCST+C+ IDL+RWL G YVI A +DE Sbjct: 13 KRPCPECGKPSARDSFPFCSTRCKDIDLNRWLKGAYVIKARDDE 56 >gi|209547853|ref|YP_002279770.1| zinc-binding protein [Rhizobium leguminosarum bv. trifolii WSM2304] gi|254801337|sp|B5ZPM7|Y244_RHILW RecName: Full=UPF0243 zinc-binding protein Rleg2_0244 gi|209533609|gb|ACI53544.1| protein of unknown function DUF329 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 70 Score = 60.8 bits (146), Expect = 5e-08, Method: Compositional matrix adjust. Identities = 26/45 (57%), Positives = 29/45 (64%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CPEC K S E YPFCS +CR +DLSRWL G Y I +DE E Sbjct: 20 CPECGKPSHREHYPFCSNRCREVDLSRWLTGAYAIPVADDETKAE 64 >gi|121601685|ref|YP_988549.1| hypothetical protein BARBAKC583_0213 [Bartonella bacilliformis KC583] gi|120613862|gb|ABM44463.1| conserved hypothetical protein [Bartonella bacilliformis KC583] Length = 60 Score = 60.8 bits (146), Expect = 5e-08, Method: Compositional matrix adjust. Identities = 27/60 (45%), Positives = 35/60 (58%), Gaps = 2/60 (3%) Query: 1 MQTSDFRSLKSI--CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 MQ L+ CPEC + S YPFCS++CR+IDL+RWL G Y++ E EEE Sbjct: 1 MQNQPIHPLRPPRPCPECGQKSQYNTYPFCSSRCRAIDLNRWLSGSYILPPPSQESDEEE 60 >gi|218514742|ref|ZP_03511582.1| zinc-binding protein [Rhizobium etli 8C-3] Length = 84 Score = 60.8 bits (146), Expect = 5e-08, Method: Compositional matrix adjust. Identities = 25/41 (60%), Positives = 28/41 (68%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDE 53 CPEC K S E YPFCS +CR +DLSRWL G Y I +DE Sbjct: 20 CPECGKPSNREHYPFCSNRCREVDLSRWLTGSYAIPVADDE 60 >gi|86356238|ref|YP_468130.1| zinc-binding protein [Rhizobium etli CFN 42] gi|123513090|sp|Q2KCN3|Y586_RHIEC RecName: Full=UPF0243 zinc-binding protein RHE_CH00586 gi|86280340|gb|ABC89403.1| hypothetical conserved protein [Rhizobium etli CFN 42] Length = 70 Score = 60.8 bits (146), Expect = 7e-08, Method: Compositional matrix adjust. Identities = 25/41 (60%), Positives = 28/41 (68%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDE 53 CPEC K S E YPFCS +CR +DLSRWL G Y I +DE Sbjct: 20 CPECGKPSNREHYPFCSNRCREVDLSRWLTGSYAIPVADDE 60 >gi|319407683|emb|CBI81331.1| conserved hypothetical protein [Bartonella sp. 1-1C] Length = 74 Score = 60.5 bits (145), Expect = 8e-08, Method: Compositional matrix adjust. Identities = 27/57 (47%), Positives = 37/57 (64%), Gaps = 1/57 (1%) Query: 2 QTSDFRSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 Q ++ R + CPEC K S + YPFCS++CR+IDL+RWL G YV+ + EEE Sbjct: 19 QKNNLRPSRP-CPECGKMSQQDSYPFCSSRCRAIDLNRWLSGAYVLPPPPQKTDEEE 74 >gi|319406203|emb|CBI79840.1| conserved hypothetical protein [Bartonella sp. AR 15-3] Length = 74 Score = 60.5 bits (145), Expect = 9e-08, Method: Compositional matrix adjust. Identities = 26/58 (44%), Positives = 37/58 (63%), Gaps = 1/58 (1%) Query: 1 MQTSDFRSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 +Q ++ R + CPEC K S + YPFCS +CR+IDL+RWL G Y++ + EEE Sbjct: 18 LQKNNLRPSRP-CPECGKMSQQDSYPFCSARCRAIDLNRWLSGAYILPPPPQKTDEEE 74 >gi|116250390|ref|YP_766228.1| zinc-binding protein [Rhizobium leguminosarum bv. viciae 3841] gi|254806540|sp|Q1MLP1|Y618_RHIL3 RecName: Full=UPF0243 zinc-binding protein RL0618 gi|115255038|emb|CAK06112.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae 3841] Length = 70 Score = 59.7 bits (143), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 26/45 (57%), Positives = 28/45 (62%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CPEC K S E YPFCS +CR DLSRWL G Y I +DE E Sbjct: 20 CPECGKPSNREHYPFCSNRCREADLSRWLTGAYAIPVADDETKAE 64 >gi|163761349|ref|ZP_02168424.1| zinc-binding protein [Hoeflea phototrophica DFL-43] gi|162281506|gb|EDQ31802.1| zinc-binding protein [Hoeflea phototrophica DFL-43] Length = 67 Score = 59.7 bits (143), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 25/46 (54%), Positives = 32/46 (69%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CPEC++ S E YPFCS +CR+IDL+RWL G Y I E E + +E Sbjct: 16 CPECKRPSTRESYPFCSERCRNIDLNRWLGGSYAIPVTEVEDNHDE 61 >gi|260467497|ref|ZP_05813665.1| protein of unknown function DUF329 [Mesorhizobium opportunistum WSM2075] gi|259028724|gb|EEW30032.1| protein of unknown function DUF329 [Mesorhizobium opportunistum WSM2075] Length = 65 Score = 59.7 bits (143), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 26/40 (65%), Positives = 29/40 (72%) Query: 10 KSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAA 49 K CPEC K S E YPFCST+C+ IDL+RWL G YVI A Sbjct: 13 KRPCPECGKPSARETYPFCSTRCKDIDLNRWLKGAYVIKA 52 >gi|239831086|ref|ZP_04679415.1| zinc-binding protein [Ochrobactrum intermedium LMG 3301] gi|239823353|gb|EEQ94921.1| zinc-binding protein [Ochrobactrum intermedium LMG 3301] Length = 71 Score = 59.7 bits (143), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 26/46 (56%), Positives = 32/46 (69%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CPEC K S E YPFCS +C+SIDL+RWL G YV+ ++ EEE Sbjct: 24 CPECGKPSTRESYPFCSPRCKSIDLNRWLSGSYVLPGKPIDEEEEE 69 >gi|126726689|ref|ZP_01742529.1| hypothetical protein RB2150_17204 [Rhodobacterales bacterium HTCC2150] gi|126704018|gb|EBA03111.1| hypothetical protein RB2150_17204 [Rhodobacterales bacterium HTCC2150] Length = 60 Score = 59.3 bits (142), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 27/51 (52%), Positives = 35/51 (68%), Gaps = 1/51 (1%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDIL 63 CP C+K ++VEF PFCS +C IDL RW+ G+Y I AV DE S +E D + Sbjct: 3 CPICKKSTVVEFRPFCSLRCADIDLGRWVTGKYAIPAV-DEDSIDEAADAI 52 >gi|241203026|ref|YP_002974122.1| zinc-binding protein [Rhizobium leguminosarum bv. trifolii WSM1325] gi|240856916|gb|ACS54583.1| protein of unknown function DUF329 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 70 Score = 59.3 bits (142), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 25/41 (60%), Positives = 27/41 (65%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDE 53 CPEC K S E YPFCS +CR DLSRWL G Y I +DE Sbjct: 20 CPECGKPSHREHYPFCSNRCREADLSRWLTGAYAIPVADDE 60 >gi|222147500|ref|YP_002548457.1| hypothetical protein Avi_0636 [Agrobacterium vitis S4] gi|254806556|sp|B9JR40|Y636_AGRVS RecName: Full=UPF0243 zinc-binding protein Avi_0636 gi|221734490|gb|ACM35453.1| conserved hypothetical protein [Agrobacterium vitis S4] Length = 69 Score = 58.9 bits (141), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 25/46 (54%), Positives = 30/46 (65%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CPEC S E YPFCS +CR+ DLSRWL G Y I EDE + ++ Sbjct: 20 CPECGHPSHREHYPFCSDRCRTQDLSRWLKGSYAIPVAEDESNPDD 65 >gi|227820811|ref|YP_002824781.1| zinc-binding protein [Sinorhizobium fredii NGR234] gi|254801295|sp|C3MFX7|Y229_RHISN RecName: Full=UPF0243 zinc-binding protein NGR_c02290 gi|227339810|gb|ACP24028.1| hypothetical protein contains zinc-binding domain [Sinorhizobium fredii NGR234] Length = 69 Score = 58.9 bits (141), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 25/47 (53%), Positives = 35/47 (74%), Gaps = 1/47 (2%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDE-KSEEE 58 CPEC + S+ E YPFCS +CR++DL+RWL G Y I +DE K+++E Sbjct: 21 CPECGRPSVRERYPFCSERCRNVDLNRWLSGSYAIPVADDESKADDE 67 >gi|222087233|ref|YP_002545768.1| hypothetical protein Arad_4034 [Agrobacterium radiobacter K84] gi|221724681|gb|ACM27837.1| conserved hypothetical protein [Agrobacterium radiobacter K84] Length = 71 Score = 58.9 bits (141), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 25/41 (60%), Positives = 29/41 (70%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDE 53 C EC + SM E YPFCS +CRS DLSRWL+G Y I ED+ Sbjct: 22 CVECGRPSMREHYPFCSDRCRSADLSRWLNGSYAIPVAEDQ 62 >gi|254701071|ref|ZP_05162899.1| zinc-binding protein [Brucella suis bv. 5 str. 513] Length = 71 Score = 58.5 bits (140), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 24/37 (64%), Positives = 28/37 (75%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAA 49 CPEC K S E YPFCS +C++IDL+RWL G YVIA Sbjct: 24 CPECGKPSTREAYPFCSPRCKNIDLNRWLSGSYVIAG 60 >gi|225851799|ref|YP_002732032.1| zinc-binding protein [Brucella melitensis ATCC 23457] gi|225640164|gb|ACO00078.1| protein of unknown function DUF329 [Brucella melitensis ATCC 23457] gi|326408293|gb|ADZ65358.1| zinc-binding protein [Brucella melitensis M28] gi|326538007|gb|ADZ86222.1| conserved hypothetical protein [Brucella melitensis M5-90] Length = 71 Score = 58.5 bits (140), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 24/37 (64%), Positives = 28/37 (75%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAA 49 CPEC K S E YPFCS +C++IDL+RWL G YVIA Sbjct: 24 CPECGKPSTREAYPFCSPRCKNIDLNRWLSGSYVIAG 60 >gi|62289248|ref|YP_221041.1| zinc-binding protein [Brucella abortus bv. 1 str. 9-941] gi|189023504|ref|YP_001934272.1| zinc-binding protein [Brucella abortus S19] gi|237814737|ref|ZP_04593735.1| zinc-binding protein [Brucella abortus str. 2308 A] gi|254696691|ref|ZP_05158519.1| zinc-binding protein [Brucella abortus bv. 2 str. 86/8/59] gi|254731599|ref|ZP_05190177.1| zinc-binding protein [Brucella abortus bv. 4 str. 292] gi|260546538|ref|ZP_05822278.1| zinc-binding protein [Brucella abortus NCTC 8038] gi|62195380|gb|AAX73680.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941] gi|189019076|gb|ACD71798.1| zinc-binding protein [Brucella abortus S19] gi|237789574|gb|EEP63784.1| zinc-binding protein [Brucella abortus str. 2308 A] gi|260096645|gb|EEW80521.1| zinc-binding protein [Brucella abortus NCTC 8038] Length = 71 Score = 58.5 bits (140), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 24/37 (64%), Positives = 28/37 (75%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAA 49 CPEC K S E YPFCS +C++IDL+RWL G YVIA Sbjct: 24 CPECGKPSTREAYPFCSPRCKNIDLNRWLSGSYVIAG 60 >gi|17987956|ref|NP_540590.1| zinc-binding protein [Brucella melitensis bv. 1 str. 16M] gi|148559915|ref|YP_001258295.1| zinc-binding protein [Brucella ovis ATCC 25840] gi|161618228|ref|YP_001592115.1| zinc-binding protein [Brucella canis ATCC 23365] gi|163842532|ref|YP_001626936.1| zinc-binding protein [Brucella suis ATCC 23445] gi|225626778|ref|ZP_03784817.1| zinc-binding protein [Brucella ceti str. Cudo] gi|254690566|ref|ZP_05153820.1| zinc-binding protein [Brucella abortus bv. 6 str. 870] gi|254695057|ref|ZP_05156885.1| zinc-binding protein [Brucella abortus bv. 3 str. Tulya] gi|254705421|ref|ZP_05167249.1| zinc-binding protein [Brucella suis bv. 3 str. 686] gi|254708003|ref|ZP_05169831.1| zinc-binding protein [Brucella pinnipedialis M163/99/10] gi|254709417|ref|ZP_05171228.1| zinc-binding protein [Brucella pinnipedialis B2/94] gi|254713163|ref|ZP_05174974.1| zinc-binding protein [Brucella ceti M644/93/1] gi|254716483|ref|ZP_05178294.1| zinc-binding protein [Brucella ceti M13/05/1] gi|254718455|ref|ZP_05180266.1| zinc-binding protein [Brucella sp. 83/13] gi|256030911|ref|ZP_05444525.1| zinc-binding protein [Brucella pinnipedialis M292/94/1] gi|256046062|ref|ZP_05448934.1| zinc-binding protein [Brucella melitensis bv. 1 str. Rev.1] gi|256060404|ref|ZP_05450577.1| zinc-binding protein [Brucella neotomae 5K33] gi|256112774|ref|ZP_05453695.1| zinc-binding protein [Brucella melitensis bv. 3 str. Ether] gi|256158951|ref|ZP_05456794.1| zinc-binding protein [Brucella ceti M490/95/1] gi|256254316|ref|ZP_05459852.1| zinc-binding protein [Brucella ceti B1/94] gi|256258821|ref|ZP_05464357.1| zinc-binding protein [Brucella abortus bv. 9 str. C68] gi|260169812|ref|ZP_05756623.1| zinc-binding protein [Brucella sp. F5/99] gi|260563340|ref|ZP_05833826.1| zinc-binding protein [Brucella melitensis bv. 1 str. 16M] gi|260567124|ref|ZP_05837594.1| zinc-binding protein [Brucella suis bv. 4 str. 40] gi|261218274|ref|ZP_05932555.1| zinc-binding protein [Brucella ceti M13/05/1] gi|261221473|ref|ZP_05935754.1| zinc-binding protein [Brucella ceti B1/94] gi|265983422|ref|ZP_06096157.1| zinc-binding protein [Brucella sp. 83/13] gi|265987972|ref|ZP_06100529.1| zinc-binding protein [Brucella pinnipedialis M292/94/1] gi|265997434|ref|ZP_06109991.1| zinc-binding protein [Brucella ceti M490/95/1] gi|294851642|ref|ZP_06792315.1| hypothetical protein BAZG_00553 [Brucella sp. NVSL 07-0026] gi|297247660|ref|ZP_06931378.1| conserved hypothetical protein [Brucella abortus bv. 5 str. B3196] gi|306840167|ref|ZP_07472951.1| zinc-binding protein [Brucella sp. NF 2653] gi|306842475|ref|ZP_07475126.1| zinc-binding protein [Brucella sp. BO2] gi|306844896|ref|ZP_07477478.1| zinc-binding protein [Brucella sp. BO1] gi|17983696|gb|AAL52854.1| non-essential pilus assembly protein [Brucella melitensis bv. 1 str. 16M] gi|148371172|gb|ABQ61151.1| conserved hypothetical protein [Brucella ovis ATCC 25840] gi|161335039|gb|ABX61344.1| protein of unknown function DUF329 [Brucella canis ATCC 23365] gi|163673255|gb|ABY37366.1| protein of unknown function DUF329 [Brucella suis ATCC 23445] gi|225618435|gb|EEH15478.1| zinc-binding protein [Brucella ceti str. Cudo] gi|260153356|gb|EEW88448.1| zinc-binding protein [Brucella melitensis bv. 1 str. 16M] gi|260156642|gb|EEW91722.1| zinc-binding protein [Brucella suis bv. 4 str. 40] gi|260920057|gb|EEX86710.1| zinc-binding protein [Brucella ceti B1/94] gi|260923363|gb|EEX89931.1| zinc-binding protein [Brucella ceti M13/05/1] gi|262551902|gb|EEZ07892.1| zinc-binding protein [Brucella ceti M490/95/1] gi|264660169|gb|EEZ30430.1| zinc-binding protein [Brucella pinnipedialis M292/94/1] gi|264662014|gb|EEZ32275.1| zinc-binding protein [Brucella sp. 83/13] gi|294820231|gb|EFG37230.1| hypothetical protein BAZG_00553 [Brucella sp. NVSL 07-0026] gi|297174829|gb|EFH34176.1| conserved hypothetical protein [Brucella abortus bv. 5 str. B3196] gi|306274725|gb|EFM56509.1| zinc-binding protein [Brucella sp. BO1] gi|306287331|gb|EFM58811.1| zinc-binding protein [Brucella sp. BO2] gi|306404765|gb|EFM61060.1| zinc-binding protein [Brucella sp. NF 2653] Length = 71 Score = 58.5 bits (140), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 24/37 (64%), Positives = 28/37 (75%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAA 49 CPEC K S E YPFCS +C++IDL+RWL G YVIA Sbjct: 24 CPECGKPSTREAYPFCSPRCKNIDLNRWLSGSYVIAG 60 >gi|261751603|ref|ZP_05995312.1| zinc-binding protein [Brucella suis bv. 5 str. 513] gi|261741356|gb|EEY29282.1| zinc-binding protein [Brucella suis bv. 5 str. 513] Length = 57 Score = 58.2 bits (139), Expect = 4e-07, Method: Compositional matrix adjust. Identities = 27/47 (57%), Positives = 32/47 (68%), Gaps = 1/47 (2%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVE-DEKSEEE 58 CPEC K S E YPFCS +C++IDL+RWL G YVIA EK E + Sbjct: 10 CPECGKPSTREAYPFCSPRCKNIDLNRWLSGSYVIAGKPLGEKDEND 56 >gi|23501154|ref|NP_697281.1| zinc-binding protein [Brucella suis 1330] gi|256368708|ref|YP_003106214.1| zinc-binding protein [Brucella microti CCM 4915] gi|260756135|ref|ZP_05868483.1| zinc-binding protein [Brucella abortus bv. 6 str. 870] gi|260885154|ref|ZP_05896768.1| zinc-binding protein [Brucella abortus bv. 9 str. C68] gi|261215409|ref|ZP_05929690.1| zinc-binding protein [Brucella abortus bv. 3 str. Tulya] gi|261315497|ref|ZP_05954694.1| zinc-binding protein [Brucella pinnipedialis M163/99/10] gi|261316935|ref|ZP_05956132.1| zinc-binding protein [Brucella pinnipedialis B2/94] gi|261320878|ref|ZP_05960075.1| zinc-binding protein [Brucella ceti M644/93/1] gi|261324390|ref|ZP_05963587.1| zinc-binding protein [Brucella neotomae 5K33] gi|261756138|ref|ZP_05999847.1| zinc-binding protein [Brucella suis bv. 3 str. 686] gi|261759357|ref|ZP_06003066.1| zinc-binding protein [Brucella sp. F5/99] gi|265992476|ref|ZP_06105033.1| zinc-binding protein [Brucella melitensis bv. 1 str. Rev.1] gi|265994217|ref|ZP_06106774.1| zinc-binding protein [Brucella melitensis bv. 3 str. Ether] gi|265999635|ref|ZP_05467216.2| zinc-binding protein [Brucella melitensis bv. 2 str. 63/9] gi|54039925|sp|P67480|Y247_BRUSU RecName: Full=UPF0243 zinc-binding protein BR0247 gi|54042760|sp|P67479|Y1673_BRUME RecName: Full=UPF0243 zinc-binding protein BMEI1673 gi|23347030|gb|AAN29196.1| conserved hypothetical protein [Brucella suis 1330] gi|255998866|gb|ACU47265.1| zinc-binding protein [Brucella microti CCM 4915] gi|260676243|gb|EEX63064.1| zinc-binding protein [Brucella abortus bv. 6 str. 870] gi|260874682|gb|EEX81751.1| zinc-binding protein [Brucella abortus bv. 9 str. C68] gi|260917016|gb|EEX83877.1| zinc-binding protein [Brucella abortus bv. 3 str. Tulya] gi|261293568|gb|EEX97064.1| zinc-binding protein [Brucella ceti M644/93/1] gi|261296158|gb|EEX99654.1| zinc-binding protein [Brucella pinnipedialis B2/94] gi|261300370|gb|EEY03867.1| zinc-binding protein [Brucella neotomae 5K33] gi|261304523|gb|EEY08020.1| zinc-binding protein [Brucella pinnipedialis M163/99/10] gi|261739341|gb|EEY27337.1| zinc-binding protein [Brucella sp. F5/99] gi|261745891|gb|EEY33817.1| zinc-binding protein [Brucella suis bv. 3 str. 686] gi|262765198|gb|EEZ11119.1| zinc-binding protein [Brucella melitensis bv. 3 str. Ether] gi|263003542|gb|EEZ15835.1| zinc-binding protein [Brucella melitensis bv. 1 str. Rev.1] gi|263095092|gb|EEZ18761.1| zinc-binding protein [Brucella melitensis bv. 2 str. 63/9] Length = 57 Score = 58.2 bits (139), Expect = 4e-07, Method: Compositional matrix adjust. Identities = 24/37 (64%), Positives = 28/37 (75%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAA 49 CPEC K S E YPFCS +C++IDL+RWL G YVIA Sbjct: 10 CPECGKPSTREAYPFCSPRCKNIDLNRWLSGSYVIAG 46 >gi|82699180|ref|YP_413754.1| zinc-binding protein [Brucella melitensis biovar Abortus 2308] gi|260759359|ref|ZP_05871707.1| zinc-binding protein [Brucella abortus bv. 4 str. 292] gi|260761080|ref|ZP_05873423.1| zinc-binding protein [Brucella abortus bv. 2 str. 86/8/59] gi|123546884|sp|Q2YPC3|Y280_BRUA2 RecName: Full=UPF0243 zinc-binding protein BAB1_0280 gi|82615281|emb|CAJ10236.1| Domain of unknown function DUF329 [Brucella melitensis biovar Abortus 2308] gi|260669677|gb|EEX56617.1| zinc-binding protein [Brucella abortus bv. 4 str. 292] gi|260671512|gb|EEX58333.1| zinc-binding protein [Brucella abortus bv. 2 str. 86/8/59] Length = 57 Score = 58.2 bits (139), Expect = 4e-07, Method: Compositional matrix adjust. Identities = 24/37 (64%), Positives = 28/37 (75%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAA 49 CPEC K S E YPFCS +C++IDL+RWL G YVIA Sbjct: 10 CPECGKPSTREAYPFCSPRCKNIDLNRWLSGSYVIAG 46 >gi|153007666|ref|YP_001368881.1| zinc-binding protein [Ochrobactrum anthropi ATCC 49188] gi|151559554|gb|ABS13052.1| protein of unknown function DUF329 [Ochrobactrum anthropi ATCC 49188] Length = 71 Score = 57.4 bits (137), Expect = 6e-07, Method: Compositional matrix adjust. Identities = 25/45 (55%), Positives = 31/45 (68%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CPEC K S E YPFCS +C+SIDL+RWL G YV+ ++ EE Sbjct: 24 CPECGKPSSRESYPFCSPRCKSIDLNRWLSGSYVLPGKPIDEEEE 68 >gi|49476076|ref|YP_034117.1| zinc-binding protein [Bartonella henselae str. Houston-1] gi|49238884|emb|CAF28177.1| hypothetical protein BH14120 [Bartonella henselae str. Houston-1] Length = 94 Score = 57.4 bits (137), Expect = 6e-07, Method: Compositional matrix adjust. Identities = 22/47 (46%), Positives = 32/47 (68%) Query: 12 ICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 +CP C + + YPFCST+CR+IDL+RWL G Y++ + + EEE Sbjct: 48 LCPICGQMAQQNAYPFCSTRCRAIDLNRWLSGSYILPPLPQKADEEE 94 >gi|150395440|ref|YP_001325907.1| zinc-binding protein [Sinorhizobium medicae WSM419] gi|166227666|sp|A6U5Z2|Y213_SINMW RecName: Full=UPF0243 zinc-binding protein Smed_0213 gi|150026955|gb|ABR59072.1| protein of unknown function DUF329 [Sinorhizobium medicae WSM419] Length = 70 Score = 56.2 bits (134), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 24/47 (51%), Positives = 34/47 (72%), Gaps = 1/47 (2%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDE-KSEEE 58 C EC + S+ E YPFCS +CR++DL+RWL G Y I +DE K+++E Sbjct: 21 CAECGRPSVREHYPFCSERCRNVDLNRWLSGSYAIPVADDESKADDE 67 >gi|15964369|ref|NP_384722.1| zinc-binding protein [Sinorhizobium meliloti 1021] gi|307307087|ref|ZP_07586826.1| protein of unknown function DUF329 [Sinorhizobium meliloti BL225C] gi|307321489|ref|ZP_07600885.1| protein of unknown function DUF329 [Sinorhizobium meliloti AK83] gi|31563281|sp|Q92S21|Y616_RHIME RecName: Full=UPF0243 zinc-binding protein R00616 gi|15073546|emb|CAC45188.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021] gi|306892874|gb|EFN23664.1| protein of unknown function DUF329 [Sinorhizobium meliloti AK83] gi|306902027|gb|EFN32626.1| protein of unknown function DUF329 [Sinorhizobium meliloti BL225C] Length = 70 Score = 56.2 bits (134), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 22/46 (47%), Positives = 31/46 (67%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 C EC + S+ E YPFCS +CR++DL+RWL G Y I +DE ++ Sbjct: 21 CAECGRPSVREHYPFCSERCRNVDLNRWLSGSYAIPVADDESKADD 66 >gi|240851126|ref|YP_002972528.1| zinc-binding protein [Bartonella grahamii as4aup] gi|240268249|gb|ACS51837.1| zinc-binding protein [Bartonella grahamii as4aup] Length = 94 Score = 55.5 bits (132), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 23/46 (50%), Positives = 30/46 (65%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C + S YPFCST+CR+IDL+RWL G Y++ + EEE Sbjct: 49 CPICGQMSQQNAYPFCSTRCRAIDLNRWLSGAYILPPPPQKSDEEE 94 >gi|13475395|ref|NP_106959.1| zinc-binding protein [Mesorhizobium loti MAFF303099] gi|31563284|sp|Q989F2|Y6451_RHILO RecName: Full=UPF0243 zinc-binding protein msl6451 gi|14026147|dbj|BAB52745.1| msl6451 [Mesorhizobium loti MAFF303099] Length = 65 Score = 55.1 bits (131), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 23/40 (57%), Positives = 28/40 (70%) Query: 10 KSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAA 49 K CPEC K S + +PFCS +C+ IDL+RWL G YVI A Sbjct: 13 KRPCPECGKPSARDTFPFCSARCKDIDLNRWLKGAYVIKA 52 >gi|154250985|ref|YP_001411809.1| hypothetical protein Plav_0529 [Parvibaculum lavamentivorans DS-1] gi|154154935|gb|ABS62152.1| protein of unknown function DUF329 [Parvibaculum lavamentivorans DS-1] Length = 75 Score = 54.7 bits (130), Expect = 5e-06, Method: Compositional matrix adjust. Identities = 22/39 (56%), Positives = 27/39 (69%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVE 51 CP C + S+ EF+PFCS C +DL+RWL G Y I AVE Sbjct: 17 CPICARKSVPEFHPFCSKHCADVDLNRWLKGGYAIPAVE 55 >gi|254471921|ref|ZP_05085322.1| conserved domain protein [Pseudovibrio sp. JE062] gi|211959123|gb|EEA94322.1| conserved domain protein [Pseudovibrio sp. JE062] Length = 65 Score = 54.3 bits (129), Expect = 5e-06, Method: Compositional matrix adjust. Identities = 22/50 (44%), Positives = 33/50 (66%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 CP C K + PFCS +C+ +DL++WL G Y + AVE+E SE ++ D+ Sbjct: 9 CPICEKPTQEATKPFCSDRCKQVDLNKWLSGHYSVPAVEEEFSESDISDL 58 >gi|27376371|ref|NP_767900.1| zinc-binding protein [Bradyrhizobium japonicum USDA 110] gi|31563248|sp|Q89UZ9|Y1260_BRAJA RecName: Full=UPF0243 zinc-binding protein bsr1260 gi|27349511|dbj|BAC46525.1| bsr1260 [Bradyrhizobium japonicum USDA 110] Length = 60 Score = 54.3 bits (129), Expect = 6e-06, Method: Compositional matrix adjust. Identities = 22/46 (47%), Positives = 31/46 (67%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K ++ +PFCS++CR +DL+RWL G YVI +DE + E Sbjct: 15 CPICGKPAVQATHPFCSSRCRDVDLNRWLKGSYVIPGRDDEVDDVE 60 >gi|154246663|ref|YP_001417621.1| hypothetical protein Xaut_2724 [Xanthobacter autotrophicus Py2] gi|154160748|gb|ABS67964.1| protein of unknown function DUF329 [Xanthobacter autotrophicus Py2] Length = 76 Score = 53.9 bits (128), Expect = 8e-06, Method: Compositional matrix adjust. Identities = 23/55 (41%), Positives = 31/55 (56%) Query: 7 RSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 R + CP C K S F+PFCS +C +DL RWL G Y I +E+ + E +D Sbjct: 20 RYVSKPCPICSKPSAERFHPFCSKRCADVDLHRWLSGSYAIPGRPEEEEDGEAQD 74 >gi|114707696|ref|ZP_01440591.1| zinc-binding protein [Fulvimarina pelagi HTCC2506] gi|114536940|gb|EAU40069.1| zinc-binding protein [Fulvimarina pelagi HTCC2506] Length = 65 Score = 53.5 bits (127), Expect = 9e-06, Method: Compositional matrix adjust. Identities = 21/38 (55%), Positives = 28/38 (73%) Query: 10 KSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVI 47 K CPEC + S E +PFCS +C+++DL+RWL G YVI Sbjct: 14 KRKCPECNRESSREHFPFCSERCKAVDLNRWLAGSYVI 51 >gi|170742435|ref|YP_001771090.1| hypothetical protein M446_4313 [Methylobacterium sp. 4-46] gi|168196709|gb|ACA18656.1| protein of unknown function DUF329 [Methylobacterium sp. 4-46] Length = 65 Score = 53.5 bits (127), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 23/49 (46%), Positives = 28/49 (57%) Query: 10 KSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 + CP C + + F PFCS +C +DL RWL G Y I A EDE EE Sbjct: 12 RPPCPICGRPAAEPFRPFCSKRCADVDLQRWLSGRYAIPAREDEGPGEE 60 >gi|163868984|ref|YP_001610214.1| zinc-binding protein [Bartonella tribocorum CIP 105476] gi|161018661|emb|CAK02219.1| hypothetical protein BT_2033 [Bartonella tribocorum CIP 105476] Length = 93 Score = 53.1 bits (126), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 22/46 (47%), Positives = 29/46 (63%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C + S YPFCS++CR+IDL+RWL G Y++ EEE Sbjct: 48 CPICGQMSQTSAYPFCSSRCRAIDLNRWLSGSYILPPPPQVSDEEE 93 >gi|16126579|ref|NP_421143.1| hypothetical protein CC_2340 [Caulobacter crescentus CB15] gi|221235361|ref|YP_002517798.1| non-essential pilus assembly protein [Caulobacter crescentus NA1000] gi|31563285|sp|Q9A5V7|Y2340_CAUCR RecName: Full=UPF0243 zinc-binding protein CC_2340 gi|254801326|sp|B8GYW7|Y2425_CAUCN RecName: Full=UPF0243 zinc-binding protein CCNA_02425 gi|13423867|gb|AAK24311.1| conserved hypothetical protein [Caulobacter crescentus CB15] gi|220964534|gb|ACL95890.1| non-essential pilus assembly protein [Caulobacter crescentus NA1000] Length = 57 Score = 52.4 bits (124), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 22/54 (40%), Positives = 31/54 (57%) Query: 9 LKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 + + CP C K F PFCS +C +DL RWL G YV+A +D++ +DI Sbjct: 1 MSAKCPICAKPVDSAFRPFCSKRCADVDLQRWLSGRYVVAGGDDDEENPPSQDI 54 >gi|260431289|ref|ZP_05785260.1| conserved domain protein [Silicibacter lacuscaerulensis ITI-1157] gi|260415117|gb|EEX08376.1| conserved domain protein [Silicibacter lacuscaerulensis ITI-1157] Length = 60 Score = 52.0 bits (123), Expect = 3e-05, Method: Compositional matrix adjust. Identities = 20/51 (39%), Positives = 33/51 (64%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDIL 63 CP C + ++ F PFCS +C IDL +WL+G Y + + +E +EE++D + Sbjct: 3 CPICGEDTVKPFRPFCSKRCADIDLGKWLNGSYAVPSQREEDVDEEIQDAV 53 >gi|294678069|ref|YP_003578684.1| hypothetical protein RCAP_rcc02547 [Rhodobacter capsulatus SB 1003] gi|294476889|gb|ADE86277.1| protein of unknown function DUF329 [Rhodobacter capsulatus SB 1003] Length = 57 Score = 51.6 bits (122), Expect = 4e-05, Method: Compositional matrix adjust. Identities = 22/54 (40%), Positives = 30/54 (55%), Gaps = 4/54 (7%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYV----IAAVEDEKSEEEVKDI 62 CP C K + + PFCS +C +DL+RWL+G YV IA ED E+ + Sbjct: 3 CPICGKATAANYRPFCSKRCADVDLARWLNGSYVIPGDIAEAEDRPGEDPAGPV 56 >gi|146343404|ref|YP_001208452.1| hypothetical protein BRADO6633 [Bradyrhizobium sp. ORS278] gi|146196210|emb|CAL80237.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278] Length = 64 Score = 51.6 bits (122), Expect = 4e-05, Method: Compositional matrix adjust. Identities = 21/46 (45%), Positives = 29/46 (63%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C + + PFCS +CR +DL+RWL G YVI A E ++ + E Sbjct: 19 CPICNRPAAEASRPFCSPRCRDVDLNRWLSGSYVIPATEGDEDDVE 64 >gi|148252480|ref|YP_001237065.1| hypothetical protein BBta_0901 [Bradyrhizobium sp. BTAi1] gi|146404653|gb|ABQ33159.1| hypothetical protein BBta_0901 [Bradyrhizobium sp. BTAi1] Length = 64 Score = 51.2 bits (121), Expect = 5e-05, Method: Compositional matrix adjust. Identities = 21/46 (45%), Positives = 29/46 (63%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C + + PFCS++CR +DL RWL G YVI A E ++ + E Sbjct: 19 CPICNRPAADASRPFCSSRCRDVDLHRWLSGSYVIPATEGDEDDVE 64 >gi|49474628|ref|YP_032670.1| zinc-binding protein [Bartonella quintana str. Toulouse] gi|49240132|emb|CAF26579.1| hypothetical protein BQ11180 [Bartonella quintana str. Toulouse] Length = 100 Score = 50.8 bits (120), Expect = 6e-05, Method: Compositional matrix adjust. Identities = 20/46 (43%), Positives = 29/46 (63%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C + + YPFCST+C++IDL+RWL G Y+ + EE+ Sbjct: 55 CPICGQMAQQNVYPFCSTRCQAIDLNRWLSGSYIFPPPLQKTDEEK 100 >gi|328544716|ref|YP_004304825.1| zinc-binding protein [polymorphum gilvum SL003B-26A1] gi|326414458|gb|ADZ71521.1| zinc-binding protein [Polymorphum gilvum SL003B-26A1] Length = 65 Score = 50.8 bits (120), Expect = 7e-05, Method: Compositional matrix adjust. Identities = 22/39 (56%), Positives = 25/39 (64%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVE 51 CP C K S +E YPFCS +C IDL+RWL Y I VE Sbjct: 18 CPICSKLSTLEHYPFCSDRCAKIDLNRWLSESYTIPVVE 56 >gi|316936027|ref|YP_004111009.1| hypothetical protein Rpdx1_4729 [Rhodopseudomonas palustris DX-1] gi|315603741|gb|ADU46276.1| protein of unknown function DUF329 [Rhodopseudomonas palustris DX-1] Length = 64 Score = 50.4 bits (119), Expect = 8e-05, Method: Compositional matrix adjust. Identities = 20/45 (44%), Positives = 27/45 (60%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP C K + E +PFCS +CR +DL+RWL G Y I + E+ Sbjct: 20 CPVCGKPATAESHPFCSERCRDVDLNRWLSGSYAIPGRPADDEED 64 >gi|329115668|ref|ZP_08244390.1| UPF0243 zinc-binding protein [Acetobacter pomorum DM001] gi|326695096|gb|EGE46815.1| UPF0243 zinc-binding protein [Acetobacter pomorum DM001] Length = 61 Score = 50.1 bits (118), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 24/54 (44%), Positives = 29/54 (53%), Gaps = 5/54 (9%) Query: 8 SLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAV-----EDEKSE 56 S + CP C K + EF PFCS +C IDL RW G+Y I DEK+E Sbjct: 3 SKPAKCPVCGKPAQAEFRPFCSKRCADIDLGRWFSGDYRIPGAPVLIENDEKAE 56 >gi|258543062|ref|YP_003188495.1| hypothetical protein APA01_19930 [Acetobacter pasteurianus IFO 3283-01] gi|256634140|dbj|BAI00116.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01] gi|256637200|dbj|BAI03169.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-03] gi|256640252|dbj|BAI06214.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-07] gi|256643309|dbj|BAI09264.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-22] gi|256646364|dbj|BAI12312.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-26] gi|256649417|dbj|BAI15358.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-32] gi|256652403|dbj|BAI18337.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01-42C] gi|256655461|dbj|BAI21388.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-12] Length = 61 Score = 50.1 bits (118), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 23/54 (42%), Positives = 29/54 (53%), Gaps = 5/54 (9%) Query: 8 SLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAV-----EDEKSE 56 S + CP C K + EF PFCS +C +DL RW G+Y I DEK+E Sbjct: 3 SKPAKCPVCGKPAQAEFRPFCSKRCADVDLGRWFSGDYRIPGAPAPIENDEKAE 56 >gi|84499989|ref|ZP_00998255.1| hypothetical protein OB2597_08614 [Oceanicola batsensis HTCC2597] gi|84391923|gb|EAQ04191.1| hypothetical protein OB2597_08614 [Oceanicola batsensis HTCC2597] Length = 66 Score = 50.1 bits (118), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 21/50 (42%), Positives = 27/50 (54%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 CP C K S + PFCS C +DL+RW G Y I + E EE ++ I Sbjct: 3 CPICHKPSEATYRPFCSKHCADVDLARWFKGGYTIPSTNPEDVEEAIEAI 52 >gi|192293376|ref|YP_001993981.1| zinc-binding protein [Rhodopseudomonas palustris TIE-1] gi|192287125|gb|ACF03506.1| protein of unknown function DUF329 [Rhodopseudomonas palustris TIE-1] Length = 60 Score = 49.7 bits (117), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 19/43 (44%), Positives = 26/43 (60%) Query: 7 RSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAA 49 R+ CP C K + + +PFCS +CR +DL+RWL G Y I Sbjct: 10 RNGAKPCPVCGKPATAQSHPFCSERCRDVDLNRWLSGAYAIPG 52 >gi|260574873|ref|ZP_05842875.1| protein of unknown function DUF329 [Rhodobacter sp. SW2] gi|259022878|gb|EEW26172.1| protein of unknown function DUF329 [Rhodobacter sp. SW2] Length = 58 Score = 49.7 bits (117), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 23/54 (42%), Positives = 32/54 (59%), Gaps = 3/54 (5%) Query: 12 ICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVI---AAVEDEKSEEEVKDI 62 CP C K + ++ PFCS +C +DL RWL G YVI AA +D++S + D Sbjct: 2 TCPICAKPTDPKYRPFCSRRCADVDLGRWLAGSYVIPAEAAEDDDQSSDSNPDT 55 >gi|188581996|ref|YP_001925441.1| hypothetical protein Mpop_2751 [Methylobacterium populi BJ001] gi|179345494|gb|ACB80906.1| protein of unknown function DUF329 [Methylobacterium populi BJ001] Length = 67 Score = 49.7 bits (117), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 22/42 (52%), Positives = 25/42 (59%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEK 54 CP C K + E PFCS +C IDL RWL YVI EDE+ Sbjct: 12 CPICGKPAQPETRPFCSPRCADIDLGRWLGERYVIPGPEDEE 53 >gi|254418005|ref|ZP_05031729.1| hypothetical protein BBAL3_315 [Brevundimonas sp. BAL3] gi|196184182|gb|EDX79158.1| hypothetical protein BBAL3_315 [Brevundimonas sp. BAL3] Length = 54 Score = 49.3 bits (116), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 22/49 (44%), Positives = 29/49 (59%), Gaps = 1/49 (2%) Query: 11 SICPECRKGSM-VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 S CP CRK ++ PFCS +C +DL RW G Y I A DE +E++ Sbjct: 2 STCPICRKADADPKYKPFCSRRCSEVDLQRWFTGGYAIPAALDEGAEDD 50 >gi|182678648|ref|YP_001832794.1| hypothetical protein Bind_1674 [Beijerinckia indica subsp. indica ATCC 9039] gi|182634531|gb|ACB95305.1| protein of unknown function DUF329 [Beijerinckia indica subsp. indica ATCC 9039] Length = 72 Score = 49.3 bits (116), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 20/46 (43%), Positives = 27/46 (58%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K + F PFCS +C +DL RWL G YV+A + + E+ Sbjct: 20 CPICGKPQVQTFRPFCSKRCADVDLHRWLSGAYVVAGESNSQKPED 65 >gi|254449891|ref|ZP_05063328.1| conserved domain protein [Octadecabacter antarcticus 238] gi|198264297|gb|EDY88567.1| conserved domain protein [Octadecabacter antarcticus 238] Length = 65 Score = 48.9 bits (115), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 19/45 (42%), Positives = 28/45 (62%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP C K + F PFCS +C +DL++WL G Y IA+ + + +E Sbjct: 3 CPICDKETNAAFRPFCSKRCGDVDLAKWLGGGYAIASTDPDDMDE 47 >gi|92115920|ref|YP_575649.1| zinc-binding protein [Nitrobacter hamburgensis X14] gi|122418833|sp|Q1QRF8|Y293_NITHX RecName: Full=UPF0243 zinc-binding protein Nham_0293 gi|91798814|gb|ABE61189.1| protein of unknown function DUF329 [Nitrobacter hamburgensis X14] Length = 60 Score = 48.5 bits (114), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 20/46 (43%), Positives = 28/46 (60%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K ++ PFCS +CR +DL+RWL G YVI + + + E Sbjct: 15 CPICGKPAVAASRPFCSERCRDVDLNRWLSGSYVIPVSKTDGEDAE 60 >gi|209883883|ref|YP_002287740.1| hypothetical protein OCAR_4734 [Oligotropha carboxidovorans OM5] gi|209872079|gb|ACI91875.1| conserved domain protein [Oligotropha carboxidovorans OM5] Length = 64 Score = 48.5 bits (114), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 21/46 (45%), Positives = 28/46 (60%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K + PFCS +CR +DL+RWL G Y I A + E ++E Sbjct: 7 CPICGKPATHASRPFCSERCRDVDLNRWLSGAYAIPARDMETDDDE 52 >gi|217976942|ref|YP_002361089.1| protein of unknown function DUF329 [Methylocella silvestris BL2] gi|217502318|gb|ACK49727.1| protein of unknown function DUF329 [Methylocella silvestris BL2] Length = 73 Score = 48.5 bits (114), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 23/49 (46%), Positives = 28/49 (57%), Gaps = 3/49 (6%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP C K ++ PFCS +C +DL RWL G Y I A E +EE KD Sbjct: 22 CPICGKPAVAAMRPFCSKRCADVDLHRWLGGVYAIPASE---TEEAAKD 67 >gi|167647544|ref|YP_001685207.1| hypothetical protein Caul_3582 [Caulobacter sp. K31] gi|167349974|gb|ABZ72709.1| protein of unknown function DUF329 [Caulobacter sp. K31] Length = 60 Score = 48.5 bits (114), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 19/52 (36%), Positives = 30/52 (57%) Query: 11 SICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 S CP C+K + F PFCS +C +DL+RWL YV+ ++++ D+ Sbjct: 2 SACPICKKPTDPAFRPFCSKRCADVDLNRWLSDRYVVPGGDEDEENPPSTDL 53 >gi|302382823|ref|YP_003818646.1| hypothetical protein Bresu_1712 [Brevundimonas subvibrioides ATCC 15264] gi|302193451|gb|ADL01023.1| protein of unknown function DUF329 [Brevundimonas subvibrioides ATCC 15264] Length = 55 Score = 48.5 bits (114), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 24/53 (45%), Positives = 29/53 (54%), Gaps = 5/53 (9%) Query: 11 SICPECRKGSMVEFY-PFCSTQCRSIDLSRWLHGEYVIA----AVEDEKSEEE 58 S+CP CRK V Y PFCS +C +DL RWL G YV+ V D E + Sbjct: 2 SVCPICRKNPTVAAYRPFCSRRCADLDLQRWLVGAYVLPDTDEGVPDADPEND 54 >gi|294084880|ref|YP_003551640.1| hypothetical protein SAR116_1313 [Candidatus Puniceispirillum marinum IMCC1322] gi|292664455|gb|ADE39556.1| Protein of unknown function DUF329 [Candidatus Puniceispirillum marinum IMCC1322] Length = 87 Score = 48.5 bits (114), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 22/52 (42%), Positives = 29/52 (55%), Gaps = 1/52 (1%) Query: 1 MQTSDFRSLKSI-CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVE 51 M S +LK + CP C + PFCS++C IDL RW G+Y I AV+ Sbjct: 1 MSASSKSNLKPVKCPTCGDMASNAARPFCSSRCADIDLGRWFQGKYAIPAVD 52 >gi|163794245|ref|ZP_02188217.1| hypothetical protein BAL199_21299 [alpha proteobacterium BAL199] gi|159180413|gb|EDP64934.1| hypothetical protein BAL199_21299 [alpha proteobacterium BAL199] Length = 72 Score = 48.5 bits (114), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 21/64 (32%), Positives = 38/64 (59%), Gaps = 11/64 (17%) Query: 7 RSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIA-----------AVEDEKS 55 ++ +S CP C+K S+ ++ PFCS +C+++DL +WL G Y + A+ E++ Sbjct: 9 KARRSSCPICKKPSVADYRPFCSPRCKTLDLGQWLSGGYRLPTEEVPEEAELEAILQERT 68 Query: 56 EEEV 59 E+E Sbjct: 69 EDET 72 >gi|304393253|ref|ZP_07375181.1| conserved domain protein [Ahrensia sp. R2A130] gi|303294260|gb|EFL88632.1| conserved domain protein [Ahrensia sp. R2A130] Length = 62 Score = 48.1 bits (113), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 18/37 (48%), Positives = 24/37 (64%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAA 49 CP+C+K S + YPFCS +C +DL WL G Y I+ Sbjct: 15 CPQCKKQSTRDTYPFCSRRCAQLDLGAWLSGGYAISG 51 >gi|46201809|ref|ZP_00208256.1| COG3024: Uncharacterized protein conserved in bacteria [Magnetospirillum magnetotacticum MS-1] Length = 56 Score = 48.1 bits (113), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 20/40 (50%), Positives = 25/40 (62%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVED 52 CP C K + + PFCST+C +DL RWL+ Y AVED Sbjct: 9 CPICGKAAEARYKPFCSTRCADVDLHRWLNESYRAPAVED 48 >gi|300024214|ref|YP_003756825.1| hypothetical protein Hden_2708 [Hyphomicrobium denitrificans ATCC 51888] gi|299526035|gb|ADJ24504.1| protein of unknown function DUF329 [Hyphomicrobium denitrificans ATCC 51888] Length = 73 Score = 48.1 bits (113), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 20/54 (37%), Positives = 32/54 (59%) Query: 3 TSDFRSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 +S+ S CP CRK + + PFCS +C IDL++WL G Y + E+++ + Sbjct: 4 SSEPASKPVRCPICRKPAAEAYRPFCSKRCADIDLAKWLGGAYAVPGREEDEGD 57 >gi|126735246|ref|ZP_01750992.1| hypothetical protein RCCS2_15254 [Roseobacter sp. CCS2] gi|126715801|gb|EBA12666.1| hypothetical protein RCCS2_15254 [Roseobacter sp. CCS2] Length = 61 Score = 48.1 bits (113), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 19/45 (42%), Positives = 27/45 (60%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP C K + F PFCS +C +DL++W G Y I A + E +E+ Sbjct: 3 CPICDKPTETAFRPFCSKRCADVDLAKWFTGGYAIPADDPEDAED 47 >gi|75674474|ref|YP_316895.1| zinc-binding protein [Nitrobacter winogradskyi Nb-255] gi|74419344|gb|ABA03543.1| Protein of unknown function DUF329 [Nitrobacter winogradskyi Nb-255] Length = 65 Score = 48.1 bits (113), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 20/46 (43%), Positives = 27/46 (58%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K + + PFCS +CR +DL+RWL G Y I A + + E Sbjct: 20 CPICGKPAAEDSRPFCSERCRDVDLNRWLSGSYAIPASRADDDDAE 65 >gi|85713842|ref|ZP_01044832.1| zinc-binding protein [Nitrobacter sp. Nb-311A] gi|85699746|gb|EAQ37613.1| zinc-binding protein [Nitrobacter sp. Nb-311A] Length = 60 Score = 47.8 bits (112), Expect = 5e-04, Method: Compositional matrix adjust. Identities = 23/46 (50%), Positives = 29/46 (63%), Gaps = 2/46 (4%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAA--VEDEKSE 56 CP C K S+ PFCS +CR +DL+RWL G YVI +DE +E Sbjct: 15 CPICGKPSVEASRPFCSERCRDVDLNRWLSGSYVIPVSRSDDEDAE 60 >gi|163852047|ref|YP_001640090.1| hypothetical protein Mext_2627 [Methylobacterium extorquens PA1] gi|254801344|sp|A9W613|Y2627_METEP RecName: Full=UPF0243 zinc-binding protein Mext_2627 gi|163663652|gb|ABY31019.1| protein of unknown function DUF329 [Methylobacterium extorquens PA1] Length = 72 Score = 47.8 bits (112), Expect = 6e-04, Method: Compositional matrix adjust. Identities = 21/43 (48%), Positives = 25/43 (58%) Query: 11 SICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDE 53 + CP C K + E PFCS +C IDL RWL YVI E+E Sbjct: 15 APCPICGKPARTETKPFCSPRCADIDLGRWLGERYVIPGPEEE 57 >gi|83949643|ref|ZP_00958376.1| hypothetical protein ISM_01075 [Roseovarius nubinhibens ISM] gi|83837542|gb|EAP76838.1| hypothetical protein ISM_01075 [Roseovarius nubinhibens ISM] Length = 64 Score = 47.4 bits (111), Expect = 6e-04, Method: Compositional matrix adjust. Identities = 21/51 (41%), Positives = 29/51 (56%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDIL 63 CP C K + F PFCS +C +DL++WL G Y I + + E EE + L Sbjct: 3 CPICDKETDKRFRPFCSKRCADVDLAKWLSGSYAIPSDDPEDMEEALDAAL 53 >gi|240139371|ref|YP_002963846.1| hypothetical protein MexAM1_META1p2816 [Methylobacterium extorquens AM1] gi|240009343|gb|ACS40569.1| conserved hypothetical protein, UPF0243 zinc-binding protein [Methylobacterium extorquens AM1] Length = 72 Score = 47.4 bits (111), Expect = 6e-04, Method: Compositional matrix adjust. Identities = 21/43 (48%), Positives = 25/43 (58%) Query: 11 SICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDE 53 + CP C K + E PFCS +C IDL RWL YVI E+E Sbjct: 15 APCPICGKPARTETKPFCSPRCADIDLGRWLGERYVIPGPEEE 57 >gi|163868983|ref|YP_001610213.1| hypothetical protein Btr_2032 [Bartonella tribocorum CIP 105476] gi|161018660|emb|CAK02218.1| hypothetical protein BT_2032 [Bartonella tribocorum CIP 105476] Length = 51 Score = 47.4 bits (111), Expect = 7e-04, Method: Compositional matrix adjust. Identities = 18/34 (52%), Positives = 24/34 (70%) Query: 25 YPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 YPFCS++CR+IDL+RWL G Y++ EEE Sbjct: 18 YPFCSSRCRAIDLNRWLSGSYILPPPPQVSDEEE 51 >gi|89055358|ref|YP_510809.1| hypothetical protein Jann_2867 [Jannaschia sp. CCS1] gi|88864907|gb|ABD55784.1| protein of unknown function DUF329 [Jannaschia sp. CCS1] Length = 60 Score = 47.4 bits (111), Expect = 7e-04, Method: Compositional matrix adjust. Identities = 17/49 (34%), Positives = 31/49 (63%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP C K + + PFCS +C ++DL RWL+G Y + + + + E+ +++ Sbjct: 3 CPICEKETDAAYRPFCSKRCANVDLGRWLNGAYAVPSTDPDDIEQALEE 51 >gi|86751447|ref|YP_487943.1| zinc-binding protein [Rhodopseudomonas palustris HaA2] gi|86574475|gb|ABD09032.1| Protein of unknown function DUF329 [Rhodopseudomonas palustris HaA2] Length = 64 Score = 47.4 bits (111), Expect = 7e-04, Method: Compositional matrix adjust. Identities = 20/46 (43%), Positives = 26/46 (56%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K + PFCS +CR +DL+RWL G Y I A + E+ Sbjct: 19 CPICGKPATEASRPFCSERCRDVDLNRWLSGSYKIPAAPADDDEDN 64 >gi|254462810|ref|ZP_05076226.1| conserved domain protein [Rhodobacterales bacterium HTCC2083] gi|206679399|gb|EDZ43886.1| conserved domain protein [Rhodobacteraceae bacterium HTCC2083] Length = 68 Score = 47.0 bits (110), Expect = 9e-04, Method: Compositional matrix adjust. Identities = 17/44 (38%), Positives = 27/44 (61%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 CP C K + PFCS +C +DL++WL G Y +A+ + + +E Sbjct: 3 CPICEKAVDAAYKPFCSKRCADVDLAKWLSGSYALASNDPDDAE 46 >gi|329889114|ref|ZP_08267457.1| hypothetical protein BDIM_07890 [Brevundimonas diminuta ATCC 11568] gi|328844415|gb|EGF93979.1| hypothetical protein BDIM_07890 [Brevundimonas diminuta ATCC 11568] Length = 54 Score = 46.6 bits (109), Expect = 0.001, Method: Compositional matrix adjust. Identities = 24/51 (47%), Positives = 29/51 (56%), Gaps = 2/51 (3%) Query: 13 CPECRKGSMVEFY-PFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 CP CR+ V Y PFCS +C IDL RW G Y I A ED +E+ + I Sbjct: 4 CPICRRAEAVAAYKPFCSKRCADIDLQRWFTGGYAIPA-EDAHDDEKDRGI 53 >gi|295690489|ref|YP_003594182.1| hypothetical protein Cseg_3124 [Caulobacter segnis ATCC 21756] gi|295432392|gb|ADG11564.1| protein of unknown function DUF329 [Caulobacter segnis ATCC 21756] Length = 57 Score = 46.6 bits (109), Expect = 0.001, Method: Compositional matrix adjust. Identities = 19/45 (42%), Positives = 26/45 (57%) Query: 9 LKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDE 53 + + CP C K F PFCS +C +DL RWL G YV+ +D+ Sbjct: 1 MSTGCPICGKPVEKAFRPFCSKRCADVDLQRWLVGRYVVPGGDDD 45 >gi|118593155|ref|ZP_01550541.1| zinc-binding protein [Stappia aggregata IAM 12614] gi|118434240|gb|EAV40895.1| zinc-binding protein [Stappia aggregata IAM 12614] Length = 67 Score = 46.6 bits (109), Expect = 0.001, Method: Compositional matrix adjust. Identities = 21/45 (46%), Positives = 26/45 (57%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP C K S + YPFCS +C IDL+RW Y I VE + +E Sbjct: 14 CPICSKLSTPDNYPFCSDRCAKIDLNRWFSEGYTIPVVETDDIDE 58 >gi|298290142|ref|YP_003692081.1| hypothetical protein Snov_0125 [Starkeya novella DSM 506] gi|296926653|gb|ADH87462.1| protein of unknown function DUF329 [Starkeya novella DSM 506] Length = 73 Score = 46.6 bits (109), Expect = 0.001, Method: Compositional matrix adjust. Identities = 18/36 (50%), Positives = 24/36 (66%) Query: 12 ICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVI 47 CP C K S+ ++ PFCS++C +DL RWL G Y I Sbjct: 15 TCPICGKPSVEKYKPFCSSRCADVDLHRWLTGAYAI 50 >gi|114799923|ref|YP_760436.1| hypothetical protein HNE_1731 [Hyphomonas neptunium ATCC 15444] gi|123028040|sp|Q0C1F7|Y1731_HYPNA RecName: Full=UPF0243 zinc-binding protein HNE_1731 gi|114740097|gb|ABI78222.1| conserved hypothetical protein [Hyphomonas neptunium ATCC 15444] Length = 73 Score = 46.2 bits (108), Expect = 0.001, Method: Compositional matrix adjust. Identities = 19/47 (40%), Positives = 29/47 (61%), Gaps = 1/47 (2%) Query: 12 ICPECRKGSMV-EFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 +C CRK ++ E+ PFCS +C DL +WL G YVI E++++ Sbjct: 13 LCARCRKQAVAAEYRPFCSKRCADADLGQWLKGGYVIPGAAAEQADD 59 >gi|218530802|ref|YP_002421618.1| hypothetical protein Mchl_2851 [Methylobacterium chloromethanicum CM4] gi|254801563|sp|B7KPV4|Y2851_METC4 RecName: Full=UPF0243 zinc-binding protein Mchl_2851 gi|218523105|gb|ACK83690.1| protein of unknown function DUF329 [Methylobacterium chloromethanicum CM4] Length = 72 Score = 46.2 bits (108), Expect = 0.001, Method: Compositional matrix adjust. Identities = 20/43 (46%), Positives = 25/43 (58%) Query: 11 SICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDE 53 + CP C K + E PFCS +C IDL RWL YVI E++ Sbjct: 15 APCPICGKPARTETKPFCSPRCADIDLGRWLGERYVIPGPEED 57 >gi|85704671|ref|ZP_01035773.1| hypothetical protein ROS217_06314 [Roseovarius sp. 217] gi|85671079|gb|EAQ25938.1| hypothetical protein ROS217_06314 [Roseovarius sp. 217] Length = 60 Score = 46.2 bits (108), Expect = 0.001, Method: Compositional matrix adjust. Identities = 18/47 (38%), Positives = 27/47 (57%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEV 59 CP C+K + + PFCS +C IDL +W G+Y + + E EE + Sbjct: 3 CPICQKKTDPAYRPFCSRRCADIDLGKWFAGDYAVPSTEPADLEEAI 49 >gi|84683717|ref|ZP_01011620.1| hypothetical protein 1099457000264_RB2654_20128 [Maritimibacter alkaliphilus HTCC2654] gi|84668460|gb|EAQ14927.1| hypothetical protein RB2654_20128 [Rhodobacterales bacterium HTCC2654] Length = 64 Score = 46.2 bits (108), Expect = 0.001, Method: Compositional matrix adjust. Identities = 20/50 (40%), Positives = 30/50 (60%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 CP C K + + PFCS +C +DL +WL+G Y I + + E +E V +I Sbjct: 3 CPICAKDTDPAYRPFCSKRCADVDLGKWLNGSYRIPSEDPEDLDELVDEI 52 >gi|170749358|ref|YP_001755618.1| hypothetical protein Mrad2831_2951 [Methylobacterium radiotolerans JCM 2831] gi|170655880|gb|ACB24935.1| protein of unknown function DUF329 [Methylobacterium radiotolerans JCM 2831] Length = 61 Score = 46.2 bits (108), Expect = 0.001, Method: Compositional matrix adjust. Identities = 18/36 (50%), Positives = 24/36 (66%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIA 48 CP CR+ S+ +F PFCS +C +DL RWL+ Y I Sbjct: 10 CPICRQPSVPDFRPFCSQRCADVDLGRWLNERYAIP 45 >gi|144897400|emb|CAM74264.1| Protein of unknown function DUF329 [Magnetospirillum gryphiswaldense MSR-1] Length = 61 Score = 46.2 bits (108), Expect = 0.001, Method: Compositional matrix adjust. Identities = 20/49 (40%), Positives = 26/49 (53%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP C K +F PFC ++C +DL+RWL G Y + E E E D Sbjct: 10 CPVCGKPPQPKFLPFCCSRCADVDLNRWLGGVYRVETNETEHQHEPDGD 58 >gi|99078527|ref|YP_611785.1| hypothetical protein TM1040_3554 [Ruegeria sp. TM1040] gi|99035665|gb|ABF62523.1| protein of unknown function DUF329 [Ruegeria sp. TM1040] Length = 60 Score = 46.2 bits (108), Expect = 0.001, Method: Compositional matrix adjust. Identities = 18/49 (36%), Positives = 29/49 (59%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP C K + PFCS +C +DL++WL+G Y + + + E E ++D Sbjct: 3 CPICGKPTQQSVRPFCSKRCADLDLAKWLNGAYAVPSEDQEDLENALED 51 >gi|254561771|ref|YP_003068866.1| hypothetical protein METDI3362 [Methylobacterium extorquens DM4] gi|254269049|emb|CAX25010.1| conserved hypothetical protein, UPF0243 zinc-binding protein [Methylobacterium extorquens DM4] Length = 72 Score = 46.2 bits (108), Expect = 0.002, Method: Compositional matrix adjust. Identities = 20/43 (46%), Positives = 25/43 (58%) Query: 11 SICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDE 53 + CP C K + E PFCS +C IDL RWL YVI E++ Sbjct: 15 APCPICGKPARTETKPFCSPRCADIDLGRWLGERYVIPGPEED 57 >gi|115526469|ref|YP_783380.1| zinc-binding protein [Rhodopseudomonas palustris BisA53] gi|115520416|gb|ABJ08400.1| protein of unknown function DUF329 [Rhodopseudomonas palustris BisA53] Length = 61 Score = 46.2 bits (108), Expect = 0.002, Method: Compositional matrix adjust. Identities = 18/46 (39%), Positives = 26/46 (56%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K ++ PFCS +CR +DL+RWL G Y I + + + Sbjct: 16 CPICGKPAVEASRPFCSERCRDVDLNRWLSGSYAIPGAPEPDDDAD 61 >gi|163741998|ref|ZP_02149387.1| hypothetical protein RG210_05492 [Phaeobacter gallaeciensis 2.10] gi|161384719|gb|EDQ09099.1| hypothetical protein RG210_05492 [Phaeobacter gallaeciensis 2.10] Length = 60 Score = 46.2 bits (108), Expect = 0.002, Method: Compositional matrix adjust. Identities = 17/50 (34%), Positives = 31/50 (62%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 CP C + + ++ PFCS +C IDL++WL+G Y + + E E ++++ Sbjct: 3 CPICAEETQKDYRPFCSRRCADIDLAKWLNGAYATPSTDPEDIENALEEV 52 >gi|114569684|ref|YP_756364.1| hypothetical protein Mmar10_1133 [Maricaulis maris MCS10] gi|114340146|gb|ABI65426.1| protein of unknown function DUF329 [Maricaulis maris MCS10] Length = 55 Score = 45.8 bits (107), Expect = 0.002, Method: Compositional matrix adjust. Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 5/51 (9%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAA-----VEDEKSEEE 58 CP CR+ + +F PFCS +C +DL +W+ G Y I ED EE Sbjct: 3 CPICRQPADPDFKPFCSKRCADVDLGKWVSGSYAIPGEPADVAEDNPPTEE 53 >gi|77464193|ref|YP_353697.1| hypothetical protein RSP_0623 [Rhodobacter sphaeroides 2.4.1] gi|126463035|ref|YP_001044149.1| hypothetical protein Rsph17029_2275 [Rhodobacter sphaeroides ATCC 17029] gi|221640076|ref|YP_002526338.1| hypothetical protein RSKD131_1977 [Rhodobacter sphaeroides KD131] gi|332559069|ref|ZP_08413391.1| hypothetical protein RSWS8N_08440 [Rhodobacter sphaeroides WS8N] gi|77388611|gb|ABA79796.1| conserved hypothetical protein [Rhodobacter sphaeroides 2.4.1] gi|126104699|gb|ABN77377.1| protein of unknown function DUF329 [Rhodobacter sphaeroides ATCC 17029] gi|221160857|gb|ACM01837.1| Hypothetical Protein RSKD131_1977 [Rhodobacter sphaeroides KD131] gi|332276781|gb|EGJ22096.1| hypothetical protein RSWS8N_08440 [Rhodobacter sphaeroides WS8N] Length = 60 Score = 45.8 bits (107), Expect = 0.002, Method: Compositional matrix adjust. Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 3/50 (6%) Query: 12 ICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP C + + + PFCS +C +DL WL G Y I A+ D EEE D Sbjct: 2 TCPICGRPAEARYRPFCSRRCADVDLGHWLKGNYRIPALGD---EEETPD 48 >gi|255262896|ref|ZP_05342238.1| conserved domain protein [Thalassiobium sp. R2A62] gi|255105231|gb|EET47905.1| conserved domain protein [Thalassiobium sp. R2A62] Length = 56 Score = 45.8 bits (107), Expect = 0.002, Method: Compositional matrix adjust. Identities = 15/37 (40%), Positives = 25/37 (67%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAA 49 CP C K ++ + PFCS +C +DL++W +G Y +A+ Sbjct: 3 CPMCEKETVATYRPFCSKRCADLDLAKWFNGTYAVAS 39 >gi|149913557|ref|ZP_01902090.1| hypothetical protein RAZWK3B_09651 [Roseobacter sp. AzwK-3b] gi|149812677|gb|EDM72506.1| hypothetical protein RAZWK3B_09651 [Roseobacter sp. AzwK-3b] Length = 60 Score = 45.4 bits (106), Expect = 0.002, Method: Compositional matrix adjust. Identities = 17/45 (37%), Positives = 26/45 (57%) Query: 12 ICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 CP C+K + F PFCS +C +DL +W G+Y + + + E E Sbjct: 2 TCPICQKPTDTRFRPFCSKRCADVDLGKWFGGDYAVPSQDPEDIE 46 >gi|114767232|ref|ZP_01446097.1| hypothetical protein 1100011001181_R2601_09315 [Pelagibaca bermudensis HTCC2601] gi|114540642|gb|EAU43713.1| hypothetical protein R2601_09315 [Roseovarius sp. HTCC2601] Length = 62 Score = 45.4 bits (106), Expect = 0.003, Method: Compositional matrix adjust. Identities = 17/41 (41%), Positives = 26/41 (63%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDE 53 CP C K + ++ PFCS +C IDL++W+ G Y I + + E Sbjct: 3 CPICGKPTEAKYRPFCSGRCADIDLAKWVSGSYAIPSTDPE 43 >gi|158424768|ref|YP_001526060.1| hypothetical protein AZC_3144 [Azorhizobium caulinodans ORS 571] gi|172047994|sp|A8IC06|Y3144_AZOC5 RecName: Full=UPF0243 zinc-binding protein AZC_3144 gi|158331657|dbj|BAF89142.1| hypothetical protein [Azorhizobium caulinodans ORS 571] Length = 68 Score = 45.4 bits (106), Expect = 0.003, Method: Compositional matrix adjust. Identities = 18/36 (50%), Positives = 23/36 (63%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIA 48 CP C K S+ + PFCS +C +DL+RWL G Y I Sbjct: 14 CPICGKPSIERYKPFCSKRCADVDLNRWLTGAYAIP 49 >gi|254505068|ref|ZP_05117219.1| conserved domain protein [Labrenzia alexandrii DFL-11] gi|222441139|gb|EEE47818.1| conserved domain protein [Labrenzia alexandrii DFL-11] Length = 67 Score = 45.4 bits (106), Expect = 0.003, Method: Compositional matrix adjust. Identities = 21/39 (53%), Positives = 23/39 (58%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVE 51 CP C K S E YPFCS +C IDL+RW Y I VE Sbjct: 16 CPICSKLSTPENYPFCSDRCAKIDLNRWFSEGYSIPVVE 54 >gi|56709231|ref|YP_164911.1| hypothetical protein SPOA0450 [Ruegeria pomeroyi DSS-3] gi|67462018|sp|Q5LLE7|Y4450_SILPO RecName: Full=UPF0243 zinc-binding protein SPOA0450 gi|56680916|gb|AAV97581.1| conserved hypothetical protein [Ruegeria pomeroyi DSS-3] Length = 60 Score = 45.1 bits (105), Expect = 0.003, Method: Compositional matrix adjust. Identities = 17/45 (37%), Positives = 27/45 (60%) Query: 12 ICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 CP C + + PFCS +C +DL++WL+G Y I A +++ E Sbjct: 2 TCPICGSKTAPSYRPFCSKRCADLDLAKWLNGSYAIPASSEDEEE 46 >gi|296532747|ref|ZP_06895429.1| zinc-binding protein [Roseomonas cervicalis ATCC 49957] gi|296266940|gb|EFH12883.1| zinc-binding protein [Roseomonas cervicalis ATCC 49957] Length = 69 Score = 45.1 bits (105), Expect = 0.003, Method: Compositional matrix adjust. Identities = 18/35 (51%), Positives = 21/35 (60%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVI 47 CP C K + PFCS +CR +DL RWL G Y I Sbjct: 16 CPVCGKPAEAAHRPFCSDRCRQVDLGRWLSGAYAI 50 >gi|296117422|ref|ZP_06836010.1| hypothetical protein GXY_16429 [Gluconacetobacter hansenii ATCC 23769] gi|295976024|gb|EFG82814.1| hypothetical protein GXY_16429 [Gluconacetobacter hansenii ATCC 23769] Length = 68 Score = 45.1 bits (105), Expect = 0.003, Method: Compositional matrix adjust. Identities = 19/51 (37%), Positives = 26/51 (50%) Query: 8 SLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 + CP C K + + PFCS +C IDL RW G+Y + A D +E Sbjct: 5 ATPPPCPVCGKPMVQAYRPFCSRRCADIDLGRWFTGQYRVPADNDFNDMDE 55 >gi|220923267|ref|YP_002498569.1| hypothetical protein Mnod_3343 [Methylobacterium nodulans ORS 2060] gi|219947874|gb|ACL58266.1| protein of unknown function DUF329 [Methylobacterium nodulans ORS 2060] Length = 65 Score = 44.7 bits (104), Expect = 0.004, Method: Compositional matrix adjust. Identities = 18/38 (47%), Positives = 23/38 (60%) Query: 16 CRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDE 53 C K + +F PFCS +C +DL RWL G Y I ED+ Sbjct: 18 CGKPADPKFRPFCSKRCADVDLQRWLSGRYAIPGREDD 55 >gi|163737328|ref|ZP_02144746.1| hypothetical protein RGBS107_04258 [Phaeobacter gallaeciensis BS107] gi|161389932|gb|EDQ14283.1| hypothetical protein RGBS107_04258 [Phaeobacter gallaeciensis BS107] Length = 60 Score = 44.7 bits (104), Expect = 0.004, Method: Compositional matrix adjust. Identities = 17/49 (34%), Positives = 30/49 (61%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP C + + ++ PFCS +C IDL++WL+G Y + + E E +++ Sbjct: 3 CPICAEETQKDYRPFCSRRCADIDLAKWLNGAYATPSTDPEDIENALEE 51 >gi|209964943|ref|YP_002297858.1| hypothetical protein RC1_1644 [Rhodospirillum centenum SW] gi|209958409|gb|ACI99045.1| conserved domain protein [Rhodospirillum centenum SW] Length = 73 Score = 44.7 bits (104), Expect = 0.004, Method: Compositional matrix adjust. Identities = 17/42 (40%), Positives = 25/42 (59%) Query: 10 KSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVE 51 ++ CP C + + PFCS +C +DLSRWL G Y + V+ Sbjct: 16 RAACPVCGRPADPALKPFCSRRCADVDLSRWLGGVYRVPVVD 57 >gi|86137058|ref|ZP_01055636.1| hypothetical protein MED193_15327 [Roseobacter sp. MED193] gi|85826382|gb|EAQ46579.1| hypothetical protein MED193_15327 [Roseobacter sp. MED193] Length = 67 Score = 44.7 bits (104), Expect = 0.004, Method: Compositional matrix adjust. Identities = 18/51 (35%), Positives = 29/51 (56%) Query: 12 ICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 ICP C + PFCS +C +DL++WL+G Y + + E E +K++ Sbjct: 2 ICPICGTETEKSHRPFCSKRCADLDLAKWLNGSYALPSDNPEDVENALKEL 52 >gi|110678991|ref|YP_681998.1| hypothetical protein RD1_1688 [Roseobacter denitrificans OCh 114] gi|109455107|gb|ABG31312.1| conserved hypothetical protein [Roseobacter denitrificans OCh 114] Length = 65 Score = 44.7 bits (104), Expect = 0.005, Method: Compositional matrix adjust. Identities = 16/37 (43%), Positives = 24/37 (64%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAA 49 CP C K ++ PFCS +C +DL+RW +G Y +A+ Sbjct: 3 CPICGKPTVQAVSPFCSKRCADLDLARWFNGSYAVAS 39 >gi|163747240|ref|ZP_02154595.1| hypothetical protein OIHEL45_00767 [Oceanibulbus indolifex HEL-45] gi|161379515|gb|EDQ03929.1| hypothetical protein OIHEL45_00767 [Oceanibulbus indolifex HEL-45] Length = 63 Score = 44.3 bits (103), Expect = 0.006, Method: Compositional matrix adjust. Identities = 17/50 (34%), Positives = 27/50 (54%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 CP C+ ++ PFCS +C IDL RW +G Y + + + E E + + Sbjct: 3 CPICKAETVKAHRPFCSRRCADIDLGRWFNGSYAVPSRDPEDVEAAIDAV 52 >gi|114777495|ref|ZP_01452492.1| hypothetical protein SPV1_14384 [Mariprofundus ferrooxydans PV-1] gi|114552277|gb|EAU54779.1| hypothetical protein SPV1_14384 [Mariprofundus ferrooxydans PV-1] Length = 64 Score = 43.9 bits (102), Expect = 0.007, Method: Compositional matrix adjust. Identities = 21/48 (43%), Positives = 30/48 (62%), Gaps = 2/48 (4%) Query: 4 SDFRSLKSICPECRKGSM--VEFYPFCSTQCRSIDLSRWLHGEYVIAA 49 S+ ++++ CP CRK + E +PFCS++CR IDL RW EY I Sbjct: 2 SEAKTIRFRCPVCRKETTRDSEDFPFCSSRCRIIDLGRWASDEYSIPG 49 >gi|288962445|ref|YP_003452740.1| hypothetical protein AZL_d03700 [Azospirillum sp. B510] gi|288914711|dbj|BAI76196.1| hypothetical protein AZL_d03700 [Azospirillum sp. B510] Length = 80 Score = 43.9 bits (102), Expect = 0.007, Method: Compositional matrix adjust. Identities = 19/46 (41%), Positives = 28/46 (60%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C + + PFCS +C IDLSRWL G Y I + E++++ + Sbjct: 25 CPICGRPTEPATRPFCSKRCADIDLSRWLGGVYRIESPENQENPAD 70 >gi|114769476|ref|ZP_01447102.1| hypothetical protein OM2255_07080 [alpha proteobacterium HTCC2255] gi|114550393|gb|EAU53274.1| hypothetical protein OM2255_07080 [alpha proteobacterium HTCC2255] Length = 60 Score = 43.9 bits (102), Expect = 0.007, Method: Compositional matrix adjust. Identities = 18/44 (40%), Positives = 26/44 (59%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 CP C K ++ PFCS +C +DL +WL Y I AVE ++ + Sbjct: 3 CPMCNKSQDKKYRPFCSKRCADLDLGKWLTESYSIPAVETDEED 46 >gi|119384530|ref|YP_915586.1| hypothetical protein Pden_1793 [Paracoccus denitrificans PD1222] gi|119374297|gb|ABL69890.1| protein of unknown function DUF329 [Paracoccus denitrificans PD1222] Length = 49 Score = 43.9 bits (102), Expect = 0.007, Method: Compositional matrix adjust. Identities = 17/37 (45%), Positives = 23/37 (62%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAA 49 CP C K + + PFCS +C +DL+RWL G+Y I Sbjct: 3 CPICGKPASERYRPFCSRRCADVDLARWLRGDYRIPG 39 >gi|126738150|ref|ZP_01753871.1| hypothetical protein RSK20926_06437 [Roseobacter sp. SK209-2-6] gi|126720647|gb|EBA17352.1| hypothetical protein RSK20926_06437 [Roseobacter sp. SK209-2-6] Length = 67 Score = 43.9 bits (102), Expect = 0.007, Method: Compositional matrix adjust. Identities = 17/47 (36%), Positives = 28/47 (59%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEV 59 CP C S + PFCS +C +DL++WL+G Y + + + E E+ + Sbjct: 3 CPICDAESQKAYRPFCSKRCADLDLAKWLNGSYTLPSQDPEDLEKAL 49 >gi|115380602|ref|ZP_01467549.1| conserved domain protein [Stigmatella aurantiaca DW4/3-1] gi|310822027|ref|YP_003954385.1| hypothetical protein STAUR_4780 [Stigmatella aurantiaca DW4/3-1] gi|115362390|gb|EAU61678.1| conserved domain protein [Stigmatella aurantiaca DW4/3-1] gi|309395099|gb|ADO72558.1| conserved uncharacterized protein [Stigmatella aurantiaca DW4/3-1] Length = 67 Score = 43.9 bits (102), Expect = 0.007, Method: Compositional matrix adjust. Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 4/54 (7%) Query: 11 SICPECRKGSMVEF----YPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK 60 CP C+K + YPFCS +CR++DL RWL EY + + ++ E+E+ Sbjct: 4 PACPICQKPTPPRAENPSYPFCSRRCRAVDLGRWLGEEYRVPDRQTDEREDELP 57 >gi|254476716|ref|ZP_05090102.1| conserved domain protein [Ruegeria sp. R11] gi|214030959|gb|EEB71794.1| conserved domain protein [Ruegeria sp. R11] Length = 60 Score = 43.9 bits (102), Expect = 0.008, Method: Compositional matrix adjust. Identities = 17/44 (38%), Positives = 27/44 (61%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 CP C + + E+ PFCS +C +DL++WL+G Y + + E E Sbjct: 3 CPICGEETRREYRPFCSRRCADVDLAKWLNGAYATPSTDPEDIE 46 >gi|310816490|ref|YP_003964454.1| zinc-binding protein [Ketogulonicigenium vulgare Y25] gi|308755225|gb|ADO43154.1| zinc-binding protein [Ketogulonicigenium vulgare Y25] Length = 58 Score = 43.9 bits (102), Expect = 0.008, Method: Compositional matrix adjust. Identities = 16/33 (48%), Positives = 23/33 (69%) Query: 21 MVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDE 53 M E+ PFCS +C +DL RWL G Y IA+ +++ Sbjct: 1 MAEYKPFCSARCADVDLGRWLGGNYRIASEDND 33 >gi|83943983|ref|ZP_00956440.1| hypothetical protein EE36_10070 [Sulfitobacter sp. EE-36] gi|83845230|gb|EAP83110.1| hypothetical protein EE36_10070 [Sulfitobacter sp. EE-36] Length = 63 Score = 43.5 bits (101), Expect = 0.009, Method: Compositional matrix adjust. Identities = 16/42 (38%), Positives = 26/42 (61%) Query: 12 ICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDE 53 CP C + S ++ PFCS +C +DL++WL+G Y + + E Sbjct: 2 TCPICDRESSPKYRPFCSGRCADVDLAKWLNGSYATPSRDPE 43 >gi|320108293|ref|YP_004183883.1| hypothetical protein AciPR4_3131 [Terriglobus saanensis SP1PR4] gi|319926814|gb|ADV83889.1| protein of unknown function DUF329 [Terriglobus saanensis SP1PR4] Length = 74 Score = 43.5 bits (101), Expect = 0.011, Method: Compositional matrix adjust. Identities = 19/39 (48%), Positives = 24/39 (61%), Gaps = 2/39 (5%) Query: 13 CPECRKGSMVE--FYPFCSTQCRSIDLSRWLHGEYVIAA 49 CP CRK ++ PFCS +CR IDL +W GEY I + Sbjct: 9 CPICRKDVALDDPNVPFCSDRCRVIDLGKWASGEYKITS 47 >gi|260425253|ref|ZP_05779233.1| conserved domain protein [Citreicella sp. SE45] gi|260423193|gb|EEX16443.1| conserved domain protein [Citreicella sp. SE45] Length = 62 Score = 43.5 bits (101), Expect = 0.011, Method: Compositional matrix adjust. Identities = 15/39 (38%), Positives = 25/39 (64%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVE 51 CP C K + ++ PFCS +C +DL++W+ G Y I + + Sbjct: 3 CPICGKPTETKYRPFCSKRCADVDLAKWVSGSYAIPSTD 41 >gi|259415507|ref|ZP_05739428.1| conserved domain protein [Silicibacter sp. TrichCH4B] gi|259348737|gb|EEW60499.1| conserved domain protein [Silicibacter sp. TrichCH4B] Length = 60 Score = 43.5 bits (101), Expect = 0.011, Method: Compositional matrix adjust. Identities = 16/48 (33%), Positives = 30/48 (62%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK 60 CP C + ++ + PFCS +C +DL++WL+G Y + + + E E ++ Sbjct: 3 CPICGEPTLQSYRPFCSKRCADLDLAKWLNGGYSVPSEDQEDLENALE 50 >gi|87121469|ref|ZP_01077358.1| hypothetical protein MED121_21595 [Marinomonas sp. MED121] gi|86163312|gb|EAQ64588.1| hypothetical protein MED121_21595 [Marinomonas sp. MED121] Length = 73 Score = 43.5 bits (101), Expect = 0.011, Method: Compositional matrix adjust. Identities = 20/48 (41%), Positives = 26/48 (54%), Gaps = 4/48 (8%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 CP C+K S ++ PFCS +C+ IDL W G Y IA E+ E Sbjct: 13 CPNCKKEAVWSSENKYRPFCSERCKLIDLGEWASGTYAIAQAHSEEDE 60 >gi|163734092|ref|ZP_02141533.1| hypothetical protein RLO149_04099 [Roseobacter litoralis Och 149] gi|161392628|gb|EDQ16956.1| hypothetical protein RLO149_04099 [Roseobacter litoralis Och 149] Length = 65 Score = 43.1 bits (100), Expect = 0.012, Method: Compositional matrix adjust. Identities = 16/38 (42%), Positives = 23/38 (60%) Query: 12 ICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAA 49 CP C K + PFCS +C +DL+RW +G Y +A+ Sbjct: 2 TCPICGKPPIETARPFCSKRCADLDLARWFNGSYAVAS 39 >gi|149203436|ref|ZP_01880406.1| hypothetical protein RTM1035_02425 [Roseovarius sp. TM1035] gi|149143269|gb|EDM31308.1| hypothetical protein RTM1035_02425 [Roseovarius sp. TM1035] Length = 60 Score = 43.1 bits (100), Expect = 0.012, Method: Compositional matrix adjust. Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 1/51 (1%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDIL 63 CP C++ + + PFCS +C +DL +W G+Y + + D EE D L Sbjct: 3 CPICQRKTDARYRPFCSRRCADVDLGKWFAGDYAVPS-SDPADIEEALDAL 52 >gi|320103111|ref|YP_004178702.1| hypothetical protein Isop_1569 [Isosphaera pallida ATCC 43644] gi|319750393|gb|ADV62153.1| protein of unknown function DUF329 [Isosphaera pallida ATCC 43644] Length = 70 Score = 43.1 bits (100), Expect = 0.013, Method: Compositional matrix adjust. Identities = 24/57 (42%), Positives = 31/57 (54%), Gaps = 6/57 (10%) Query: 13 CPEC-RKGSMVEF-----YPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDIL 63 CP C R V F +PFCS +CR IDL RW+ G+Y I A EEE ++ + Sbjct: 5 CPICGRSFEFVSFEATPSFPFCSERCRLIDLGRWIDGDYRIPATACGPDEEEAEEPV 61 >gi|322434669|ref|YP_004216881.1| protein of unknown function DUF329 [Acidobacterium sp. MP5ACTX9] gi|321162396|gb|ADW68101.1| protein of unknown function DUF329 [Acidobacterium sp. MP5ACTX9] Length = 75 Score = 42.7 bits (99), Expect = 0.016, Method: Compositional matrix adjust. Identities = 21/54 (38%), Positives = 32/54 (59%), Gaps = 3/54 (5%) Query: 12 ICPECRKGSMV--EFYPFCSTQCRSIDLSRWLHGEYVIAA-VEDEKSEEEVKDI 62 CP CRK + +PFCS +CR +DL +W G YVI++ V D +E++ + Sbjct: 8 FCPTCRKVVLATDPDFPFCSDRCRILDLGKWASGGYVISSPVHDPDLLDELEGL 61 >gi|83312435|ref|YP_422699.1| hypothetical protein amb3336 [Magnetospirillum magneticum AMB-1] gi|82947276|dbj|BAE52140.1| Uncharacterized protein conserved in bacteria [Magnetospirillum magneticum AMB-1] Length = 56 Score = 42.7 bits (99), Expect = 0.016, Method: Compositional matrix adjust. Identities = 19/46 (41%), Positives = 26/46 (56%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 C C K + ++ PFCS +C +DL RWL+ Y AVED + E Sbjct: 9 CAICGKPAQPKYKPFCSARCADVDLHRWLNESYRAPAVEDPEGLPE 54 >gi|307945969|ref|ZP_07661304.1| conserved domain protein [Roseibium sp. TrichSKD4] gi|307769633|gb|EFO28859.1| conserved domain protein [Roseibium sp. TrichSKD4] Length = 65 Score = 42.7 bits (99), Expect = 0.017, Method: Compositional matrix adjust. Identities = 20/38 (52%), Positives = 22/38 (57%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAV 50 CP C K S E YPFCS +C +DL RW Y I AV Sbjct: 15 CPICSKLSSPEDYPFCSERCAKVDLHRWFSEGYSIPAV 52 >gi|108763065|ref|YP_632599.1| hypothetical protein MXAN_4428 [Myxococcus xanthus DK 1622] gi|108466945|gb|ABF92130.1| conserved hypothetical protein [Myxococcus xanthus DK 1622] Length = 97 Score = 42.7 bits (99), Expect = 0.017, Method: Compositional matrix adjust. Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 6/53 (11%) Query: 12 ICPECRK-----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEV 59 CP C+K G F PFCS +CR++DL RWL EY + + ++ E+E+ Sbjct: 33 TCPICQKPVPPRGENAAF-PFCSKRCRAVDLGRWLGEEYRVPDRQADEQEDEL 84 >gi|254465224|ref|ZP_05078635.1| conserved domain protein [Rhodobacterales bacterium Y4I] gi|206686132|gb|EDZ46614.1| conserved domain protein [Rhodobacterales bacterium Y4I] Length = 67 Score = 42.7 bits (99), Expect = 0.018, Method: Compositional matrix adjust. Identities = 19/49 (38%), Positives = 27/49 (55%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP C S F PFCS +C IDL +WL G Y + + + E E +++ Sbjct: 3 CPICGGESQKSFRPFCSKRCADIDLGKWLTGVYSVPSQDPEDIENALEE 51 >gi|90425885|ref|YP_534255.1| zinc-binding protein [Rhodopseudomonas palustris BisB18] gi|90107899|gb|ABD89936.1| protein of unknown function DUF329 [Rhodopseudomonas palustris BisB18] Length = 61 Score = 42.7 bits (99), Expect = 0.019, Method: Compositional matrix adjust. Identities = 17/35 (48%), Positives = 21/35 (60%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVI 47 CP C K + PFCS +CR +DL+RWL Y I Sbjct: 16 CPICGKPATAASRPFCSERCRDVDLNRWLSNSYSI 50 >gi|84516475|ref|ZP_01003834.1| hypothetical protein SKA53_07686 [Loktanella vestfoldensis SKA53] gi|84509511|gb|EAQ05969.1| hypothetical protein SKA53_07686 [Loktanella vestfoldensis SKA53] Length = 60 Score = 42.4 bits (98), Expect = 0.022, Method: Compositional matrix adjust. Identities = 16/37 (43%), Positives = 22/37 (59%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAA 49 CP C + + + PFCS +C +DL +WL G Y I A Sbjct: 3 CPICNRPTDKAYRPFCSRRCADVDLGKWLTGSYAIPA 39 >gi|299138361|ref|ZP_07031540.1| protein of unknown function DUF329 [Acidobacterium sp. MP5ACTX8] gi|298599607|gb|EFI55766.1| protein of unknown function DUF329 [Acidobacterium sp. MP5ACTX8] Length = 75 Score = 42.0 bits (97), Expect = 0.025, Method: Compositional matrix adjust. Identities = 18/39 (46%), Positives = 26/39 (66%), Gaps = 2/39 (5%) Query: 13 CPECRKGSMVEF--YPFCSTQCRSIDLSRWLHGEYVIAA 49 CP CRK ++ PFCS +CR+IDL +W G+Y I++ Sbjct: 9 CPICRKDVPLDTPEVPFCSERCRTIDLGKWASGDYKISS 47 >gi|148264347|ref|YP_001231053.1| hypothetical protein Gura_2301 [Geobacter uraniireducens Rf4] gi|146397847|gb|ABQ26480.1| protein of unknown function DUF329 [Geobacter uraniireducens Rf4] Length = 74 Score = 42.0 bits (97), Expect = 0.026, Method: Compositional matrix adjust. Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 3/52 (5%) Query: 10 KSICPECRKGSMVE---FYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 K +CP+CRK + E + PFCS +C+ IDL W+ +Y I + +EE Sbjct: 20 KRLCPQCRKDVVWEENPYRPFCSERCKLIDLGAWVTEDYRIPGEKKADDDEE 71 >gi|83945212|ref|ZP_00957561.1| hypothetical protein OA2633_00555 [Oceanicaulis alexandrii HTCC2633] gi|83851382|gb|EAP89238.1| hypothetical protein OA2633_00555 [Oceanicaulis alexandrii HTCC2633] Length = 65 Score = 42.0 bits (97), Expect = 0.030, Method: Compositional matrix adjust. Identities = 16/40 (40%), Positives = 20/40 (50%) Query: 10 KSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAA 49 K CP C+K + PFCS +C DL RW G Y + Sbjct: 5 KPGCPICKKPVDPRYRPFCSARCADADLGRWFSGAYAVPG 44 >gi|85373321|ref|YP_457383.1| hypothetical protein ELI_02470 [Erythrobacter litoralis HTCC2594] gi|84786404|gb|ABC62586.1| hypothetical protein ELI_02470 [Erythrobacter litoralis HTCC2594] Length = 53 Score = 42.0 bits (97), Expect = 0.031, Method: Compositional matrix adjust. Identities = 22/53 (41%), Positives = 29/53 (54%), Gaps = 4/53 (7%) Query: 9 LKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVI----AAVEDEKSEE 57 +K CP C+K + PFCST+C+ DL+RW Y + AA ED EE Sbjct: 1 MKKPCPICKKPRSEDHSPFCSTRCKDRDLARWFTDGYSVPGPPAAPEDILREE 53 >gi|85707921|ref|ZP_01038987.1| zinc-binding protein [Erythrobacter sp. NAP1] gi|85689455|gb|EAQ29458.1| zinc-binding protein [Erythrobacter sp. NAP1] Length = 61 Score = 42.0 bits (97), Expect = 0.032, Method: Compositional matrix adjust. Identities = 16/37 (43%), Positives = 22/37 (59%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAA 49 CP C+K EF PFCS +C+ DL++W Y +A Sbjct: 8 CPICKKPRAEEFTPFCSQRCKDRDLAQWFGDGYTVAG 44 >gi|325110505|ref|YP_004271573.1| hypothetical protein Plabr_3974 [Planctomyces brasiliensis DSM 5305] gi|324970773|gb|ADY61551.1| UPF0243 zinc-binding protein yacG [Planctomyces brasiliensis DSM 5305] Length = 82 Score = 41.6 bits (96), Expect = 0.033, Method: Compositional matrix adjust. Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 6/50 (12%) Query: 13 CPEC------RKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 CP C + + E +PFCS +CRS+DL RW G+Y I E+++ Sbjct: 7 CPVCNLPVGPQTTAPAELFPFCSPRCRSVDLFRWSEGKYAIVENISERAD 56 >gi|83954557|ref|ZP_00963268.1| hypothetical protein NAS141_15088 [Sulfitobacter sp. NAS-14.1] gi|83840841|gb|EAP80012.1| hypothetical protein NAS141_15088 [Sulfitobacter sp. NAS-14.1] Length = 63 Score = 41.6 bits (96), Expect = 0.034, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 26/42 (61%) Query: 12 ICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDE 53 CP C + + ++ PFCS +C +DL++WL+G Y + + + Sbjct: 2 TCPICDRETSPKYRPFCSGRCADVDLAKWLNGSYATPSRDPQ 43 >gi|326405165|ref|YP_004285247.1| hypothetical protein ACMV_30180 [Acidiphilium multivorum AIU301] gi|325052027|dbj|BAJ82365.1| hypothetical protein ACMV_30180 [Acidiphilium multivorum AIU301] Length = 64 Score = 41.6 bits (96), Expect = 0.036, Method: Compositional matrix adjust. Identities = 18/52 (34%), Positives = 27/52 (51%) Query: 7 RSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 R CP C + + PFCS +CR+IDL RW +Y + + E ++ E Sbjct: 13 RKPAGACPICGRKAQEAHRPFCSARCRAIDLGRWFGEDYRLPSDEAPLTDSE 64 >gi|126729158|ref|ZP_01744972.1| hypothetical protein SSE37_23199 [Sagittula stellata E-37] gi|126710148|gb|EBA09200.1| hypothetical protein SSE37_23199 [Sagittula stellata E-37] Length = 60 Score = 41.2 bits (95), Expect = 0.044, Method: Compositional matrix adjust. Identities = 16/37 (43%), Positives = 23/37 (62%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAA 49 CP C K + + PFCS +C +DL++WL G Y I + Sbjct: 3 CPICGKPTEPKVRPFCSKRCADVDLAKWLGGGYAIPS 39 >gi|332991951|gb|AEF02006.1| zinc-binding protein [Alteromonas sp. SN2] Length = 75 Score = 41.2 bits (95), Expect = 0.044, Method: Compositional matrix adjust. Identities = 23/54 (42%), Positives = 28/54 (51%), Gaps = 4/54 (7%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 CP C K S EF PFCS +C+ IDL W E+ IAA E+ + DI Sbjct: 5 CPTCAKSVTWNSESEFRPFCSKKCQLIDLGEWASEEHKIAAKPSEQPSAKEVDI 58 >gi|254486386|ref|ZP_05099591.1| conserved domain protein [Roseobacter sp. GAI101] gi|214043255|gb|EEB83893.1| conserved domain protein [Roseobacter sp. GAI101] Length = 63 Score = 41.2 bits (95), Expect = 0.045, Method: Compositional matrix adjust. Identities = 16/44 (36%), Positives = 25/44 (56%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 CP C ++ PFCS +C IDL++WL+G Y + + + E Sbjct: 3 CPICSGDVSAKYRPFCSRRCADIDLAKWLNGSYAAPSNDPDDIE 46 >gi|78222944|ref|YP_384691.1| hypothetical protein Gmet_1735 [Geobacter metallireducens GS-15] gi|78194199|gb|ABB31966.1| protein of unknown function DUF329 [Geobacter metallireducens GS-15] Length = 86 Score = 41.2 bits (95), Expect = 0.046, Method: Compositional matrix adjust. Identities = 21/49 (42%), Positives = 31/49 (63%), Gaps = 4/49 (8%) Query: 13 CPECRKGSMVE---FYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP CRK + + F PFCS +C+++DL+ W EY IA+ ED ++E Sbjct: 34 CPRCRKETPWQGNPFRPFCSERCKTMDLAAWADEEYRIAS-EDTPGDDE 81 >gi|89070659|ref|ZP_01157932.1| hypothetical protein OG2516_17433 [Oceanicola granulosus HTCC2516] gi|89043739|gb|EAR49942.1| hypothetical protein OG2516_17433 [Oceanicola granulosus HTCC2516] Length = 60 Score = 41.2 bits (95), Expect = 0.046, Method: Compositional matrix adjust. Identities = 16/44 (36%), Positives = 24/44 (54%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 CP C + + PFCS +C IDL +WL G Y + ++S+ Sbjct: 3 CPICSGPTDARYRPFCSRRCADIDLGKWLTGAYRVPGPPADESD 46 >gi|162449943|ref|YP_001612310.1| hypothetical protein sce1672 [Sorangium cellulosum 'So ce 56'] gi|161160525|emb|CAN91830.1| hypothetical protein sce1672 [Sorangium cellulosum 'So ce 56'] Length = 90 Score = 41.2 bits (95), Expect = 0.048, Method: Compositional matrix adjust. Identities = 19/41 (46%), Positives = 23/41 (56%), Gaps = 4/41 (9%) Query: 13 CPECRK--GSMVE--FYPFCSTQCRSIDLSRWLHGEYVIAA 49 CP CRK G E +PFCS QC+ +DL WL G Y + Sbjct: 20 CPICRKSAGPRPENPVFPFCSPQCKLVDLGHWLDGGYRVPG 60 >gi|83647946|ref|YP_436381.1| hypothetical protein HCH_05282 [Hahella chejuensis KCTC 2396] gi|83635989|gb|ABC31956.1| uncharacterized protein conserved in bacteria [Hahella chejuensis KCTC 2396] Length = 78 Score = 41.2 bits (95), Expect = 0.049, Method: Compositional matrix adjust. Identities = 23/58 (39%), Positives = 30/58 (51%), Gaps = 4/58 (6%) Query: 8 SLKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 +L+ CP C K EF PFCS +C+ IDL W EY IA E++ E +D Sbjct: 14 ALEVDCPTCGKKVPWTQENEFRPFCSKRCQMIDLGAWASEEYRIAEAEEKDKWSETED 71 >gi|296123618|ref|YP_003631396.1| hypothetical protein Plim_3384 [Planctomyces limnophilus DSM 3776] gi|296015958|gb|ADG69197.1| protein of unknown function DUF329 [Planctomyces limnophilus DSM 3776] Length = 75 Score = 41.2 bits (95), Expect = 0.051, Method: Compositional matrix adjust. Identities = 18/47 (38%), Positives = 28/47 (59%), Gaps = 4/47 (8%) Query: 11 SICPECR----KGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDE 53 + CP C+ + S+ ++PFCS +C+ +D SRW G+Y I DE Sbjct: 5 TTCPICQHVAPQASVNTYFPFCSERCKLVDFSRWWDGKYQIVDHLDE 51 >gi|301165945|emb|CBW25518.1| conserved hypothetical protein [Bacteriovorax marinus SJ] Length = 80 Score = 41.2 bits (95), Expect = 0.053, Method: Compositional matrix adjust. Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 3/46 (6%) Query: 7 RSLKSICPECRKGSMV---EFYPFCSTQCRSIDLSRWLHGEYVIAA 49 R L+ CP C+K EF PFCS +C+ ID+ WL+ Y + Sbjct: 4 RKLEVKCPHCKKKFNYYEGEFRPFCSERCKMIDMGHWLNEGYTVPV 49 >gi|168705437|ref|ZP_02737714.1| hypothetical protein GobsU_38247 [Gemmata obscuriglobus UQM 2246] Length = 50 Score = 40.8 bits (94), Expect = 0.056, Method: Compositional matrix adjust. Identities = 16/31 (51%), Positives = 22/31 (70%), Gaps = 2/31 (6%) Query: 19 GSMVEF--YPFCSTQCRSIDLSRWLHGEYVI 47 G+ E+ YPFC+ +CR IDL RWL G+Y + Sbjct: 3 GNWQEYPDYPFCTARCRKIDLGRWLDGKYRV 33 >gi|146276654|ref|YP_001166813.1| hypothetical protein Rsph17025_0602 [Rhodobacter sphaeroides ATCC 17025] gi|145554895|gb|ABP69508.1| protein of unknown function DUF329 [Rhodobacter sphaeroides ATCC 17025] Length = 60 Score = 40.8 bits (94), Expect = 0.057, Method: Compositional matrix adjust. Identities = 15/36 (41%), Positives = 21/36 (58%) Query: 12 ICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVI 47 CP C + + ++ PFCS +C +DL WL G Y I Sbjct: 2 TCPICGRAAEAKYRPFCSRRCADVDLGHWLKGNYRI 37 >gi|255066089|ref|ZP_05317944.1| conserved domain protein [Neisseria sicca ATCC 29256] gi|255049634|gb|EET45098.1| conserved domain protein [Neisseria sicca ATCC 29256] Length = 68 Score = 40.8 bits (94), Expect = 0.058, Method: Compositional matrix adjust. Identities = 18/45 (40%), Positives = 27/45 (60%), Gaps = 4/45 (8%) Query: 13 CPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDE 53 CP C+K + ++ PFCS +CR IDL W +Y +AA E++ Sbjct: 16 CPTCQKPVIWNEESKYRPFCSQRCRLIDLGEWAQEKYTVAAEEND 60 >gi|237807309|ref|YP_002891749.1| hypothetical protein Tola_0534 [Tolumonas auensis DSM 9187] gi|259647079|sp|C4LA34|Y534_TOLAT RecName: Full=UPF0243 zinc-binding protein Tola_0534 gi|237499570|gb|ACQ92163.1| protein of unknown function DUF329 [Tolumonas auensis DSM 9187] Length = 72 Score = 40.8 bits (94), Expect = 0.065, Method: Compositional matrix adjust. Identities = 26/62 (41%), Positives = 30/62 (48%), Gaps = 8/62 (12%) Query: 8 SLKSICPECRKGSMVE------FYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 SLK CP C G+ VE F PFCS +CR IDL W E IA E S + + Sbjct: 2 SLKVDCPTC--GTPVEWSPLSQFRPFCSDRCRLIDLGEWFSEERSIAGEEHTPSSDTARP 59 Query: 62 IL 63 L Sbjct: 60 QL 61 >gi|39996320|ref|NP_952271.1| hypothetical protein GSU1218 [Geobacter sulfurreducens PCA] gi|67462062|sp|Q74DU7|Y1218_GEOSL RecName: Full=UPF0243 zinc-binding protein GSU1218 gi|39983200|gb|AAR34594.1| conserved hypothetical protein [Geobacter sulfurreducens PCA] Length = 61 Score = 40.8 bits (94), Expect = 0.067, Method: Compositional matrix adjust. Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 3/50 (6%) Query: 12 ICPECRKGSMVE---FYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP CR ++ E PFCS +C+++DL+ W EY IA E +E Sbjct: 8 TCPRCRAETVWEGNPHRPFCSARCKTVDLAAWADEEYRIAGPEAPSDNDE 57 >gi|298505330|gb|ADI84053.1| protein of unknown function DUF329 [Geobacter sulfurreducens KN400] Length = 59 Score = 40.8 bits (94), Expect = 0.069, Method: Compositional matrix adjust. Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 3/50 (6%) Query: 12 ICPECRKGSMVE---FYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP CR ++ E PFCS +C+++DL+ W EY IA E +E Sbjct: 6 TCPRCRAETVWEGNPHRPFCSARCKTVDLAAWADEEYRIAGPEAPSDNDE 55 >gi|83594098|ref|YP_427850.1| hypothetical protein Rru_A2766 [Rhodospirillum rubrum ATCC 11170] gi|83577012|gb|ABC23563.1| Protein of unknown function DUF329 [Rhodospirillum rubrum ATCC 11170] Length = 78 Score = 40.4 bits (93), Expect = 0.073, Method: Compositional matrix adjust. Identities = 19/51 (37%), Positives = 23/51 (45%) Query: 7 RSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 R CP C + PFCS +C IDL RW+ G Y I E +E Sbjct: 27 RVTARACPICGHPVEARYRPFCSKRCADIDLGRWVLGTYRIETNEAPDPDE 77 >gi|332978535|gb|EGK15244.1| zinc-binding protein [Psychrobacter sp. 1501(2011)] Length = 69 Score = 40.4 bits (93), Expect = 0.079, Method: Compositional matrix adjust. Identities = 18/48 (37%), Positives = 30/48 (62%), Gaps = 3/48 (6%) Query: 13 CPECRKGSMVE---FYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP C+K ++ + + PFCS +C+ IDL W + EY +AA + S++ Sbjct: 19 CPNCQKPTVWQDNPYKPFCSDRCKLIDLGAWANEEYRVAAEDSPFSDD 66 >gi|312795074|ref|YP_004027996.1| non-essential pilus assembly protein [Burkholderia rhizoxinica HKI 454] gi|312166849|emb|CBW73852.1| non-essential pilus assembly protein [Burkholderia rhizoxinica HKI 454] Length = 66 Score = 40.4 bits (93), Expect = 0.084, Method: Compositional matrix adjust. Identities = 22/52 (42%), Positives = 27/52 (51%), Gaps = 10/52 (19%) Query: 13 CPECRKGSMVE------FYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C G VE F PFCS +C+ IDL W G+Y I DE+ +E Sbjct: 7 CPTC--GKKVEWKPESRFRPFCSMRCKQIDLGAWATGKYTIGG--DERPADE 54 >gi|56551907|ref|YP_162746.1| hypothetical protein ZMO1011 [Zymomonas mobilis subsp. mobilis ZM4] gi|67462020|sp|Q5NNS5|Y1011_ZYMMO RecName: Full=UPF0243 zinc-binding protein ZMO1011 gi|56543481|gb|AAV89635.1| hypothetical protein ZMO1011 [Zymomonas mobilis subsp. mobilis ZM4] Length = 61 Score = 40.4 bits (93), Expect = 0.084, Method: Compositional matrix adjust. Identities = 20/48 (41%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Query: 10 KSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 K CP C + EF PFCS CR DL WL Y + V+D ++E+ Sbjct: 11 KGKCPICGAPTKAEFRPFCSRGCRDRDLLNWLGDAYRL-PVKDLQAED 57 >gi|302877534|ref|YP_003846098.1| hypothetical protein Galf_0289 [Gallionella capsiferriformans ES-2] gi|302580323|gb|ADL54334.1| protein of unknown function DUF329 [Gallionella capsiferriformans ES-2] Length = 63 Score = 40.4 bits (93), Expect = 0.086, Method: Compositional matrix adjust. Identities = 19/46 (41%), Positives = 27/46 (58%), Gaps = 4/46 (8%) Query: 13 CPECRKGSMVE----FYPFCSTQCRSIDLSRWLHGEYVIAAVEDEK 54 CP C K S + F PFCS +C+ IDL +W E+ +A +DE+ Sbjct: 9 CPRCGKESPWDTNNRFRPFCSERCKMIDLGKWADEEFRVAVPDDEQ 54 >gi|326388841|ref|ZP_08210423.1| hypothetical protein Y88_3585 [Novosphingobium nitrogenifigens DSM 19370] gi|326206441|gb|EGD57276.1| hypothetical protein Y88_3585 [Novosphingobium nitrogenifigens DSM 19370] Length = 60 Score = 40.4 bits (93), Expect = 0.091, Method: Compositional matrix adjust. Identities = 18/49 (36%), Positives = 26/49 (53%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP C K + + PFCS++CR DL RWL Y I E++ ++ Sbjct: 11 CPICGKPRVEQHAPFCSSRCRDRDLMRWLDEGYAIPGPSTLGGEDDDRE 59 >gi|260752537|ref|YP_003225430.1| hypothetical protein Za10_0294 [Zymomonas mobilis subsp. mobilis NCIMB 11163] gi|258551900|gb|ACV74846.1| conserved hypothetical protein [Zymomonas mobilis subsp. mobilis NCIMB 11163] Length = 61 Score = 40.4 bits (93), Expect = 0.092, Method: Compositional matrix adjust. Identities = 20/48 (41%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Query: 10 KSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 K CP C + EF PFCS CR DL WL Y + V+D ++E+ Sbjct: 11 KGKCPICGAPTKAEFRPFCSRGCRDRDLLNWLGDAYRL-PVKDLQAED 57 >gi|94969170|ref|YP_591218.1| hypothetical protein Acid345_2143 [Candidatus Koribacter versatilis Ellin345] gi|94551220|gb|ABF41144.1| protein of unknown function DUF329 [Candidatus Koribacter versatilis Ellin345] Length = 80 Score = 40.0 bits (92), Expect = 0.095, Method: Compositional matrix adjust. Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 2/47 (4%) Query: 13 CPECRKGSMVEF--YPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP CRK + + +PFCS +C+ IDL +W YVI+ + E+ Sbjct: 11 CPTCRKIVLRKDPDFPFCSERCKMIDLGKWASNGYVISTPINNAGED 57 >gi|251771352|gb|EES51933.1| hypothetical protein UBAL3_95450153 [Leptospirillum ferrodiazotrophum] Length = 72 Score = 40.0 bits (92), Expect = 0.096, Method: Compositional matrix adjust. Identities = 17/29 (58%), Positives = 22/29 (75%) Query: 27 FCSTQCRSIDLSRWLHGEYVIAAVEDEKS 55 FCS +CR+IDL+RWL EY I EDE++ Sbjct: 21 FCSERCRTIDLARWLSEEYRIRGGEDEEA 49 >gi|312113072|ref|YP_004010668.1| hypothetical protein Rvan_0280 [Rhodomicrobium vannielii ATCC 17100] gi|311218201|gb|ADP69569.1| protein of unknown function DUF329 [Rhodomicrobium vannielii ATCC 17100] Length = 65 Score = 40.0 bits (92), Expect = 0.099, Method: Compositional matrix adjust. Identities = 16/40 (40%), Positives = 24/40 (60%) Query: 18 KGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 + + E+ PFCS +C +DL RWL G Y I +E+ +E Sbjct: 21 RPQVPEYRPFCSRRCADVDLHRWLGGVYAIPVKPEEEEDE 60 >gi|312883950|ref|ZP_07743667.1| zinc-binding protein [Vibrio caribbenthicus ATCC BAA-2122] gi|309368408|gb|EFP95943.1| zinc-binding protein [Vibrio caribbenthicus ATCC BAA-2122] Length = 64 Score = 40.0 bits (92), Expect = 0.11, Method: Compositional matrix adjust. Identities = 18/44 (40%), Positives = 22/44 (50%), Gaps = 4/44 (9%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVED 52 CP+C K G + PFCS QC+ ID W E+ IA D Sbjct: 9 CPQCNKDVIWGEQSPYRPFCSKQCQMIDFGDWADEEHSIAGAPD 52 >gi|238026145|ref|YP_002910376.1| hypothetical protein bglu_1g04750 [Burkholderia glumae BGR1] gi|237875339|gb|ACR27672.1| Hypothetical protein bglu_1g04750 [Burkholderia glumae BGR1] Length = 69 Score = 40.0 bits (92), Expect = 0.11, Method: Compositional matrix adjust. Identities = 18/52 (34%), Positives = 24/52 (46%), Gaps = 4/52 (7%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK 60 CP C K F PFCS +C+ +DL W Y I +DE S++ Sbjct: 7 CPACAKDVPWTPESPFRPFCSARCKQMDLGAWAAERYRIGGTDDEPSDDAAN 58 >gi|33152249|ref|NP_873602.1| hypothetical protein HD1129 [Haemophilus ducreyi 35000HP] gi|47117471|sp|Q7VM69|Y1129_HAEDU RecName: Full=UPF0243 zinc-binding protein HD_1129 gi|33148471|gb|AAP95991.1| conserved hypothetical protein [Haemophilus ducreyi 35000HP] Length = 62 Score = 40.0 bits (92), Expect = 0.12, Method: Compositional matrix adjust. Identities = 20/45 (44%), Positives = 27/45 (60%), Gaps = 4/45 (8%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDE 53 CP C K + ++ PFCS +C+ IDL W + E IA+VEDE Sbjct: 8 CPTCAKQVIWDPVSKYRPFCSERCQLIDLGEWANEEKRIASVEDE 52 >gi|319944676|ref|ZP_08018943.1| hypothetical protein HMPREF0551_1791 [Lautropia mirabilis ATCC 51599] gi|319742115|gb|EFV94535.1| hypothetical protein HMPREF0551_1791 [Lautropia mirabilis ATCC 51599] Length = 73 Score = 39.7 bits (91), Expect = 0.13, Method: Compositional matrix adjust. Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 4/55 (7%) Query: 7 RSLKSICPECRKGSMV----EFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 R + CP C+ S+ + PFCS +CR IDL W + EYV+ E ++ Sbjct: 11 RRITVNCPTCQGPSLFAPENRWRPFCSERCRMIDLGAWANDEYVVPGQPVEADDD 65 >gi|300690355|ref|YP_003751350.1| hypothetical protein RPSI07_0677 [Ralstonia solanacearum PSI07] gi|299077415|emb|CBJ50041.1| conserved protein of unknown function, UPF0243 family [Ralstonia solanacearum PSI07] Length = 71 Score = 39.7 bits (91), Expect = 0.14, Method: Compositional matrix adjust. Identities = 19/45 (42%), Positives = 23/45 (51%), Gaps = 4/45 (8%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDE 53 CP C K + PFCS +CR IDL W +Y I VED+ Sbjct: 8 CPTCGKPVPWVPESRYRPFCSERCRQIDLGAWAAEQYTIPVVEDD 52 >gi|187925429|ref|YP_001897071.1| hypothetical protein Bphyt_3457 [Burkholderia phytofirmans PsJN] gi|187716623|gb|ACD17847.1| protein of unknown function DUF329 [Burkholderia phytofirmans PsJN] Length = 65 Score = 39.7 bits (91), Expect = 0.14, Method: Compositional matrix adjust. Identities = 20/51 (39%), Positives = 24/51 (47%), Gaps = 4/51 (7%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEV 59 CP C K F PFCS +C+ IDL W +Y I E E S +E Sbjct: 7 CPTCGKDVRWTPENRFRPFCSDRCKQIDLGAWAAEKYKIGGAEQEASSDET 57 >gi|87199077|ref|YP_496334.1| hypothetical protein Saro_1055 [Novosphingobium aromaticivorans DSM 12444] gi|87134758|gb|ABD25500.1| protein of unknown function DUF329 [Novosphingobium aromaticivorans DSM 12444] Length = 57 Score = 39.7 bits (91), Expect = 0.15, Method: Compositional matrix adjust. Identities = 19/46 (41%), Positives = 22/46 (47%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K PFCST+CR DL RWL Y + E E+ Sbjct: 12 CPICGKPRSEAHSPFCSTRCRDRDLVRWLEDGYALPGRPAEVDPED 57 >gi|148557012|ref|YP_001264594.1| hypothetical protein Swit_4113 [Sphingomonas wittichii RW1] gi|148502202|gb|ABQ70456.1| hypothetical protein Swit_4113 [Sphingomonas wittichii RW1] Length = 51 Score = 39.7 bits (91), Expect = 0.15, Method: Compositional matrix adjust. Identities = 18/45 (40%), Positives = 22/45 (48%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP C K + +F PFCS CR DL +WL Y I + E Sbjct: 7 CPGCGKAPVEQFEPFCSQGCRDRDLLKWLDEGYRIPGPPADPEGE 51 >gi|206890298|ref|YP_002249441.1| putative zinc-binding protein [Thermodesulfovibrio yellowstonii DSM 11347] gi|206891111|ref|YP_002249391.1| putative zinc-binding protein [Thermodesulfovibrio yellowstonii DSM 11347] gi|206742236|gb|ACI21293.1| putative zinc-binding protein [Thermodesulfovibrio yellowstonii DSM 11347] gi|206743049|gb|ACI22106.1| putative zinc-binding protein [Thermodesulfovibrio yellowstonii DSM 11347] Length = 72 Score = 39.7 bits (91), Expect = 0.15, Method: Compositional matrix adjust. Identities = 26/58 (44%), Positives = 30/58 (51%), Gaps = 5/58 (8%) Query: 9 LKSICPECRKGSMVE---FYPFCSTQCRSIDLSRWLHGEYVIAAVE-DEK-SEEEVKD 61 +K CP C K E + PFCS C+ IDL W H Y I E DEK + EE KD Sbjct: 1 MKIKCPVCGKAVEYENNPWRPFCSKNCKIIDLWNWFHEHYSIKVEEVDEKINTEEEKD 58 >gi|298370051|ref|ZP_06981367.1| hypothetical protein HMPREF9016_01385 [Neisseria sp. oral taxon 014 str. F0314] gi|298281511|gb|EFI23000.1| hypothetical protein HMPREF9016_01385 [Neisseria sp. oral taxon 014 str. F0314] Length = 64 Score = 39.3 bits (90), Expect = 0.16, Method: Compositional matrix adjust. Identities = 18/45 (40%), Positives = 26/45 (57%), Gaps = 4/45 (8%) Query: 13 CPECRKGSMV----EFYPFCSTQCRSIDLSRWLHGEYVIAAVEDE 53 CP CR+ ++ PFCS +C+ IDL W +Y +AA E+E Sbjct: 12 CPNCRQPVAWIPENKYRPFCSERCKLIDLGEWADEKYTVAAQEEE 56 >gi|329851100|ref|ZP_08265857.1| hypothetical protein ABI_39330 [Asticcacaulis biprosthecum C19] gi|328839946|gb|EGF89518.1| hypothetical protein ABI_39330 [Asticcacaulis biprosthecum C19] Length = 77 Score = 39.3 bits (90), Expect = 0.19, Method: Compositional matrix adjust. Identities = 17/37 (45%), Positives = 22/37 (59%) Query: 24 FYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK 60 + PFCS +C +DL WL GEYVI D +EV+ Sbjct: 27 YAPFCSKRCADVDLVHWLKGEYVIGDDGDLSLTDEVE 63 >gi|167580488|ref|ZP_02373362.1| hypothetical protein BthaT_20201 [Burkholderia thailandensis TXDOH] Length = 67 Score = 38.9 bits (89), Expect = 0.21, Method: Compositional matrix adjust. Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 4/50 (8%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K F PFCS +C+ +DL W +Y I +DE E+ Sbjct: 7 CPSCGKEVRWTPENRFRPFCSARCKQLDLGAWAAEKYRIGGTDDEAPSED 56 >gi|254294125|ref|YP_003060148.1| hypothetical protein Hbal_1763 [Hirschia baltica ATCC 49814] gi|254042656|gb|ACT59451.1| protein of unknown function DUF329 [Hirschia baltica ATCC 49814] Length = 63 Score = 38.9 bits (89), Expect = 0.22, Method: Compositional matrix adjust. Identities = 17/41 (41%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Query: 10 KSICPEC-RKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAA 49 + IC C R F PFCS +C +DL W+ G YVI Sbjct: 3 QKICTNCERSFDTKGFEPFCSKRCADVDLHHWMQGSYVIPG 43 >gi|167618597|ref|ZP_02387228.1| hypothetical protein BthaB_19975 [Burkholderia thailandensis Bt4] gi|257137848|ref|ZP_05586110.1| hypothetical protein BthaA_01279 [Burkholderia thailandensis E264] Length = 67 Score = 38.9 bits (89), Expect = 0.22, Method: Compositional matrix adjust. Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 4/50 (8%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K F PFCS +C+ +DL W +Y I +DE E+ Sbjct: 7 CPSCGKEVRWTPENRFRPFCSARCKQLDLGAWAAEKYRIGGTDDEAPSED 56 >gi|262374078|ref|ZP_06067355.1| conserved hypothetical protein [Acinetobacter junii SH205] gi|262311089|gb|EEY92176.1| conserved hypothetical protein [Acinetobacter junii SH205] Length = 63 Score = 38.9 bits (89), Expect = 0.23, Method: Compositional matrix adjust. Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 8/57 (14%) Query: 13 CPECRKGSM---VEFYPFCSTQCRSIDLSRWLHGEYVIAAVE-----DEKSEEEVKD 61 CP C + S EF PFCS +C+ IDL W + EY + + D++ E+E +D Sbjct: 7 CPRCGQDSTWEGNEFRPFCSERCKLIDLGAWANDEYKLPTQDAPQAGDKRHEDEYED 63 >gi|83721406|ref|YP_441679.1| hypothetical protein BTH_I1131 [Burkholderia thailandensis E264] gi|83655231|gb|ABC39294.1| Domain of unknown function (DUF329) superfamily [Burkholderia thailandensis E264] Length = 74 Score = 38.9 bits (89), Expect = 0.23, Method: Compositional matrix adjust. Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 4/50 (8%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K F PFCS +C+ +DL W +Y I +DE E+ Sbjct: 14 CPSCGKEVRWTPENRFRPFCSARCKQLDLGAWAAEKYRIGGTDDEAPSED 63 >gi|283780799|ref|YP_003371554.1| hypothetical protein Psta_3029 [Pirellula staleyi DSM 6068] gi|283439252|gb|ADB17694.1| protein of unknown function DUF329 [Pirellula staleyi DSM 6068] Length = 71 Score = 38.9 bits (89), Expect = 0.23, Method: Compositional matrix adjust. Identities = 21/50 (42%), Positives = 28/50 (56%), Gaps = 6/50 (12%) Query: 13 CPECRK---GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAV---EDEKSE 56 CP C K + + PFCS +CR IDL RWL+ Y + +DE+SE Sbjct: 6 CPICEKRFDQATTQAMPFCSERCRKIDLGRWLNEGYSVPVERIDDDEESE 55 >gi|296284361|ref|ZP_06862359.1| hypothetical protein CbatJ_12081 [Citromicrobium bathyomarinum JL354] Length = 58 Score = 38.9 bits (89), Expect = 0.24, Method: Compositional matrix adjust. Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Query: 10 KSICPECRKG-SMVEFYPFCSTQCRSIDLSRWLHGEYVIAA 49 K CP C+ E+ PFCS +CR DL+RW + Y + Sbjct: 5 KRPCPICKSSVQTPEYKPFCSARCRDKDLNRWFNDGYALPG 45 >gi|261391855|emb|CAX49314.1| putative UPF0243 zinc-binding protein [Neisseria meningitidis 8013] gi|325145125|gb|EGC67407.1| zinc-binding protein YacG [Neisseria meningitidis M01-240013] Length = 69 Score = 38.9 bits (89), Expect = 0.24, Method: Compositional matrix adjust. Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 4/45 (8%) Query: 9 LKSICPECRKGSMVE----FYPFCSTQCRSIDLSRWLHGEYVIAA 49 L+ CP C+ + E F PFCS +C+ IDL W G+Y ++ Sbjct: 9 LQVKCPTCQTAVVWEPENAFRPFCSQRCKLIDLGGWADGKYTVSG 53 >gi|218768894|ref|YP_002343406.1| hypothetical protein NMA2158 [Neisseria meningitidis Z2491] gi|304386509|ref|ZP_07368797.1| protein of hypothetical function DUF329 [Neisseria meningitidis ATCC 13091] gi|31563289|sp|Q9JSS3|Y2158_NEIMA RecName: Full=UPF0243 zinc-binding protein NMA2158 gi|121052902|emb|CAM09254.1| conserved hypothetical protein [Neisseria meningitidis Z2491] gi|254670161|emb|CBA05213.1| conserved hypothetical protein [Neisseria meningitidis alpha153] gi|304339338|gb|EFM05410.1| protein of hypothetical function DUF329 [Neisseria meningitidis ATCC 13091] gi|308388538|gb|ADO30858.1| hypothetical protein NMBB_0368 [Neisseria meningitidis alpha710] gi|319411195|emb|CBY91600.1| putative UPF0243 zinc-binding protein [Neisseria meningitidis WUE 2594] gi|325130909|gb|EGC53638.1| zinc-binding protein YacG [Neisseria meningitidis OX99.30304] gi|325132885|gb|EGC55562.1| zinc-binding protein YacG [Neisseria meningitidis M6190] gi|325134911|gb|EGC57543.1| zinc-binding protein YacG [Neisseria meningitidis M13399] gi|325136905|gb|EGC59502.1| zinc-binding protein YacG [Neisseria meningitidis M0579] gi|325138870|gb|EGC61420.1| zinc-binding protein YacG [Neisseria meningitidis ES14902] Length = 69 Score = 38.9 bits (89), Expect = 0.24, Method: Compositional matrix adjust. Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 4/53 (7%) Query: 1 MQTSDFRSLKSICPECRKGSMVE----FYPFCSTQCRSIDLSRWLHGEYVIAA 49 M S L+ CP C+ + E F PFCS +C+ IDL W G+Y ++ Sbjct: 1 MAESRQTRLQVKCPTCQTAVVWEPENAFRPFCSQRCKLIDLGGWADGKYTVSG 53 >gi|17547549|ref|NP_520951.1| hypothetical protein RSc2830 [Ralstonia solanacearum GMI1000] gi|31563273|sp|Q8XVK0|Y2830_RALSO RecName: Full=UPF0243 zinc-binding protein RSc2830 gi|17429853|emb|CAD16537.1| hypothetical zinc-binding protein [Ralstonia solanacearum GMI1000] Length = 71 Score = 38.9 bits (89), Expect = 0.26, Method: Compositional matrix adjust. Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 5/51 (9%) Query: 8 SLKSI-CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDE 53 ++K++ CP C K + PFCS +C+ IDL W +Y I VED+ Sbjct: 2 NMKTVKCPTCGKPVPWTPESRYRPFCSERCKQIDLGAWAAEQYTIPVVEDD 52 >gi|307545302|ref|YP_003897781.1| hypothetical protein HELO_2712 [Halomonas elongata DSM 2581] gi|307217326|emb|CBV42596.1| K09862 hypothetical protein [Halomonas elongata DSM 2581] Length = 77 Score = 38.9 bits (89), Expect = 0.27, Method: Compositional matrix adjust. Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Query: 7 RSLKSICPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAA 49 R L+ CP+CRK + + PFCS +CR +DL W + IA Sbjct: 8 RPLEVACPQCRKKVLWSEDNPYRPFCSKRCRLLDLGAWADESHRIAG 54 >gi|77919243|ref|YP_357058.1| hypothetical protein Pcar_1644 [Pelobacter carbinolicus DSM 2380] gi|77545326|gb|ABA88888.1| conserved hypothetical protein [Pelobacter carbinolicus DSM 2380] Length = 87 Score = 38.9 bits (89), Expect = 0.27, Method: Compositional matrix adjust. Identities = 19/59 (32%), Positives = 29/59 (49%), Gaps = 3/59 (5%) Query: 3 TSDFRSLKSICPECRKGSMVE---FYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 T+D ++ CP C E + PFCS++CR +DL W+ EY + EE+ Sbjct: 16 TNDKKTFTVKCPHCGASKPWEGNAYRPFCSSRCRQMDLGAWVDEEYRVPDASCPSDEEQ 74 >gi|315498406|ref|YP_004087210.1| hypothetical protein Astex_1390 [Asticcacaulis excentricus CB 48] gi|315416418|gb|ADU13059.1| protein of unknown function DUF329 [Asticcacaulis excentricus CB 48] Length = 82 Score = 38.5 bits (88), Expect = 0.29, Method: Compositional matrix adjust. Identities = 18/39 (46%), Positives = 23/39 (58%), Gaps = 3/39 (7%) Query: 23 EFYPFCSTQCRSIDLSRWLHGEYVI---AAVEDEKSEEE 58 ++ PFCS +C DL WL GEYVI A+ E EE+ Sbjct: 26 DYSPFCSKRCADADLMHWLKGEYVISGTGALAAEAPEEQ 64 >gi|209544280|ref|YP_002276509.1| hypothetical protein Gdia_2136 [Gluconacetobacter diazotrophicus PAl 5] gi|209531957|gb|ACI51894.1| protein of unknown function DUF329 [Gluconacetobacter diazotrophicus PAl 5] Length = 82 Score = 38.5 bits (88), Expect = 0.29, Method: Compositional matrix adjust. Identities = 15/36 (41%), Positives = 18/36 (50%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIA 48 CP C + F PFCS +C IDL RW Y + Sbjct: 17 CPICGRPGQTAFRPFCSKRCGDIDLGRWFSETYRVP 52 >gi|152983302|ref|YP_001354691.1| hypothetical protein mma_3001 [Janthinobacterium sp. Marseille] gi|151283379|gb|ABR91789.1| Uncharacterized conserved protein [Janthinobacterium sp. Marseille] Length = 64 Score = 38.5 bits (88), Expect = 0.30, Method: Compositional matrix adjust. Identities = 20/45 (44%), Positives = 24/45 (53%), Gaps = 8/45 (17%) Query: 13 CPECRKGSMVE------FYPFCSTQCRSIDLSRWLHGEYVIAAVE 51 CP C G+ VE F PFCS +C+ IDL W +YVI V Sbjct: 7 CPTC--GTKVEWTELSKFRPFCSNRCKQIDLGAWAEEKYVIPVVN 49 >gi|300702976|ref|YP_003744578.1| hypothetical protein RCFBP_10630 [Ralstonia solanacearum CFBP2957] gi|299070639|emb|CBJ41934.1| conserved protein of unknown function, UPF0243 family [Ralstonia solanacearum CFBP2957] Length = 72 Score = 38.5 bits (88), Expect = 0.30, Method: Compositional matrix adjust. Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 4/45 (8%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDE 53 CP C K + PFCS +C+ IDL W +Y I VED+ Sbjct: 9 CPTCGKPVPWVPESRYRPFCSERCKQIDLGAWAAEQYTIPVVEDD 53 >gi|95929554|ref|ZP_01312296.1| protein of unknown function DUF329 [Desulfuromonas acetoxidans DSM 684] gi|95134251|gb|EAT15908.1| protein of unknown function DUF329 [Desulfuromonas acetoxidans DSM 684] Length = 58 Score = 38.5 bits (88), Expect = 0.30, Method: Compositional matrix adjust. Identities = 21/54 (38%), Positives = 32/54 (59%), Gaps = 7/54 (12%) Query: 13 CPECRKGSMVE---FYPFCSTQCRSIDLSRWLHGEYVIAA----VEDEKSEEEV 59 CP+C+K + E + PFCS +CR +DL W+ +Y IA V D++S+ V Sbjct: 5 CPQCKKKTPWEDNPWRPFCSERCRLVDLGCWVDEDYRIAGDPAPVTDDESDYNV 58 >gi|300309694|ref|YP_003773786.1| hypothetical protein Hsero_0352 [Herbaspirillum seropedicae SmR1] gi|300072479|gb|ADJ61878.1| conserved hypothetical protein [Herbaspirillum seropedicae SmR1] Length = 61 Score = 38.5 bits (88), Expect = 0.31, Method: Compositional matrix adjust. Identities = 20/44 (45%), Positives = 24/44 (54%), Gaps = 8/44 (18%) Query: 13 CPECRKGSMVE------FYPFCSTQCRSIDLSRWLHGEYVIAAV 50 CP C G+ VE F PFCS +C+ IDL W +Y I AV Sbjct: 7 CPTC--GAKVEWSEKNKFRPFCSERCKQIDLGAWAEEKYTIPAV 48 >gi|114327691|ref|YP_744848.1| ribonuclease G [Granulibacter bethesdensis CGDNIH1] gi|114315865|gb|ABI61925.1| ribonuclease G [Granulibacter bethesdensis CGDNIH1] Length = 76 Score = 38.5 bits (88), Expect = 0.32, Method: Compositional matrix adjust. Identities = 22/51 (43%), Positives = 26/51 (50%), Gaps = 5/51 (9%) Query: 11 SICPECRK-GSMVEF----YPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 S CP C K GS F PFCS +C +DL RWL +Y I E+ E Sbjct: 21 SRCPICNKSGSDSTFDHSYMPFCSRRCADVDLGRWLQEDYRIPGPPAEQPE 71 >gi|325295188|ref|YP_004281702.1| yacG [Desulfurobacterium thermolithotrophum DSM 11699] gi|325065636|gb|ADY73643.1| UPF0243 zinc-binding protein yacG [Desulfurobacterium thermolithotrophum DSM 11699] Length = 58 Score = 38.5 bits (88), Expect = 0.32, Method: Compositional matrix adjust. Identities = 17/42 (40%), Positives = 26/42 (61%), Gaps = 3/42 (7%) Query: 13 CPECRKGSMVE---FYPFCSTQCRSIDLSRWLHGEYVIAAVE 51 CP C K + + + PFCS +C+ DLS+WL+ EY + + E Sbjct: 6 CPNCGKETTWKDNPYRPFCSEKCKLADLSKWLNEEYTLFSEE 47 >gi|149185948|ref|ZP_01864263.1| hypothetical protein ED21_24481 [Erythrobacter sp. SD-21] gi|148830509|gb|EDL48945.1| hypothetical protein ED21_24481 [Erythrobacter sp. SD-21] Length = 59 Score = 38.5 bits (88), Expect = 0.33, Method: Compositional matrix adjust. Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 3/55 (5%) Query: 9 LKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVI---AAVEDEKSEEEVK 60 + CP C+K + PFCS +CR DL++W Y + A+ +E + E VK Sbjct: 1 MSKPCPICKKPRTEKHAPFCSDRCRDRDLAQWFGDGYAVPGRPALPEEIAAEVVK 55 >gi|149176808|ref|ZP_01855419.1| hypothetical protein PM8797T_15176 [Planctomyces maris DSM 8797] gi|148844449|gb|EDL58801.1| hypothetical protein PM8797T_15176 [Planctomyces maris DSM 8797] Length = 73 Score = 38.5 bits (88), Expect = 0.34, Method: Compositional matrix adjust. Identities = 19/44 (43%), Positives = 23/44 (52%), Gaps = 10/44 (22%) Query: 13 CPECRKGSMVEF--------YPFCSTQCRSIDLSRWLHGEYVIA 48 CP CRK +V F +PFCS +CR +D RW G Y I Sbjct: 12 CPICRK--VVTFQASDDQSPFPFCSQKCRDVDFFRWSDGRYAIV 53 >gi|107021651|ref|YP_619978.1| hypothetical protein Bcen_0091 [Burkholderia cenocepacia AU 1054] gi|116688597|ref|YP_834220.1| hypothetical protein Bcen2424_0573 [Burkholderia cenocepacia HI2424] gi|170731896|ref|YP_001763843.1| hypothetical protein Bcenmc03_0543 [Burkholderia cenocepacia MC0-3] gi|105891840|gb|ABF75005.1| protein of unknown function DUF329 [Burkholderia cenocepacia AU 1054] gi|116646686|gb|ABK07327.1| protein of unknown function DUF329 [Burkholderia cenocepacia HI2424] gi|169815138|gb|ACA89721.1| protein of unknown function DUF329 [Burkholderia cenocepacia MC0-3] Length = 66 Score = 38.5 bits (88), Expect = 0.34, Method: Compositional matrix adjust. Identities = 21/55 (38%), Positives = 27/55 (49%), Gaps = 6/55 (10%) Query: 13 CPEC----RKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDE--KSEEEVKD 61 CP C R +F PFCS +C+ +DL W +Y I DE SEE+ D Sbjct: 7 CPSCGAEVRWTPENKFRPFCSARCKQLDLGAWAAEKYRIGGASDEGPSSEEDGTD 61 >gi|329118202|ref|ZP_08246912.1| zinc-binding protein [Neisseria bacilliformis ATCC BAA-1200] gi|327465623|gb|EGF11898.1| zinc-binding protein [Neisseria bacilliformis ATCC BAA-1200] Length = 61 Score = 38.5 bits (88), Expect = 0.34, Method: Compositional matrix adjust. Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 4/51 (7%) Query: 13 CPECRKGSMV----EFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEV 59 CP C K + + PFCS +C++ DL W G Y ++A E+ SE Sbjct: 10 CPRCGKPAEFSPRNPYRPFCSQRCKTADLGAWADGSYRVSAEEEPFSEPPT 60 >gi|83749811|ref|ZP_00946783.1| Hypothetical Protein RRSL_00264 [Ralstonia solanacearum UW551] gi|83723522|gb|EAP70728.1| Hypothetical Protein RRSL_00264 [Ralstonia solanacearum UW551] Length = 71 Score = 38.5 bits (88), Expect = 0.35, Method: Compositional matrix adjust. Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 5/51 (9%) Query: 8 SLKSI-CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDE 53 ++K++ CP C K + PFCS +C+ IDL W +Y I VED+ Sbjct: 2 NVKTVKCPTCGKPVPWVPESRYRPFCSERCKQIDLGAWAAEQYTIPVVEDD 52 >gi|167571333|ref|ZP_02364207.1| hypothetical protein BoklC_15942 [Burkholderia oklahomensis C6786] Length = 67 Score = 38.1 bits (87), Expect = 0.37, Method: Compositional matrix adjust. Identities = 17/48 (35%), Positives = 23/48 (47%) Query: 11 SICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 S C E R F PFCS +C+ DL W +Y I +DE ++ Sbjct: 9 SCCKEVRWTPENRFRPFCSARCKQFDLGAWAAEKYRIGGTDDEAPSDD 56 >gi|262193836|ref|YP_003265045.1| hypothetical protein Hoch_0513 [Haliangium ochraceum DSM 14365] gi|262077183|gb|ACY13152.1| protein of unknown function DUF329 [Haliangium ochraceum DSM 14365] Length = 82 Score = 38.1 bits (87), Expect = 0.38, Method: Compositional matrix adjust. Identities = 13/25 (52%), Positives = 18/25 (72%) Query: 25 YPFCSTQCRSIDLSRWLHGEYVIAA 49 +PFCS +C+ +DL RWL G+Y I Sbjct: 36 HPFCSPRCQMVDLGRWLDGDYCIPG 60 >gi|170702926|ref|ZP_02893766.1| protein of unknown function DUF329 [Burkholderia ambifaria IOP40-10] gi|170132165|gb|EDT00653.1| protein of unknown function DUF329 [Burkholderia ambifaria IOP40-10] Length = 67 Score = 38.1 bits (87), Expect = 0.39, Method: Compositional matrix adjust. Identities = 19/53 (35%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Query: 13 CPEC----RKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP C R +F PFCS +C+ +DL W +Y I DE E +D Sbjct: 7 CPSCGAEVRWTPENKFRPFCSARCKQLDLGAWAAEKYRIGGSSDEGPSSEEED 59 >gi|93006230|ref|YP_580667.1| hypothetical protein Pcryo_1404 [Psychrobacter cryohalolentis K5] gi|92393908|gb|ABE75183.1| protein of unknown function DUF329 [Psychrobacter cryohalolentis K5] Length = 65 Score = 38.1 bits (87), Expect = 0.39, Method: Compositional matrix adjust. Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 3/48 (6%) Query: 13 CPECRKGSMVE---FYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CPEC K + + + PFCS C+ IDL W + +Y + A S+E Sbjct: 17 CPECGKQTTWQDNKYKPFCSHHCKLIDLGAWANEDYTLPAESTPFSDE 64 >gi|172059562|ref|YP_001807214.1| hypothetical protein BamMC406_0501 [Burkholderia ambifaria MC40-6] gi|171992079|gb|ACB62998.1| protein of unknown function DUF329 [Burkholderia ambifaria MC40-6] Length = 66 Score = 38.1 bits (87), Expect = 0.41, Method: Compositional matrix adjust. Identities = 21/55 (38%), Positives = 27/55 (49%), Gaps = 6/55 (10%) Query: 13 CPEC----RKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDE--KSEEEVKD 61 CP C R +F PFCS +C+ +DL W +Y I DE SEE+ D Sbjct: 7 CPSCGAEVRWAPENKFRPFCSARCKQLDLGAWAAEKYRIGGSADEGPSSEEDGTD 61 >gi|167837989|ref|ZP_02464848.1| hypothetical protein Bpse38_15857 [Burkholderia thailandensis MSMB43] Length = 67 Score = 38.1 bits (87), Expect = 0.42, Method: Compositional matrix adjust. Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 4/50 (8%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K F PFCS +C+ +DL W +Y I +DE ++ Sbjct: 7 CPSCGKEVRWTPENRFRPFCSARCKQLDLGAWAAEKYRIGGTDDEAPSDD 56 >gi|71279567|ref|YP_271100.1| hypothetical protein CPS_4452 [Colwellia psychrerythraea 34H] gi|123630938|sp|Q47VS2|Y4452_COLP3 RecName: Full=UPF0243 zinc-binding protein CPS_4452 gi|71145307|gb|AAZ25780.1| conserved hypothetical protein [Colwellia psychrerythraea 34H] Length = 78 Score = 38.1 bits (87), Expect = 0.42, Method: Compositional matrix adjust. Identities = 18/45 (40%), Positives = 26/45 (57%), Gaps = 4/45 (8%) Query: 8 SLKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIA 48 +LK CP+C+K + EF PFCS +C+ IDL W + I+ Sbjct: 2 TLKVPCPQCQKTVVWQASSEFRPFCSKRCQLIDLGEWAEESHKIS 46 >gi|294668191|ref|ZP_06733298.1| conserved domain protein [Neisseria elongata subsp. glycolytica ATCC 29315] gi|291309899|gb|EFE51142.1| conserved domain protein [Neisseria elongata subsp. glycolytica ATCC 29315] Length = 65 Score = 38.1 bits (87), Expect = 0.43, Method: Compositional matrix adjust. Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 6/57 (10%) Query: 1 MQTSDFRSLKSICPEC----RKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDE 53 M +D R +K CP C S + PFCS +C++IDL W +Y + ++ E Sbjct: 1 MMEADMRKVK--CPRCGIVTEWSSANPYRPFCSKRCKNIDLGAWADEDYRVTMIDQE 55 >gi|225874942|ref|YP_002756401.1| hypothetical protein ACP_3406 [Acidobacterium capsulatum ATCC 51196] gi|225793181|gb|ACO33271.1| conserved hypothetical protein [Acidobacterium capsulatum ATCC 51196] Length = 72 Score = 38.1 bits (87), Expect = 0.43, Method: Compositional matrix adjust. Identities = 13/25 (52%), Positives = 18/25 (72%) Query: 25 YPFCSTQCRSIDLSRWLHGEYVIAA 49 +PFCS +CR IDL +W G Y I++ Sbjct: 24 FPFCSDRCRKIDLGKWASGAYKISS 48 >gi|88859011|ref|ZP_01133652.1| hypothetical protein PTD2_08404 [Pseudoalteromonas tunicata D2] gi|88819237|gb|EAR29051.1| hypothetical protein PTD2_08404 [Pseudoalteromonas tunicata D2] Length = 79 Score = 38.1 bits (87), Expect = 0.43, Method: Compositional matrix adjust. Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 4/40 (10%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIA 48 CP C+K G + PFCS QC+ IDL W + IA Sbjct: 7 CPNCKKQVIWGPDAPYRPFCSKQCQLIDLGEWAAENHKIA 46 >gi|161870740|ref|YP_001599913.1| hypothetical protein NMCC_1813 [Neisseria meningitidis 053442] gi|189039029|sp|A9M2Z1|Y1813_NEIM0 RecName: Full=UPF0243 zinc-binding protein NMCC_1813 gi|161596293|gb|ABX73953.1| Hypothetical zinc-binding protein [Neisseria meningitidis 053442] Length = 69 Score = 38.1 bits (87), Expect = 0.45, Method: Compositional matrix adjust. Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 4/56 (7%) Query: 1 MQTSDFRSLKSICPECRKGSMVE----FYPFCSTQCRSIDLSRWLHGEYVIAAVED 52 M S L+ CP C+ + + F PFCS +C+ IDL W EY + A E+ Sbjct: 1 MAESRQTRLQVKCPTCQTAVVWKPENAFRPFCSQRCKLIDLGGWADEEYTVTAQEE 56 >gi|297537716|ref|YP_003673485.1| hypothetical protein M301_0524 [Methylotenera sp. 301] gi|297257063|gb|ADI28908.1| protein of unknown function DUF329 [Methylotenera sp. 301] Length = 70 Score = 38.1 bits (87), Expect = 0.46, Method: Compositional matrix adjust. Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 5/55 (9%) Query: 13 CPECRKGSMVE----FYPFCSTQCRSIDLSRWLHGEYVIAA-VEDEKSEEEVKDI 62 CP C+K S F PFC +C+ IDL W +Y I ++++ E+E D+ Sbjct: 11 CPNCKKLSEFSPSNAFRPFCGERCKMIDLGLWASEQYAIPVEIKEDDLEQEFSDV 65 >gi|197118661|ref|YP_002139088.1| hypothetical protein Gbem_2280 [Geobacter bemidjiensis Bem] gi|226701241|sp|B5EEE7|Y2280_GEOBB RecName: Full=UPF0243 zinc-binding protein Gbem_2280 gi|197088021|gb|ACH39292.1| protein of unknown function DUF329 [Geobacter bemidjiensis Bem] Length = 62 Score = 37.7 bits (86), Expect = 0.49, Method: Compositional matrix adjust. Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 4/53 (7%) Query: 13 CPECRKGSMV---EFYPFCSTQCRSIDLSRWLHGEYVIAAVE-DEKSEEEVKD 61 CP+CRK + + + PFCS +C+ IDL W Y I + E +EE D Sbjct: 9 CPQCRKETTLAGNPYRPFCSQRCKMIDLGTWADEGYRIPGEKAPESGDEEPGD 61 >gi|78065134|ref|YP_367903.1| hypothetical protein Bcep18194_A3658 [Burkholderia sp. 383] gi|77965879|gb|ABB07259.1| protein of unknown function DUF329 [Burkholderia sp. 383] Length = 66 Score = 37.7 bits (86), Expect = 0.51, Method: Compositional matrix adjust. Identities = 19/52 (36%), Positives = 25/52 (48%), Gaps = 8/52 (15%) Query: 13 CPECRKGSMV------EFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C G+ V +F PFCS +C+ +DL W +Y I DE E Sbjct: 7 CPSC--GAAVRWTPENQFRPFCSARCKQLDLGAWAAEKYRIGGSSDEGPSSE 56 >gi|104783625|ref|YP_610123.1| zinc-binding protein [Pseudomonas entomophila L48] gi|122401826|sp|Q1I4U6|Y4670_PSEE4 RecName: Full=UPF0243 zinc-binding protein PSEEN4670 gi|95112612|emb|CAK17340.1| conserved hypothetical protein [Pseudomonas entomophila L48] Length = 66 Score = 37.7 bits (86), Expect = 0.54, Method: Compositional matrix adjust. Identities = 19/48 (39%), Positives = 24/48 (50%), Gaps = 4/48 (8%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 CP C G F PFCS +C+ IDL W E+ IA E+ + E Sbjct: 9 CPTCGAPVEWGEKSPFRPFCSDRCKLIDLGAWAAEEHKIAGAEESEDE 56 >gi|32033517|ref|ZP_00133844.1| COG3024: Uncharacterized protein conserved in bacteria [Actinobacillus pleuropneumoniae serovar 1 str. 4074] gi|126208351|ref|YP_001053576.1| putative zinc-binding protein [Actinobacillus pleuropneumoniae L20] gi|165976296|ref|YP_001651889.1| zinc-binding protein [Actinobacillus pleuropneumoniae serovar 3 str. JL03] gi|190150203|ref|YP_001968728.1| zinc-binding protein [Actinobacillus pleuropneumoniae serovar 7 str. AP76] gi|303251265|ref|ZP_07337443.1| zinc-binding protein [Actinobacillus pleuropneumoniae serovar 6 str. Femo] gi|303252873|ref|ZP_07339032.1| zinc-binding protein [Actinobacillus pleuropneumoniae serovar 2 str. 4226] gi|307245739|ref|ZP_07527825.1| hypothetical protein appser1_9420 [Actinobacillus pleuropneumoniae serovar 1 str. 4074] gi|307247863|ref|ZP_07529899.1| hypothetical protein appser2_8520 [Actinobacillus pleuropneumoniae serovar 2 str. S1536] gi|307250115|ref|ZP_07532077.1| hypothetical protein appser4_9030 [Actinobacillus pleuropneumoniae serovar 4 str. M62] gi|307254710|ref|ZP_07536538.1| hypothetical protein appser9_9500 [Actinobacillus pleuropneumoniae serovar 9 str. CVJ13261] gi|307256928|ref|ZP_07538706.1| hypothetical protein appser10_9320 [Actinobacillus pleuropneumoniae serovar 10 str. D13039] gi|307259152|ref|ZP_07540882.1| hypothetical protein appser11_9500 [Actinobacillus pleuropneumoniae serovar 11 str. 56153] gi|307261360|ref|ZP_07543035.1| hypothetical protein appser12_9260 [Actinobacillus pleuropneumoniae serovar 12 str. 1096] gi|307263541|ref|ZP_07545156.1| hypothetical protein appser13_9570 [Actinobacillus pleuropneumoniae serovar 13 str. N273] gi|166228769|sp|A3N0N5|Y875_ACTP2 RecName: Full=UPF0243 zinc-binding protein APL_0875 gi|226696009|sp|B0BPG0|Y887_ACTPJ RecName: Full=UPF0243 zinc-binding protein APJL_0887 gi|226696034|sp|B3H1L4|Y934_ACTP7 RecName: Full=UPF0243 zinc-binding protein APP7_0934 gi|126097143|gb|ABN73971.1| putative zinc-binding protein [Actinobacillus pleuropneumoniae serovar 5b str. L20] gi|165876397|gb|ABY69445.1| zinc-binding protein [Actinobacillus pleuropneumoniae serovar 3 str. JL03] gi|189915334|gb|ACE61586.1| putative zinc-binding protein [Actinobacillus pleuropneumoniae serovar 7 str. AP76] gi|302648303|gb|EFL78500.1| zinc-binding protein [Actinobacillus pleuropneumoniae serovar 2 str. 4226] gi|302649807|gb|EFL79985.1| zinc-binding protein [Actinobacillus pleuropneumoniae serovar 6 str. Femo] gi|306853441|gb|EFM85660.1| hypothetical protein appser1_9420 [Actinobacillus pleuropneumoniae serovar 1 str. 4074] gi|306855665|gb|EFM87832.1| hypothetical protein appser2_8520 [Actinobacillus pleuropneumoniae serovar 2 str. S1536] gi|306857846|gb|EFM89940.1| hypothetical protein appser4_9030 [Actinobacillus pleuropneumoniae serovar 4 str. M62] gi|306862383|gb|EFM94349.1| hypothetical protein appser9_9500 [Actinobacillus pleuropneumoniae serovar 9 str. CVJ13261] gi|306864662|gb|EFM96567.1| hypothetical protein appser10_9320 [Actinobacillus pleuropneumoniae serovar 10 str. D13039] gi|306866819|gb|EFM98677.1| hypothetical protein appser11_9500 [Actinobacillus pleuropneumoniae serovar 11 str. 56153] gi|306869091|gb|EFN00893.1| hypothetical protein appser12_9260 [Actinobacillus pleuropneumoniae serovar 12 str. 1096] gi|306871184|gb|EFN02913.1| hypothetical protein appser13_9570 [Actinobacillus pleuropneumoniae serovar 13 str. N273] Length = 62 Score = 37.7 bits (86), Expect = 0.54, Method: Compositional matrix adjust. Identities = 18/45 (40%), Positives = 27/45 (60%), Gaps = 4/45 (8%) Query: 13 CPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDE 53 CP C + + ++ PFCS +C+ IDL W + E IAAVE++ Sbjct: 8 CPTCNQDVIWKPESKYRPFCSERCQLIDLGEWANEEKRIAAVEND 52 >gi|262370031|ref|ZP_06063358.1| UPF0243 zinc-binding protein yacG [Acinetobacter johnsonii SH046] gi|262315070|gb|EEY96110.1| UPF0243 zinc-binding protein yacG [Acinetobacter johnsonii SH046] Length = 61 Score = 37.7 bits (86), Expect = 0.55, Method: Compositional matrix adjust. Identities = 22/51 (43%), Positives = 28/51 (54%), Gaps = 6/51 (11%) Query: 13 CPECRKGSMVE---FYPFCSTQCRSIDLSRWLHGEYVIA---AVEDEKSEE 57 CP C + S E F PFCS +C+ IDL W + EY + A + E SEE Sbjct: 11 CPRCGEMSQWEDNAFRPFCSERCKLIDLGAWANDEYRLPTQDAPQAENSEE 61 >gi|126640462|ref|YP_001083445.1| putative Zinc-binding protein [Acinetobacter baumannii ATCC 17978] gi|169634508|ref|YP_001708244.1| hypothetical protein ABSDF3126 [Acinetobacter baumannii SDF] gi|169797362|ref|YP_001715155.1| hypothetical protein ABAYE3391 [Acinetobacter baumannii AYE] gi|184156714|ref|YP_001845053.1| putative zinc-binding protein [Acinetobacter baumannii ACICU] gi|213155822|ref|YP_002317868.1| hypothetical protein AB57_0461 [Acinetobacter baumannii AB0057] gi|215484802|ref|YP_002327037.1| UPF0243 zinc-binding protein yacG [Acinetobacter baumannii AB307-0294] gi|239500883|ref|ZP_04660193.1| UPF0243 zinc-binding protein yacG [Acinetobacter baumannii AB900] gi|260549197|ref|ZP_05823418.1| UPF0243 zinc-binding protein yacG [Acinetobacter sp. RUH2624] gi|260556255|ref|ZP_05828474.1| UPF0243 zinc-binding protein yacG [Acinetobacter baumannii ATCC 19606] gi|301345465|ref|ZP_07226206.1| putative zinc-binding protein [Acinetobacter baumannii AB056] gi|301511095|ref|ZP_07236332.1| putative zinc-binding protein [Acinetobacter baumannii AB058] gi|301596665|ref|ZP_07241673.1| putative zinc-binding protein [Acinetobacter baumannii AB059] gi|332851881|ref|ZP_08433784.1| hypothetical protein HMPREF0021_01356 [Acinetobacter baumannii 6013150] gi|332867939|ref|ZP_08437927.1| hypothetical protein HMPREF0020_01551 [Acinetobacter baumannii 6013113] gi|332873124|ref|ZP_08441081.1| hypothetical protein HMPREF0022_00684 [Acinetobacter baumannii 6014059] gi|126386346|gb|ABO10844.1| putative Zinc-binding protein [Acinetobacter baumannii ATCC 17978] gi|169150289|emb|CAM88186.1| conserved hypothetical protein [Acinetobacter baumannii AYE] gi|169153300|emb|CAP02406.1| conserved hypothetical protein [Acinetobacter baumannii] gi|183208308|gb|ACC55706.1| putative zinc-binding protein [Acinetobacter baumannii ACICU] gi|213054982|gb|ACJ39884.1| conserved hypothetical protein [Acinetobacter baumannii AB0057] gi|213988161|gb|ACJ58460.1| UPF0243 zinc-binding protein yacG [Acinetobacter baumannii AB307-0294] gi|260407925|gb|EEX01397.1| UPF0243 zinc-binding protein yacG [Acinetobacter sp. RUH2624] gi|260410310|gb|EEX03609.1| UPF0243 zinc-binding protein yacG [Acinetobacter baumannii ATCC 19606] gi|322506603|gb|ADX02057.1| Putative Zinc-binding protein [Acinetobacter baumannii 1656-2] gi|323516480|gb|ADX90861.1| putative zinc-binding protein [Acinetobacter baumannii TCDC-AB0715] gi|332729666|gb|EGJ61002.1| hypothetical protein HMPREF0021_01356 [Acinetobacter baumannii 6013150] gi|332733640|gb|EGJ64799.1| hypothetical protein HMPREF0020_01551 [Acinetobacter baumannii 6013113] gi|332738636|gb|EGJ69506.1| hypothetical protein HMPREF0022_00684 [Acinetobacter baumannii 6014059] Length = 64 Score = 37.7 bits (86), Expect = 0.56, Method: Compositional matrix adjust. Identities = 21/53 (39%), Positives = 30/53 (56%), Gaps = 7/53 (13%) Query: 13 CPECRKGSM---VEFYPFCSTQCRSIDLSRWLHGEYVI----AAVEDEKSEEE 58 CP C + S+ EF PFCS +C+ IDL W + EY + A +D+ S+ E Sbjct: 7 CPRCGEPSVWEGNEFRPFCSERCKLIDLGAWANDEYRLPTQDAPQQDKGSQHE 59 >gi|332185520|ref|ZP_08387268.1| hypothetical protein SUS17_706 [Sphingomonas sp. S17] gi|332014498|gb|EGI56555.1| hypothetical protein SUS17_706 [Sphingomonas sp. S17] Length = 55 Score = 37.7 bits (86), Expect = 0.59, Method: Compositional matrix adjust. Identities = 22/51 (43%), Positives = 26/51 (50%), Gaps = 3/51 (5%) Query: 11 SICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 + CP C K S E PFCS C+ DL +WL Y I E S+EE D Sbjct: 2 TTCPICDKPSAPEHAPFCSRGCKDRDLLQWLGEGYRIPVKE---SDEEGLD 49 >gi|261250237|ref|ZP_05942813.1| zinc-binding protein [Vibrio orientalis CIP 102891] gi|260939353|gb|EEX95339.1| zinc-binding protein [Vibrio orientalis CIP 102891] Length = 64 Score = 37.7 bits (86), Expect = 0.59, Method: Compositional matrix adjust. Identities = 17/44 (38%), Positives = 20/44 (45%), Gaps = 4/44 (9%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVED 52 CP+C + G F PFCS QC+ ID W E I D Sbjct: 9 CPQCGQDVQWGEQSPFRPFCSKQCQMIDFGEWADEENTIPGAPD 52 >gi|119773505|ref|YP_926245.1| hypothetical protein Sama_0364 [Shewanella amazonensis SB2B] gi|166232621|sp|A1S2G9|Y364_SHEAM RecName: Full=UPF0243 zinc-binding protein Sama_0364 gi|119766005|gb|ABL98575.1| conserved hypothetical protein [Shewanella amazonensis SB2B] Length = 71 Score = 37.7 bits (86), Expect = 0.59, Method: Compositional matrix adjust. Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 5/54 (9%) Query: 8 SLKSICPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 +L CP+C+K + F PFCS +C+ IDL W ++ I V+D+ SEE Sbjct: 2 TLTVKCPQCQKPVTWDASSAFKPFCSERCKLIDLGDWASEKHAI-PVKDDISEE 54 >gi|262375094|ref|ZP_06068328.1| UPF0243 zinc-binding protein yacG [Acinetobacter lwoffii SH145] gi|262310107|gb|EEY91236.1| UPF0243 zinc-binding protein yacG [Acinetobacter lwoffii SH145] Length = 57 Score = 37.7 bits (86), Expect = 0.60, Method: Compositional matrix adjust. Identities = 21/51 (41%), Positives = 28/51 (54%), Gaps = 6/51 (11%) Query: 13 CPECRKGSM---VEFYPFCSTQCRSIDLSRWLHGEYVIA---AVEDEKSEE 57 CP C K + EF PFCS +C+ IDL W + EY + A + + SEE Sbjct: 7 CPRCGKLTTWEDNEFRPFCSERCKMIDLGAWANEEYSLPTQDAPQADNSEE 57 >gi|290476441|ref|YP_003469346.1| hypothetical protein XBJ1_3464 [Xenorhabdus bovienii SS-2004] gi|289175779|emb|CBJ82582.1| conserved hypothetical protein [Xenorhabdus bovienii SS-2004] Length = 65 Score = 37.4 bits (85), Expect = 0.63, Method: Compositional matrix adjust. Identities = 19/48 (39%), Positives = 25/48 (52%), Gaps = 4/48 (8%) Query: 9 LKSICPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVED 52 L CP C K G + + PFCS +C+ IDL W E IA+ +D Sbjct: 5 LTVACPTCAKTVIWGEINPYRPFCSKRCQLIDLGEWASEEKKIASQDD 52 >gi|239999759|ref|ZP_04719683.1| hypothetical protein Ngon3_09816 [Neisseria gonorrhoeae 35/02] gi|240014916|ref|ZP_04721829.1| hypothetical protein NgonD_09803 [Neisseria gonorrhoeae DGI18] gi|240017364|ref|ZP_04723904.1| hypothetical protein NgonFA_09421 [Neisseria gonorrhoeae FA6140] gi|240081507|ref|ZP_04726050.1| hypothetical protein NgonF_09398 [Neisseria gonorrhoeae FA19] gi|240113786|ref|ZP_04728276.1| hypothetical protein NgonM_09521 [Neisseria gonorrhoeae MS11] gi|240116520|ref|ZP_04730582.1| hypothetical protein NgonPID1_09861 [Neisseria gonorrhoeae PID18] gi|240118744|ref|ZP_04732806.1| hypothetical protein NgonPID_09872 [Neisseria gonorrhoeae PID1] gi|240121986|ref|ZP_04734948.1| hypothetical protein NgonPI_09528 [Neisseria gonorrhoeae PID24-1] gi|240124283|ref|ZP_04737239.1| hypothetical protein NgonP_10163 [Neisseria gonorrhoeae PID332] gi|240126494|ref|ZP_04739380.1| hypothetical protein NgonSK_09868 [Neisseria gonorrhoeae SK-92-679] gi|240128957|ref|ZP_04741618.1| hypothetical protein NgonS_10107 [Neisseria gonorrhoeae SK-93-1035] gi|260439723|ref|ZP_05793539.1| hypothetical protein NgonDG_01288 [Neisseria gonorrhoeae DGI2] gi|268599858|ref|ZP_06134025.1| LOW QUALITY PROTEIN: DUF329 domain-containing protein [Neisseria gonorrhoeae MS11] gi|268602193|ref|ZP_06136360.1| dephospho-CoA kinase [Neisseria gonorrhoeae PID18] gi|268604458|ref|ZP_06138625.1| zinc-binding protein [Neisseria gonorrhoeae PID1] gi|268682912|ref|ZP_06149774.1| zinc-binding protein [Neisseria gonorrhoeae PID332] gi|268685078|ref|ZP_06151940.1| dephospho-CoA kinase [Neisseria gonorrhoeae SK-92-679] gi|31563239|sp|Q50961|YPIL_NEIGO RecName: Full=UPF0243 zinc-binding protein ORFY gi|67462012|sp|Q5F690|Y1672_NEIG1 RecName: Full=UPF0243 zinc-binding protein NGO1672 gi|268583989|gb|EEZ48665.1| LOW QUALITY PROTEIN: DUF329 domain-containing protein [Neisseria gonorrhoeae MS11] gi|268586324|gb|EEZ51000.1| dephospho-CoA kinase [Neisseria gonorrhoeae PID18] gi|268588589|gb|EEZ53265.1| zinc-binding protein [Neisseria gonorrhoeae PID1] gi|268623196|gb|EEZ55596.1| zinc-binding protein [Neisseria gonorrhoeae PID332] gi|268625362|gb|EEZ57762.1| dephospho-CoA kinase [Neisseria gonorrhoeae SK-92-679] Length = 69 Score = 37.4 bits (85), Expect = 0.63, Method: Compositional matrix adjust. Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 4/53 (7%) Query: 1 MQTSDFRSLKSICPECRKGSMVE----FYPFCSTQCRSIDLSRWLHGEYVIAA 49 M S L+ CP C+ + + F PFCS +C+ IDL W G+Y ++ Sbjct: 1 MAESRQTRLQVKCPTCQTAVVWKPENAFRPFCSQRCKLIDLGGWADGKYTVSG 53 >gi|115350530|ref|YP_772369.1| hypothetical protein Bamb_0476 [Burkholderia ambifaria AMMD] gi|171316222|ref|ZP_02905445.1| protein of unknown function DUF329 [Burkholderia ambifaria MEX-5] gi|115280518|gb|ABI86035.1| protein of unknown function DUF329 [Burkholderia ambifaria AMMD] gi|171098636|gb|EDT43433.1| protein of unknown function DUF329 [Burkholderia ambifaria MEX-5] Length = 66 Score = 37.4 bits (85), Expect = 0.63, Method: Compositional matrix adjust. Identities = 21/55 (38%), Positives = 27/55 (49%), Gaps = 6/55 (10%) Query: 13 CPEC----RKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDE--KSEEEVKD 61 CP C R +F PFCS +C+ +DL W +Y I DE SEE+ D Sbjct: 7 CPSCGAEVRWTPENKFRPFCSARCKQLDLGAWAAEKYRIGGSSDEGPSSEEDGTD 61 >gi|121635534|ref|YP_975779.1| hypothetical protein NMC1842 [Neisseria meningitidis FAM18] gi|254805635|ref|YP_003083856.1| hypothetical protein NMO_1711 [Neisseria meningitidis alpha14] gi|166225449|sp|A1KVV4|Y1842_NEIMF RecName: Full=UPF0243 zinc-binding protein NMC1842 gi|120867240|emb|CAM11009.1| conserved hypothetical protein [Neisseria meningitidis FAM18] gi|254669177|emb|CBA07909.1| conserved hypothetical protein [Neisseria meningitidis alpha14] gi|325128916|gb|EGC51770.1| zinc-binding protein YacG [Neisseria meningitidis N1568] gi|325202850|gb|ADY98304.1| zinc-binding protein YacG [Neisseria meningitidis M01-240149] gi|325203443|gb|ADY98896.1| zinc-binding protein YacG [Neisseria meningitidis M01-240355] gi|325205407|gb|ADZ00860.1| zinc-binding protein YacG [Neisseria meningitidis M04-240196] gi|325208843|gb|ADZ04295.1| zinc-binding protein YacG [Neisseria meningitidis NZ-05/33] Length = 69 Score = 37.4 bits (85), Expect = 0.64, Method: Compositional matrix adjust. Identities = 16/45 (35%), Positives = 26/45 (57%), Gaps = 4/45 (8%) Query: 9 LKSICPECRKGSMVE----FYPFCSTQCRSIDLSRWLHGEYVIAA 49 L+ CP C+ + + F PFCS +C+ IDL W G+Y +++ Sbjct: 9 LQVKCPTCQTAVVWKPENAFRPFCSQRCKLIDLGGWADGKYTVSS 53 >gi|221068975|ref|ZP_03545080.1| protein of unknown function DUF329 [Comamonas testosteroni KF-1] gi|220713998|gb|EED69366.1| protein of unknown function DUF329 [Comamonas testosteroni KF-1] Length = 70 Score = 37.4 bits (85), Expect = 0.64, Method: Compositional matrix adjust. Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 4/41 (9%) Query: 13 CPECRKGSMV----EFYPFCSTQCRSIDLSRWLHGEYVIAA 49 CP C S+ +F PFCS +CR+IDL W + E+ + A Sbjct: 13 CPTCGGPSVFLPSNKFRPFCSERCRNIDLGAWGNEEFRVPA 53 >gi|15676246|ref|NP_273379.1| hypothetical protein NMB0330 [Neisseria meningitidis MC58] gi|31563290|sp|Q9K155|Y330_NEIMB RecName: Full=UPF0243 zinc-binding protein NMB0330 gi|7225551|gb|AAF40774.1| conserved hypothetical protein [Neisseria meningitidis MC58] gi|325140979|gb|EGC63485.1| zinc-binding protein YacG [Neisseria meningitidis CU385] gi|325199524|gb|ADY94979.1| zinc-binding protein YacG [Neisseria meningitidis H44/76] Length = 69 Score = 37.4 bits (85), Expect = 0.65, Method: Compositional matrix adjust. Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 4/45 (8%) Query: 9 LKSICPECRKGSMVE----FYPFCSTQCRSIDLSRWLHGEYVIAA 49 L+ CP C+ + + F PFCS +C+ IDL W G+Y ++ Sbjct: 9 LQVKCPTCQTAVVWKPENAFRPFCSQRCKLIDLGGWADGKYTVSG 53 >gi|186477408|ref|YP_001858878.1| hypothetical protein Bphy_2660 [Burkholderia phymatum STM815] gi|184193867|gb|ACC71832.1| protein of unknown function DUF329 [Burkholderia phymatum STM815] Length = 64 Score = 37.4 bits (85), Expect = 0.66, Method: Compositional matrix adjust. Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 4/51 (7%) Query: 13 CPEC----RKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEV 59 CP C R S F PFCS +C+ IDL W +Y I ++E ++ Sbjct: 7 CPSCGRDVRWTSENRFRPFCSERCKQIDLGAWAAEKYKIGGTDEEPPTDDT 57 >gi|262380048|ref|ZP_06073203.1| conserved hypothetical protein [Acinetobacter radioresistens SH164] gi|262298242|gb|EEY86156.1| conserved hypothetical protein [Acinetobacter radioresistens SH164] Length = 63 Score = 37.4 bits (85), Expect = 0.66, Method: Compositional matrix adjust. Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 4/49 (8%) Query: 13 CPECRKGSM---VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K + EF PFCS +C+ IDL W + EY + +D S ++ Sbjct: 10 CPRCGKPATWENNEFRPFCSERCKMIDLGAWANEEYRV-PTQDSPSRQD 57 >gi|255321266|ref|ZP_05362432.1| conserved hypothetical protein [Acinetobacter radioresistens SK82] gi|255301820|gb|EET81071.1| conserved hypothetical protein [Acinetobacter radioresistens SK82] Length = 61 Score = 37.4 bits (85), Expect = 0.66, Method: Compositional matrix adjust. Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 4/49 (8%) Query: 13 CPECRKGSM---VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K + EF PFCS +C+ IDL W + EY + +D S ++ Sbjct: 8 CPRCGKPATWENNEFRPFCSERCKMIDLGAWANEEYRV-PTQDSPSRQD 55 >gi|297170248|gb|ADI21285.1| hypothetical protein [uncultured gamma proteobacterium HF0010_09F21] Length = 54 Score = 37.4 bits (85), Expect = 0.67, Method: Compositional matrix adjust. Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 2/46 (4%) Query: 13 CPECRKGSMV--EFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 CP+C+ + EF PFCS C+++D W + E I +D S+ Sbjct: 9 CPQCKNIVEISSEFNPFCSKTCKNLDFLNWANEEKSIPMPDDSTSD 54 >gi|149376820|ref|ZP_01894577.1| zinc-binding protein [Marinobacter algicola DG893] gi|149358941|gb|EDM47408.1| zinc-binding protein [Marinobacter algicola DG893] Length = 62 Score = 37.4 bits (85), Expect = 0.67, Method: Compositional matrix adjust. Identities = 17/41 (41%), Positives = 22/41 (53%), Gaps = 4/41 (9%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAA 49 CP C+K F PFCS +C+ IDL W + EY + A Sbjct: 5 CPTCKKSVEWNENNPFRPFCSERCKLIDLGAWANEEYRVPA 45 >gi|309783035|ref|ZP_07677754.1| conserved hypothetical protein [Ralstonia sp. 5_7_47FAA] gi|308918143|gb|EFP63821.1| conserved hypothetical protein [Ralstonia sp. 5_7_47FAA] Length = 67 Score = 37.4 bits (85), Expect = 0.68, Method: Compositional matrix adjust. Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 4/45 (8%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDE 53 CP C K + PFCS +C+ IDL W +Y I VE++ Sbjct: 8 CPSCGKAVPWVPESRYRPFCSERCKQIDLGAWAAEQYTIPVVEED 52 >gi|241664293|ref|YP_002982653.1| hypothetical protein Rpic12D_2710 [Ralstonia pickettii 12D] gi|240866320|gb|ACS63981.1| protein of unknown function DUF329 [Ralstonia pickettii 12D] Length = 67 Score = 37.4 bits (85), Expect = 0.68, Method: Compositional matrix adjust. Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 4/45 (8%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDE 53 CP C K + PFCS +C+ IDL W +Y I VE++ Sbjct: 8 CPSCGKAVPWVPESRYRPFCSERCKQIDLGAWAAEQYTIPVVEED 52 >gi|148653224|ref|YP_001280317.1| hypothetical protein PsycPRwf_1422 [Psychrobacter sp. PRwf-1] gi|148572308|gb|ABQ94367.1| protein of unknown function DUF329 [Psychrobacter sp. PRwf-1] Length = 68 Score = 37.4 bits (85), Expect = 0.69, Method: Compositional matrix adjust. Identities = 16/48 (33%), Positives = 30/48 (62%), Gaps = 3/48 (6%) Query: 13 CPECRKGSMVE---FYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP+C+K ++ + + PFCS +C+ IDL W + +Y + A + S++ Sbjct: 19 CPQCQKLTVWQDNPYKPFCSDRCKLIDLGAWANEDYKLPAQDSPFSQD 66 >gi|73542649|ref|YP_297169.1| hypothetical protein Reut_A2965 [Ralstonia eutropha JMP134] gi|72120062|gb|AAZ62325.1| Protein of unknown function DUF329 [Ralstonia eutropha JMP134] Length = 63 Score = 37.4 bits (85), Expect = 0.72, Method: Compositional matrix adjust. Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 8/55 (14%) Query: 13 CPECRKGSMVE------FYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP C G+ VE F PFCS +C+ IDL W +YVI + E ++ + Sbjct: 7 CPTC--GTKVEWIPENKFRPFCSERCKQIDLGAWASEKYVIGSKPGETPSPDLPE 59 >gi|254178790|ref|ZP_04885444.1| conserved hypothetical protein [Burkholderia mallei ATCC 10399] gi|254299351|ref|ZP_04966801.1| conserved hypothetical protein [Burkholderia pseudomallei 406e] gi|254357653|ref|ZP_04973927.1| conserved hypothetical protein [Burkholderia mallei 2002721280] gi|148026717|gb|EDK84802.1| conserved hypothetical protein [Burkholderia mallei 2002721280] gi|157809263|gb|EDO86433.1| conserved hypothetical protein [Burkholderia pseudomallei 406e] gi|160694704|gb|EDP84712.1| conserved hypothetical protein [Burkholderia mallei ATCC 10399] Length = 76 Score = 37.4 bits (85), Expect = 0.72, Method: Compositional matrix adjust. Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 4/50 (8%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K F PFCS +C+ +DL W +Y I +D E+ Sbjct: 16 CPSCGKEVRWTPENRFRPFCSARCKQLDLGAWAAEKYRIGGTDDAAPSED 65 >gi|134294660|ref|YP_001118395.1| hypothetical protein Bcep1808_0548 [Burkholderia vietnamiensis G4] gi|134137817|gb|ABO53560.1| protein of unknown function DUF329 [Burkholderia vietnamiensis G4] Length = 66 Score = 37.4 bits (85), Expect = 0.73, Method: Compositional matrix adjust. Identities = 21/56 (37%), Positives = 27/56 (48%), Gaps = 6/56 (10%) Query: 13 CPEC----RKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDE--KSEEEVKDI 62 CP C R +F PFCS +C+ +DL W +Y I DE SEE+ D Sbjct: 7 CPSCGAEVRWTHENKFRPFCSARCKQLDLGAWAAEKYRIGGSSDEGPSSEEDGGDT 62 >gi|237749304|ref|ZP_04579784.1| conserved hypothetical protein [Oxalobacter formigenes OXCC13] gi|229380666|gb|EEO30757.1| conserved hypothetical protein [Oxalobacter formigenes OXCC13] Length = 59 Score = 37.4 bits (85), Expect = 0.74, Method: Compositional matrix adjust. Identities = 21/51 (41%), Positives = 25/51 (49%), Gaps = 5/51 (9%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEY-VIAAVEDEKSEEE 58 CP C K + PFCS +C+ IDL W +Y V A EDE EE Sbjct: 7 CPVCGKDVEWKEANAYRPFCSERCKQIDLGAWADEQYKVPGAAEDENDREE 57 >gi|149909372|ref|ZP_01898027.1| Uncharacterized zinc finger protein [Moritella sp. PE36] gi|149807482|gb|EDM67431.1| Uncharacterized zinc finger protein [Moritella sp. PE36] Length = 61 Score = 37.4 bits (85), Expect = 0.74, Method: Compositional matrix adjust. Identities = 20/52 (38%), Positives = 25/52 (48%), Gaps = 4/52 (7%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK 60 CP C+K + EF PFC +C+ IDL W GE I E E + K Sbjct: 5 CPTCQKPVEWVATSEFRPFCCERCKLIDLGEWASGERAIPGEEVSPQELQPK 56 >gi|134095956|ref|YP_001101031.1| hypothetical protein HEAR2794 [Herminiimonas arsenicoxydans] gi|133739859|emb|CAL62910.1| conserved hypothetical protein; putative glucocorticoid receptor domain [Herminiimonas arsenicoxydans] Length = 66 Score = 37.4 bits (85), Expect = 0.74, Method: Compositional matrix adjust. Identities = 19/41 (46%), Positives = 23/41 (56%), Gaps = 8/41 (19%) Query: 13 CPECRKGSMVE------FYPFCSTQCRSIDLSRWLHGEYVI 47 CP C G+ VE F PFCS +C+ IDL W +YVI Sbjct: 7 CPTC--GTKVEWSETSKFRPFCSNRCKQIDLGAWAEEKYVI 45 >gi|237747146|ref|ZP_04577626.1| conserved hypothetical protein [Oxalobacter formigenes HOxBLS] gi|229378497|gb|EEO28588.1| conserved hypothetical protein [Oxalobacter formigenes HOxBLS] Length = 62 Score = 37.4 bits (85), Expect = 0.76, Method: Compositional matrix adjust. Identities = 19/49 (38%), Positives = 26/49 (53%), Gaps = 8/49 (16%) Query: 13 CPECRKGSMVE------FYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKS 55 CP C G VE + PFCS +C+ IDL W +Y + A DE++ Sbjct: 7 CPMC--GKDVEWKESNLYRPFCSERCKQIDLGAWAEEKYKVPAANDEEN 53 >gi|59801997|ref|YP_208709.1| hypothetical protein NGO1672 [Neisseria gonorrhoeae FA 1090] gi|268595572|ref|ZP_06129739.1| dephospho-CoA kinase [Neisseria gonorrhoeae 35/02] gi|268597607|ref|ZP_06131774.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19] gi|291042971|ref|ZP_06568709.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2] gi|996086|gb|AAC43466.1| ORFY; non-essential for pilus assembly; Method: conceptual translation supplied by author [Neisseria gonorrhoeae] gi|59718892|gb|AAW90297.1| conserved hypothetical protein [Neisseria gonorrhoeae FA 1090] gi|268548961|gb|EEZ44379.1| dephospho-CoA kinase [Neisseria gonorrhoeae 35/02] gi|268551395|gb|EEZ46414.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19] gi|291013110|gb|EFE05079.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2] Length = 105 Score = 37.4 bits (85), Expect = 0.76, Method: Compositional matrix adjust. Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 4/45 (8%) Query: 9 LKSICPECRKGSMVE----FYPFCSTQCRSIDLSRWLHGEYVIAA 49 L+ CP C+ + + F PFCS +C+ IDL W G+Y ++ Sbjct: 45 LQVKCPTCQTAVVWKPENAFRPFCSQRCKLIDLGGWADGKYTVSG 89 >gi|261401638|ref|ZP_05987763.1| conserved domain protein [Neisseria lactamica ATCC 23970] gi|296313616|ref|ZP_06863557.1| conserved domain protein [Neisseria polysaccharea ATCC 43768] gi|269208277|gb|EEZ74732.1| conserved domain protein [Neisseria lactamica ATCC 23970] gi|296839854|gb|EFH23792.1| conserved domain protein [Neisseria polysaccharea ATCC 43768] Length = 69 Score = 37.0 bits (84), Expect = 0.80, Method: Compositional matrix adjust. Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 4/44 (9%) Query: 9 LKSICPECRKGSMVE----FYPFCSTQCRSIDLSRWLHGEYVIA 48 L+ CP C+ + + F PFCS +C+ IDL W G+Y ++ Sbjct: 9 LQVKCPTCQTAVVWKPENAFRPFCSQRCKLIDLGGWADGKYTVS 52 >gi|299065622|emb|CBJ36794.1| conserved protein of unknown function, UPF0243 family [Ralstonia solanacearum CMR15] Length = 57 Score = 37.0 bits (84), Expect = 0.83, Method: Compositional matrix adjust. Identities = 14/30 (46%), Positives = 19/30 (63%) Query: 24 FYPFCSTQCRSIDLSRWLHGEYVIAAVEDE 53 + PFCS +C+ IDL W +Y I VED+ Sbjct: 9 YRPFCSERCKQIDLGAWAAEQYTIPVVEDD 38 >gi|53720622|ref|YP_109608.1| hypothetical protein BPSL3012a [Burkholderia pseudomallei K96243] gi|76811108|ref|YP_334902.1| hypothetical protein BURPS1710b_3532 [Burkholderia pseudomallei 1710b] gi|121599354|ref|YP_991807.1| hypothetical protein BMASAVP1_A0458 [Burkholderia mallei SAVP1] gi|124384215|ref|YP_001027299.1| hypothetical protein BMA10229_A1316 [Burkholderia mallei NCTC 10229] gi|126439020|ref|YP_001060521.1| hypothetical protein BURPS668_3511 [Burkholderia pseudomallei 668] gi|126449405|ref|YP_001082763.1| hypothetical protein BMA10247_3246 [Burkholderia mallei NCTC 10247] gi|126451790|ref|YP_001067772.1| hypothetical protein BURPS1106A_3536 [Burkholderia pseudomallei 1106a] gi|134280404|ref|ZP_01767115.1| conserved hypothetical protein [Burkholderia pseudomallei 305] gi|166998622|ref|ZP_02264480.1| conserved hypothetical protein [Burkholderia mallei PRL-20] gi|167721325|ref|ZP_02404561.1| hypothetical protein BpseD_20113 [Burkholderia pseudomallei DM98] gi|167740294|ref|ZP_02413068.1| hypothetical protein Bpse14_19680 [Burkholderia pseudomallei 14] gi|167817513|ref|ZP_02449193.1| hypothetical protein Bpse9_20411 [Burkholderia pseudomallei 91] gi|167825914|ref|ZP_02457385.1| hypothetical protein Bpseu9_19737 [Burkholderia pseudomallei 9] gi|167847400|ref|ZP_02472908.1| hypothetical protein BpseB_19147 [Burkholderia pseudomallei B7210] gi|167895988|ref|ZP_02483390.1| hypothetical protein Bpse7_19751 [Burkholderia pseudomallei 7894] gi|167904373|ref|ZP_02491578.1| hypothetical protein BpseN_19126 [Burkholderia pseudomallei NCTC 13177] gi|167912633|ref|ZP_02499724.1| hypothetical protein Bpse112_19244 [Burkholderia pseudomallei 112] gi|167920601|ref|ZP_02507692.1| hypothetical protein BpseBC_18784 [Burkholderia pseudomallei BCC215] gi|217425710|ref|ZP_03457200.1| conserved hypothetical protein [Burkholderia pseudomallei 576] gi|226199607|ref|ZP_03795163.1| conserved hypothetical protein [Burkholderia pseudomallei Pakistan 9] gi|237813905|ref|YP_002898356.1| hypothetical protein GBP346_A3684 [Burkholderia pseudomallei MSHR346] gi|238561276|ref|ZP_04609516.1| conserved hypothetical protein [Burkholderia mallei GB8 horse 4] gi|242315177|ref|ZP_04814193.1| conserved hypothetical protein [Burkholderia pseudomallei 1106b] gi|254180561|ref|ZP_04887159.1| conserved hypothetical protein [Burkholderia pseudomallei 1655] gi|254190999|ref|ZP_04897505.1| conserved hypothetical protein [Burkholderia pseudomallei Pasteur 52237] gi|254199095|ref|ZP_04905510.1| conserved hypothetical protein [Burkholderia pseudomallei S13] gi|254202801|ref|ZP_04909164.1| conserved hypothetical protein [Burkholderia mallei FMH] gi|254208143|ref|ZP_04914493.1| conserved hypothetical protein [Burkholderia mallei JHU] gi|254260560|ref|ZP_04951614.1| conserved hypothetical protein [Burkholderia pseudomallei 1710a] gi|52211036|emb|CAH37024.1| conserved hypothetical protein [Burkholderia pseudomallei K96243] gi|76580561|gb|ABA50036.1| conserved hypothetical protein [Burkholderia pseudomallei 1710b] gi|121228164|gb|ABM50682.1| conserved hypothetical protein [Burkholderia mallei SAVP1] gi|124292235|gb|ABN01504.1| conserved hypothetical protein [Burkholderia mallei NCTC 10229] gi|126218513|gb|ABN82019.1| conserved hypothetical protein [Burkholderia pseudomallei 668] gi|126225432|gb|ABN88972.1| conserved hypothetical protein [Burkholderia pseudomallei 1106a] gi|126242275|gb|ABO05368.1| conserved hypothetical protein [Burkholderia mallei NCTC 10247] gi|134248411|gb|EBA48494.1| conserved hypothetical protein [Burkholderia pseudomallei 305] gi|147747048|gb|EDK54125.1| conserved hypothetical protein [Burkholderia mallei FMH] gi|147752037|gb|EDK59104.1| conserved hypothetical protein [Burkholderia mallei JHU] gi|157938673|gb|EDO94343.1| conserved hypothetical protein [Burkholderia pseudomallei Pasteur 52237] gi|169656925|gb|EDS88322.1| conserved hypothetical protein [Burkholderia pseudomallei S13] gi|184211100|gb|EDU08143.1| conserved hypothetical protein [Burkholderia pseudomallei 1655] gi|217391298|gb|EEC31330.1| conserved hypothetical protein [Burkholderia pseudomallei 576] gi|225928353|gb|EEH24384.1| conserved hypothetical protein [Burkholderia pseudomallei Pakistan 9] gi|237504590|gb|ACQ96908.1| conserved hypothetical protein [Burkholderia pseudomallei MSHR346] gi|238524993|gb|EEP88423.1| conserved hypothetical protein [Burkholderia mallei GB8 horse 4] gi|242138416|gb|EES24818.1| conserved hypothetical protein [Burkholderia pseudomallei 1106b] gi|243065303|gb|EES47489.1| conserved hypothetical protein [Burkholderia mallei PRL-20] gi|254219249|gb|EET08633.1| conserved hypothetical protein [Burkholderia pseudomallei 1710a] Length = 67 Score = 37.0 bits (84), Expect = 0.83, Method: Compositional matrix adjust. Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 4/50 (8%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K F PFCS +C+ +DL W +Y I +D E+ Sbjct: 7 CPSCGKEVRWTPENRFRPFCSARCKQLDLGAWAAEKYRIGGTDDAAPSED 56 >gi|299529711|ref|ZP_07043148.1| hypothetical protein CTS44_03025 [Comamonas testosteroni S44] gi|298722574|gb|EFI63494.1| hypothetical protein CTS44_03025 [Comamonas testosteroni S44] Length = 60 Score = 37.0 bits (84), Expect = 0.85, Method: Compositional matrix adjust. Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 4/41 (9%) Query: 13 CPECRKGSMV----EFYPFCSTQCRSIDLSRWLHGEYVIAA 49 CP C S+ +F PFCS +CR+IDL W + E+ + A Sbjct: 4 CPTCGGPSVFLPSNKFRPFCSERCRNIDLGAWGNEEFRVPA 44 >gi|264676893|ref|YP_003276799.1| hypothetical protein CtCNB1_0757 [Comamonas testosteroni CNB-2] gi|262207405|gb|ACY31503.1| hypothetical conserved protein [Comamonas testosteroni CNB-2] Length = 60 Score = 37.0 bits (84), Expect = 0.85, Method: Compositional matrix adjust. Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 4/42 (9%) Query: 12 ICPECRKGSMV----EFYPFCSTQCRSIDLSRWLHGEYVIAA 49 CP C S+ +F PFCS +CR+IDL W + E+ + A Sbjct: 3 TCPTCGGPSVFLPSNKFRPFCSERCRNIDLGAWGNEEFRVPA 44 >gi|323143366|ref|ZP_08078054.1| hypothetical protein HMPREF9444_00672 [Succinatimonas hippei YIT 12066] gi|322416884|gb|EFY07530.1| hypothetical protein HMPREF9444_00672 [Succinatimonas hippei YIT 12066] Length = 106 Score = 37.0 bits (84), Expect = 0.86, Method: Compositional matrix adjust. Identities = 22/54 (40%), Positives = 28/54 (51%), Gaps = 6/54 (11%) Query: 2 QTSDFR--SLKSICPECRKGSMVE----FYPFCSTQCRSIDLSRWLHGEYVIAA 49 QTS F +LK CP C K + F PFCS +C+ IDL W + E +A Sbjct: 24 QTSRFDGDTLKVKCPICGKEIIYSKDNPFRPFCSERCKLIDLGAWANEERTVAG 77 >gi|167564184|ref|ZP_02357100.1| hypothetical protein BoklE_16634 [Burkholderia oklahomensis EO147] Length = 67 Score = 37.0 bits (84), Expect = 0.87, Method: Compositional matrix adjust. Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 4/50 (8%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K F PFCS +C+ DL W +Y I +DE ++ Sbjct: 7 CPSCGKEVRWTPENRFRPFCSARCKQFDLGAWAAEKYRIGGTDDEAPSDD 56 >gi|322514589|ref|ZP_08067622.1| zinc-binding protein [Actinobacillus ureae ATCC 25976] gi|322119528|gb|EFX91615.1| zinc-binding protein [Actinobacillus ureae ATCC 25976] Length = 62 Score = 37.0 bits (84), Expect = 0.90, Method: Compositional matrix adjust. Identities = 18/45 (40%), Positives = 27/45 (60%), Gaps = 4/45 (8%) Query: 13 CPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDE 53 CP C + + ++ PFCS +C+ IDL W + E IAAVE++ Sbjct: 8 CPTCHQEVIWKPESKYRPFCSERCQLIDLGEWANEEKRIAAVEND 52 >gi|257464507|ref|ZP_05628878.1| putative zinc-binding protein [Actinobacillus minor 202] gi|257450167|gb|EEV24210.1| putative zinc-binding protein [Actinobacillus minor 202] Length = 61 Score = 37.0 bits (84), Expect = 0.92, Method: Compositional matrix adjust. Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 4/52 (7%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK 60 CP C K ++ PFCS +C+ IDL W E IA+VED+ E+++ Sbjct: 8 CPICSKPVSWNPSSKYRPFCSERCQLIDLGEWASEEKRIASVEDDVFSEDLE 59 >gi|116620690|ref|YP_822846.1| hypothetical protein Acid_1570 [Candidatus Solibacter usitatus Ellin6076] gi|116223852|gb|ABJ82561.1| protein of unknown function DUF329 [Candidatus Solibacter usitatus Ellin6076] Length = 63 Score = 37.0 bits (84), Expect = 0.92, Method: Compositional matrix adjust. Identities = 17/43 (39%), Positives = 23/43 (53%), Gaps = 3/43 (6%) Query: 13 CPECRKGSMV---EFYPFCSTQCRSIDLSRWLHGEYVIAAVED 52 CP C+K + +PFCS +CR IDL W +YV+ D Sbjct: 5 CPICKKVEVAVGDPEFPFCSERCRIIDLGNWATEKYVVPTPAD 47 >gi|307731059|ref|YP_003908283.1| hypothetical protein BC1003_3043 [Burkholderia sp. CCGE1003] gi|307585594|gb|ADN58992.1| protein of unknown function DUF329 [Burkholderia sp. CCGE1003] Length = 65 Score = 37.0 bits (84), Expect = 0.93, Method: Compositional matrix adjust. Identities = 18/51 (35%), Positives = 23/51 (45%), Gaps = 4/51 (7%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEV 59 CP C K F PFCS +C+ IDL W +Y I + E +E Sbjct: 7 CPTCGKDVRWTPESRFRPFCSERCKQIDLGAWAAEKYKIGGTDQEAPSDET 57 >gi|26987366|ref|NP_742791.1| zinc-binding protein [Pseudomonas putida KT2440] gi|31563247|sp|Q88Q66|Y630_PSEPK RecName: Full=UPF0243 zinc-binding protein PP_0630 gi|24982020|gb|AAN66255.1|AE016254_2 conserved hypothetical protein [Pseudomonas putida KT2440] Length = 66 Score = 37.0 bits (84), Expect = 0.93, Method: Compositional matrix adjust. Identities = 22/56 (39%), Positives = 29/56 (51%), Gaps = 8/56 (14%) Query: 7 RSLKSICPECRKGSMVE------FYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 + L CP C G+ VE F PFCS +C+ IDL W E+ IA E+ + E Sbjct: 3 QPLTVDCPTC--GAPVEWSEKNAFRPFCSDRCKLIDLGAWAAEEHKIAGSEESEDE 56 >gi|299771734|ref|YP_003733760.1| putative zinc-binding protein [Acinetobacter sp. DR1] gi|298701822|gb|ADI92387.1| putative zinc-binding protein [Acinetobacter sp. DR1] Length = 64 Score = 37.0 bits (84), Expect = 0.97, Method: Compositional matrix adjust. Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 3/40 (7%) Query: 13 CPECRKGSM---VEFYPFCSTQCRSIDLSRWLHGEYVIAA 49 CP C + S+ EF PFCS +C+ IDL W + EY + Sbjct: 7 CPRCGEPSVWEGNEFRPFCSERCKLIDLGAWANDEYRLPT 46 >gi|260596526|ref|YP_003209097.1| hypothetical protein CTU_07340 [Cronobacter turicensis z3032] gi|260215703|emb|CBA28052.1| UPF0243 zinc-binding protein ESA_03238 [Cronobacter turicensis z3032] Length = 66 Score = 37.0 bits (84), Expect = 0.97, Method: Compositional matrix adjust. Identities = 19/44 (43%), Positives = 21/44 (47%), Gaps = 4/44 (9%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVED 52 CP C K G F PFCS +CR IDL W E I + D Sbjct: 9 CPTCGKEVIWGEQSPFRPFCSNRCRLIDLGEWAAEEKRIPSSGD 52 >gi|253700565|ref|YP_003021754.1| hypothetical protein GM21_1943 [Geobacter sp. M21] gi|259646530|sp|C6E808|Y1943_GEOSM RecName: Full=UPF0243 zinc-binding protein GM21_1943 gi|251775415|gb|ACT17996.1| protein of unknown function DUF329 [Geobacter sp. M21] Length = 62 Score = 37.0 bits (84), Expect = 0.97, Method: Compositional matrix adjust. Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 4/53 (7%) Query: 13 CPECRKGSMV---EFYPFCSTQCRSIDLSRWLHGEYVIAAVE-DEKSEEEVKD 61 CP+CRK + + + PFCS +C+ IDL W Y I + E EE D Sbjct: 9 CPQCRKETTLAGNPYRPFCSQRCKMIDLGTWADEGYRIPGEKAPESGGEEPGD 61 >gi|167031692|ref|YP_001666923.1| zinc-binding protein [Pseudomonas putida GB-1] gi|3169572|gb|AAC17879.1| unknown [Pseudomonas putida GB-1] gi|166858180|gb|ABY96587.1| protein of unknown function DUF329 [Pseudomonas putida GB-1] Length = 66 Score = 37.0 bits (84), Expect = 0.99, Method: Compositional matrix adjust. Identities = 22/56 (39%), Positives = 29/56 (51%), Gaps = 8/56 (14%) Query: 7 RSLKSICPECRKGSMVE------FYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 + L CP C G+ VE F PFCS +C+ IDL W E+ IA E+ + E Sbjct: 3 QPLTVDCPTC--GAPVEWTEKSAFRPFCSDRCKLIDLGAWAAEEHKIAGSEESEDE 56 >gi|240949022|ref|ZP_04753376.1| putative zinc-binding protein [Actinobacillus minor NM305] gi|240296609|gb|EER47227.1| putative zinc-binding protein [Actinobacillus minor NM305] Length = 61 Score = 37.0 bits (84), Expect = 1.0, Method: Compositional matrix adjust. Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 4/52 (7%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK 60 CP C K ++ PFCS +C+ IDL W E IA+VED+ E+++ Sbjct: 8 CPICSKPVPWNPSSKYRPFCSERCQLIDLGEWASEEKRIASVEDDVFSEDLE 59 >gi|319789351|ref|YP_004150984.1| protein of unknown function DUF329 [Thermovibrio ammonificans HB-1] gi|317113853|gb|ADU96343.1| protein of unknown function DUF329 [Thermovibrio ammonificans HB-1] Length = 57 Score = 37.0 bits (84), Expect = 1.0, Method: Compositional matrix adjust. Identities = 19/40 (47%), Positives = 22/40 (55%), Gaps = 3/40 (7%) Query: 10 KSICPECRKGSMVE---FYPFCSTQCRSIDLSRWLHGEYV 46 K CP C K E F PFC QC+ DLS+WL+ EY Sbjct: 3 KVKCPNCGKEVEWENNPFRPFCCEQCKLADLSKWLNEEYA 42 >gi|187930143|ref|YP_001900630.1| hypothetical protein Rpic_3075 [Ralstonia pickettii 12J] gi|226703694|sp|B2UCW3|Y3075_RALPJ RecName: Full=UPF0243 zinc-binding protein Rpic_3075 gi|187727033|gb|ACD28198.1| protein of unknown function DUF329 [Ralstonia pickettii 12J] Length = 67 Score = 37.0 bits (84), Expect = 1.0, Method: Compositional matrix adjust. Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 4/45 (8%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDE 53 CP C K + PFCS +C+ IDL W +Y I VE++ Sbjct: 8 CPSCGKPVPWVPESRYRPFCSERCKQIDLGAWAAEQYTIPVVEED 52 >gi|269101769|ref|ZP_06154466.1| zinc-binding protein [Photobacterium damselae subsp. damselae CIP 102761] gi|268161667|gb|EEZ40163.1| zinc-binding protein [Photobacterium damselae subsp. damselae CIP 102761] Length = 69 Score = 36.6 bits (83), Expect = 1.1, Method: Compositional matrix adjust. Identities = 17/44 (38%), Positives = 21/44 (47%), Gaps = 4/44 (9%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVED 52 CP C++ G F PFCS +C+ IDL W E I D Sbjct: 14 CPTCKEDVVWGEQSPFRPFCSKRCQLIDLGEWADEEKAIPGAPD 57 >gi|293610181|ref|ZP_06692482.1| conserved hypothetical protein [Acinetobacter sp. SH024] gi|292827413|gb|EFF85777.1| conserved hypothetical protein [Acinetobacter sp. SH024] gi|325124356|gb|ADY83879.1| putative zinc-binding protein [Acinetobacter calcoaceticus PHEA-2] Length = 64 Score = 36.6 bits (83), Expect = 1.1, Method: Compositional matrix adjust. Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 3/40 (7%) Query: 13 CPECRKGSM---VEFYPFCSTQCRSIDLSRWLHGEYVIAA 49 CP C + S+ EF PFCS +C+ IDL W + EY + Sbjct: 7 CPRCGEPSVWEGNEFRPFCSERCKLIDLGAWANDEYRLPT 46 >gi|126665145|ref|ZP_01736128.1| zinc-binding protein [Marinobacter sp. ELB17] gi|126630515|gb|EBA01130.1| zinc-binding protein [Marinobacter sp. ELB17] Length = 65 Score = 36.6 bits (83), Expect = 1.2, Method: Compositional matrix adjust. Identities = 19/43 (44%), Positives = 24/43 (55%), Gaps = 8/43 (18%) Query: 13 CPECRKGSMVEFY------PFCSTQCRSIDLSRWLHGEYVIAA 49 CP CRK VE+ PFCS +C+ IDL W + EY + A Sbjct: 5 CPTCRKA--VEWTDANPERPFCSHRCKLIDLGAWANEEYRVPA 45 >gi|254672311|emb|CBA05432.1| conserved hypothetical protein [Neisseria meningitidis alpha275] gi|325143044|gb|EGC65395.1| zinc-binding protein YacG [Neisseria meningitidis 961-5945] gi|325198980|gb|ADY94436.1| zinc-binding protein YacG [Neisseria meningitidis G2136] Length = 69 Score = 36.6 bits (83), Expect = 1.2, Method: Compositional matrix adjust. Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 4/44 (9%) Query: 9 LKSICPECRKGSMVE----FYPFCSTQCRSIDLSRWLHGEYVIA 48 L+ CP C+ + + F PFCS +C+ IDL W G+Y ++ Sbjct: 9 LQVKCPTCQTTVVWKPENAFRPFCSQRCKLIDLGGWADGKYTVS 52 >gi|92114300|ref|YP_574228.1| hypothetical protein Csal_2178 [Chromohalobacter salexigens DSM 3043] gi|91797390|gb|ABE59529.1| protein of unknown function DUF329 [Chromohalobacter salexigens DSM 3043] Length = 76 Score = 36.6 bits (83), Expect = 1.2, Method: Compositional matrix adjust. Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 4/51 (7%) Query: 3 TSDFRSLKSICPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAA 49 T R L+ CP+CR + + PFCS +CR +DL W + IA Sbjct: 4 TPQDRPLEVACPQCRTKVAWTTENPYRPFCSKRCRLLDLGAWADESHRIAG 54 >gi|325518040|gb|EGC97845.1| hypothetical protein B1M_44614 [Burkholderia sp. TJI49] Length = 65 Score = 36.6 bits (83), Expect = 1.2, Method: Compositional matrix adjust. Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 4/50 (8%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K +F PFCS +C+ +DL W +Y I +D +E Sbjct: 7 CPSCGKPVRWTPENQFRPFCSARCKQLDLGAWAAEKYRIGGSDDAPLSDE 56 >gi|325983257|ref|YP_004295659.1| Uncharacterized zinc-binding family protein [Nitrosomonas sp. AL212] gi|325532776|gb|ADZ27497.1| Uncharacterized zinc-binding family protein [Nitrosomonas sp. AL212] Length = 58 Score = 36.6 bits (83), Expect = 1.3, Method: Compositional matrix adjust. Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 4/52 (7%) Query: 10 KSICPECRKGSMVE----FYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 K CP+C + + E F PFCS +C++ DLS+W Y I + + E+ Sbjct: 5 KVNCPQCGEKVIWEAASRFRPFCSERCKTADLSQWAQESYRIPEPANTREEK 56 >gi|288575344|ref|ZP_05976763.2| conserved domain protein [Neisseria mucosa ATCC 25996] gi|288567875|gb|EFC89435.1| conserved domain protein [Neisseria mucosa ATCC 25996] Length = 49 Score = 36.6 bits (83), Expect = 1.3, Method: Compositional matrix adjust. Identities = 14/31 (45%), Positives = 20/31 (64%) Query: 23 EFYPFCSTQCRSIDLSRWLHGEYVIAAVEDE 53 ++ PFCS +CR IDL W +Y + A ED+ Sbjct: 8 KYRPFCSQRCRLIDLGEWAQEKYTVEAEEDD 38 >gi|262280806|ref|ZP_06058589.1| conserved hypothetical protein [Acinetobacter calcoaceticus RUH2202] gi|262257706|gb|EEY76441.1| conserved hypothetical protein [Acinetobacter calcoaceticus RUH2202] Length = 64 Score = 36.6 bits (83), Expect = 1.3, Method: Compositional matrix adjust. Identities = 17/40 (42%), Positives = 22/40 (55%), Gaps = 3/40 (7%) Query: 13 CPECRKGSM---VEFYPFCSTQCRSIDLSRWLHGEYVIAA 49 CP C S+ EF PFCS +C+ IDL W + EY + Sbjct: 7 CPRCGGPSVWEGNEFRPFCSERCKLIDLGAWANDEYKLPT 46 >gi|34499278|ref|NP_903493.1| hypothetical protein CV_3823 [Chromobacterium violaceum ATCC 12472] gi|47117442|sp|Q7NRF8|Y3823_CHRVO RecName: Full=UPF0243 zinc-binding protein CV_3823 gi|34105129|gb|AAQ61485.1| conserved hypothetical protein [Chromobacterium violaceum ATCC 12472] Length = 63 Score = 36.6 bits (83), Expect = 1.3, Method: Compositional matrix adjust. Identities = 19/49 (38%), Positives = 23/49 (46%), Gaps = 4/49 (8%) Query: 13 CPEC----RKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP C R + PFCS +CR IDL +W Y + A ED E Sbjct: 10 CPTCKAEVRWEPQSRYRPFCSERCRLIDLGQWASESYRVPAEEDHPPGE 58 >gi|120612329|ref|YP_972007.1| hypothetical protein Aave_3685 [Acidovorax citrulli AAC00-1] gi|120590793|gb|ABM34233.1| protein of unknown function DUF329 [Acidovorax citrulli AAC00-1] Length = 84 Score = 36.6 bits (83), Expect = 1.3, Method: Compositional matrix adjust. Identities = 19/47 (40%), Positives = 24/47 (51%), Gaps = 4/47 (8%) Query: 7 RSLKSICPECRKGSMV----EFYPFCSTQCRSIDLSRWLHGEYVIAA 49 R L CP C S+ F PFCS +CR IDL W ++ +AA Sbjct: 19 RQLWVDCPTCGGRSLYAHENRFRPFCSERCRQIDLGAWAAEDFRMAA 65 >gi|294635020|ref|ZP_06713537.1| conserved domain protein [Edwardsiella tarda ATCC 23685] gi|291091619|gb|EFE24180.1| conserved domain protein [Edwardsiella tarda ATCC 23685] Length = 66 Score = 36.2 bits (82), Expect = 1.4, Method: Compositional matrix adjust. Identities = 22/50 (44%), Positives = 27/50 (54%), Gaps = 5/50 (10%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K G F PFCS +C+ IDL W + E IA+ E E S+ E Sbjct: 10 CPTCGKPVIWGEQSPFRPFCSKRCQLIDLGEWANEEKRIAS-EAEHSDSE 58 >gi|253995888|ref|YP_003047952.1| hypothetical protein Mmol_0515 [Methylotenera mobilis JLW8] gi|253982567|gb|ACT47425.1| protein of unknown function DUF329 [Methylotenera mobilis JLW8] Length = 63 Score = 36.2 bits (82), Expect = 1.4, Method: Compositional matrix adjust. Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 9/54 (16%) Query: 13 CPECRKGSMVEF------YPFCSTQCRSIDLSRWLHGEYVI-AAVEDEKSEEEV 59 CP C+ ++VEF PFCS +C IDL W + +Y I A +D+ +E+ Sbjct: 10 CPTCK--NLVEFSPLNSYRPFCSKRCEMIDLGAWANEDYAIPTATKDDDLPDEL 61 >gi|167586036|ref|ZP_02378424.1| hypothetical protein BuboB_11902 [Burkholderia ubonensis Bu] Length = 66 Score = 36.2 bits (82), Expect = 1.4, Method: Compositional matrix adjust. Identities = 18/50 (36%), Positives = 23/50 (46%), Gaps = 4/50 (8%) Query: 13 CPEC----RKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C R F PFCS +C+ +DL W +Y I +D EE Sbjct: 7 CPSCGAEVRWTPENRFRPFCSARCKQLDLGAWAAEKYRIGGSDDSPLSEE 56 >gi|53803866|ref|YP_114520.1| hypothetical protein MCA2090 [Methylococcus capsulatus str. Bath] gi|67462034|sp|Q606C8|Y2090_METCA RecName: Full=UPF0243 zinc-binding protein MCA2090 gi|53757627|gb|AAU91918.1| conserved hypothetical protein [Methylococcus capsulatus str. Bath] Length = 73 Score = 36.2 bits (82), Expect = 1.4, Method: Compositional matrix adjust. Identities = 18/48 (37%), Positives = 23/48 (47%), Gaps = 4/48 (8%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 CP C K F PFCS +CR IDL W + +Y I + +E Sbjct: 12 CPRCGKPVPWNETQRFRPFCSERCRLIDLGSWANEDYAIPGEPIDPAE 59 >gi|148545921|ref|YP_001266023.1| zinc-binding protein [Pseudomonas putida F1] gi|167016751|sp|A5VY79|Y671_PSEP1 RecName: Full=UPF0243 zinc-binding protein Pput_0671 gi|148509979|gb|ABQ76839.1| protein of unknown function DUF329 [Pseudomonas putida F1] Length = 66 Score = 36.2 bits (82), Expect = 1.4, Method: Compositional matrix adjust. Identities = 23/62 (37%), Positives = 30/62 (48%), Gaps = 8/62 (12%) Query: 7 RSLKSICPECRKGSMVE------FYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK 60 + L CP C G+ VE F PFCS +C+ IDL W E+ IA E + E Sbjct: 3 QPLTVDCPTC--GAPVEWSEKNAFRPFCSDRCKLIDLGAWAAEEHKIAGSEGSEDELYSG 60 Query: 61 DI 62 D+ Sbjct: 61 DL 62 >gi|262273804|ref|ZP_06051617.1| zinc-binding protein [Grimontia hollisae CIP 101886] gi|262222219|gb|EEY73531.1| zinc-binding protein [Grimontia hollisae CIP 101886] Length = 73 Score = 36.2 bits (82), Expect = 1.4, Method: Compositional matrix adjust. Identities = 18/44 (40%), Positives = 23/44 (52%), Gaps = 4/44 (9%) Query: 13 CPECR----KGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVED 52 CP+C G + F PFCS +C+ IDL W E IA+ D Sbjct: 19 CPQCGLPVVWGDVSPFRPFCSKKCQLIDLGEWADEEKRIASAPD 62 >gi|261379324|ref|ZP_05983897.1| conserved domain protein [Neisseria subflava NJ9703] gi|284797761|gb|EFC53108.1| conserved domain protein [Neisseria subflava NJ9703] Length = 60 Score = 36.2 bits (82), Expect = 1.4, Method: Compositional matrix adjust. Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 4/48 (8%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 CP C K + + PFCS +C+ IDL W +Y +++ +D S+ Sbjct: 8 CPTCHKKVVWNTDSPYRPFCSKRCKLIDLGEWAQEKYTVSSEDDPFSD 55 >gi|161525992|ref|YP_001581004.1| hypothetical protein Bmul_2823 [Burkholderia multivorans ATCC 17616] gi|189349291|ref|YP_001944919.1| hypothetical protein BMULJ_00415 [Burkholderia multivorans ATCC 17616] gi|221202529|ref|ZP_03575559.1| conserved hypothetical protein [Burkholderia multivorans CGD2M] gi|221208149|ref|ZP_03581154.1| conserved hypothetical protein [Burkholderia multivorans CGD2] gi|221213263|ref|ZP_03586238.1| conserved hypothetical protein [Burkholderia multivorans CGD1] gi|160343421|gb|ABX16507.1| protein of unknown function DUF329 [Burkholderia multivorans ATCC 17616] gi|189333313|dbj|BAG42383.1| conserved hypothetical protein [Burkholderia multivorans ATCC 17616] gi|221166715|gb|EED99186.1| conserved hypothetical protein [Burkholderia multivorans CGD1] gi|221172052|gb|EEE04494.1| conserved hypothetical protein [Burkholderia multivorans CGD2] gi|221177624|gb|EEE10041.1| conserved hypothetical protein [Burkholderia multivorans CGD2M] Length = 65 Score = 36.2 bits (82), Expect = 1.5, Method: Compositional matrix adjust. Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 4/50 (8%) Query: 13 CPEC----RKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C R +F PFCS +C+ +DL W +Y I +D +E Sbjct: 7 CPSCGVAVRWTPENQFRPFCSARCKQLDLGAWASEKYRIGGSDDAPLSDE 56 >gi|90411984|ref|ZP_01219991.1| zinc-binding protein [Photobacterium profundum 3TCK] gi|90326962|gb|EAS43341.1| zinc-binding protein [Photobacterium profundum 3TCK] Length = 71 Score = 36.2 bits (82), Expect = 1.5, Method: Compositional matrix adjust. Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 6/58 (10%) Query: 1 MQTSDFRSLKSI--CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVED 52 M S+ + +I CP C+K G + PFC+ +C+ IDL W E I D Sbjct: 1 MSQSNTPTTPTIVKCPTCKKEVEWGEQSPYRPFCTKRCQLIDLGEWAEEEKSIPGAPD 58 >gi|330815456|ref|YP_004359161.1| hypothetical protein bgla_1g05120 [Burkholderia gladioli BSR3] gi|327367849|gb|AEA59205.1| hypothetical protein bgla_1g05120 [Burkholderia gladioli BSR3] Length = 66 Score = 36.2 bits (82), Expect = 1.5, Method: Compositional matrix adjust. Identities = 18/54 (33%), Positives = 25/54 (46%), Gaps = 4/54 (7%) Query: 8 SLKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 +L CP C K F PFCS +C+ +DL W Y I ++E S + Sbjct: 2 TLAVKCPACGKQVRWVPENTFRPFCSARCKQMDLGAWAAERYRIGGTDEEPSSD 55 >gi|270263970|ref|ZP_06192238.1| hypothetical protein SOD_f01840 [Serratia odorifera 4Rx13] gi|270042163|gb|EFA15259.1| hypothetical protein SOD_f01840 [Serratia odorifera 4Rx13] Length = 63 Score = 36.2 bits (82), Expect = 1.5, Method: Compositional matrix adjust. Identities = 20/50 (40%), Positives = 24/50 (48%), Gaps = 4/50 (8%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C KG + F PFCS +C+ IDL W E I + D EE Sbjct: 7 CPTCGKGVVWGEVSPFRPFCSKRCQLIDLGEWADEEKRIPSNSDLSESEE 56 >gi|226951889|ref|ZP_03822353.1| zinc-binding protein [Acinetobacter sp. ATCC 27244] gi|294649146|ref|ZP_06726587.1| zinc-binding protein [Acinetobacter haemolyticus ATCC 19194] gi|226837429|gb|EEH69812.1| zinc-binding protein [Acinetobacter sp. ATCC 27244] gi|292824944|gb|EFF83706.1| zinc-binding protein [Acinetobacter haemolyticus ATCC 19194] Length = 63 Score = 36.2 bits (82), Expect = 1.5, Method: Compositional matrix adjust. Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 3/47 (6%) Query: 13 CPECRKGSM---VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 CP C + S EF PFCS +C+ IDL W EY + + +++ Sbjct: 7 CPRCGENSTWEGNEFRPFCSERCKLIDLGAWASDEYKLPTQDAPQAD 53 >gi|32490941|ref|NP_871195.1| hypothetical protein WGLp192 [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] gi|31563249|sp|Q8D309|Y192_WIGBR RecName: Full=UPF0243 zinc-binding protein WIGBR1920 gi|25166147|dbj|BAC24338.1| yacG [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] Length = 48 Score = 36.2 bits (82), Expect = 1.5, Method: Compositional matrix adjust. Identities = 12/22 (54%), Positives = 18/22 (81%) Query: 24 FYPFCSTQCRSIDLSRWLHGEY 45 F+PFCS +C+ IDL +W+ G+Y Sbjct: 24 FFPFCSKKCKIIDLYQWISGKY 45 >gi|209696043|ref|YP_002263973.1| zinc-binding protein [Aliivibrio salmonicida LFI1238] gi|226701467|sp|B6ELG6|Y2635_ALISL RecName: Full=UPF0243 zinc-binding protein VSAL_I2635 gi|208009996|emb|CAQ80319.1| zinc-binding protein [Aliivibrio salmonicida LFI1238] Length = 69 Score = 36.2 bits (82), Expect = 1.6, Method: Compositional matrix adjust. Identities = 17/44 (38%), Positives = 21/44 (47%), Gaps = 4/44 (9%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVED 52 CP C+ + EF PFCS +C+ ID W E IA D Sbjct: 14 CPTCQNKVVWNTESEFRPFCSKKCQMIDFGEWADEEKSIAGAPD 57 >gi|326570838|gb|EGE20862.1| hypothetical protein E9S_03857 [Moraxella catarrhalis BC7] Length = 61 Score = 36.2 bits (82), Expect = 1.6, Method: Compositional matrix adjust. Identities = 19/37 (51%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Query: 26 PFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE-EEVKD 61 PFCS +C+ IDL W EY+IA E SE EV D Sbjct: 24 PFCSKRCKLIDLGAWASDEYLIAGDELPSSEHHEVTD 60 >gi|225077386|ref|ZP_03720585.1| hypothetical protein NEIFLAOT_02447 [Neisseria flavescens NRL30031/H210] gi|241760234|ref|ZP_04758330.1| conserved hypothetical protein [Neisseria flavescens SK114] gi|319639055|ref|ZP_07993812.1| hypothetical protein HMPREF0604_01436 [Neisseria mucosa C102] gi|224951270|gb|EEG32479.1| hypothetical protein NEIFLAOT_02447 [Neisseria flavescens NRL30031/H210] gi|241319345|gb|EER55810.1| conserved hypothetical protein [Neisseria flavescens SK114] gi|317399633|gb|EFV80297.1| hypothetical protein HMPREF0604_01436 [Neisseria mucosa C102] Length = 60 Score = 36.2 bits (82), Expect = 1.6, Method: Compositional matrix adjust. Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 4/48 (8%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 CP C K + + PFCS +C+ IDL W +Y +++ +D S+ Sbjct: 8 CPTCHKEVVWNTDSPYRPFCSKRCKLIDLGEWAQEKYTVSSEDDPFSD 55 >gi|291615158|ref|YP_003525315.1| hypothetical protein Slit_2703 [Sideroxydans lithotrophicus ES-1] gi|291585270|gb|ADE12928.1| protein of unknown function DUF329 [Sideroxydans lithotrophicus ES-1] Length = 61 Score = 36.2 bits (82), Expect = 1.7, Method: Compositional matrix adjust. Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 4/46 (8%) Query: 12 ICPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDE 53 CP C K + F PFCS +C+ IDL +W + EY + E + Sbjct: 8 TCPNCGKEMVWDTSNRFRPFCSERCKLIDLGKWANEEYRVEQREQD 53 >gi|163803449|ref|ZP_02197322.1| zinc-binding protein [Vibrio sp. AND4] gi|159172750|gb|EDP57598.1| zinc-binding protein [Vibrio sp. AND4] Length = 64 Score = 36.2 bits (82), Expect = 1.7, Method: Compositional matrix adjust. Identities = 16/44 (36%), Positives = 20/44 (45%), Gaps = 4/44 (9%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVED 52 CP+C G + PFCS QC+ ID W + IA D Sbjct: 9 CPQCGADVEWGEQSPYRPFCSKQCQMIDFGEWADEDNAIAGAPD 52 >gi|303258224|ref|ZP_07344231.1| conserved domain protein [Burkholderiales bacterium 1_1_47] gi|302858977|gb|EFL82061.1| conserved domain protein [Burkholderiales bacterium 1_1_47] Length = 83 Score = 36.2 bits (82), Expect = 1.7, Method: Compositional matrix adjust. Identities = 19/51 (37%), Positives = 24/51 (47%), Gaps = 4/51 (7%) Query: 1 MQTSDFRSLKSICP----ECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVI 47 MQ ++K CP EC + PFC +CR IDL W G+Y I Sbjct: 1 MQYVVKMAIKVKCPTCGRECEYSDKNPYRPFCCERCRLIDLGAWAEGKYSI 51 >gi|157369017|ref|YP_001477006.1| hypothetical protein Spro_0772 [Serratia proteamaculans 568] gi|157320781|gb|ABV39878.1| protein of unknown function DUF329 [Serratia proteamaculans 568] Length = 67 Score = 36.2 bits (82), Expect = 1.7, Method: Compositional matrix adjust. Identities = 20/50 (40%), Positives = 24/50 (48%), Gaps = 4/50 (8%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C KG + F PFCS +C+ IDL W E I + D EE Sbjct: 7 CPTCGKGVVWGEVSPFRPFCSKRCQLIDLGEWADEEKRIPSNSDLSESEE 56 >gi|331001060|ref|ZP_08324691.1| hypothetical protein HMPREF9439_02346 [Parasutterella excrementihominis YIT 11859] gi|329569365|gb|EGG51143.1| hypothetical protein HMPREF9439_02346 [Parasutterella excrementihominis YIT 11859] Length = 83 Score = 36.2 bits (82), Expect = 1.8, Method: Compositional matrix adjust. Identities = 19/51 (37%), Positives = 24/51 (47%), Gaps = 4/51 (7%) Query: 1 MQTSDFRSLKSICP----ECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVI 47 MQ ++K CP EC + PFC +CR IDL W G+Y I Sbjct: 1 MQYVVKMAIKVKCPTCGRECEYSDKNPYRPFCCERCRLIDLGAWAEGKYSI 51 >gi|170723701|ref|YP_001751389.1| zinc-binding protein [Pseudomonas putida W619] gi|226706203|sp|B1JF64|Y4540_PSEPW RecName: Full=UPF0243 zinc-binding protein PputW619_4540 gi|169761704|gb|ACA75020.1| protein of unknown function DUF329 [Pseudomonas putida W619] Length = 66 Score = 36.2 bits (82), Expect = 1.8, Method: Compositional matrix adjust. Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 8/56 (14%) Query: 7 RSLKSICPECRKGSMVE------FYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 + L CP C G+ VE F PFCS +C+ IDL W E+ IA ++ + E Sbjct: 3 QPLTVDCPTC--GAPVEWDAKNAFRPFCSDRCKLIDLGAWAAEEHKIAGSQESEDE 56 >gi|222056004|ref|YP_002538366.1| protein of unknown function DUF329 [Geobacter sp. FRC-32] gi|254801586|sp|B9M2R9|Y2922_GEOSF RecName: Full=UPF0243 zinc-binding protein Geob_2922 gi|221565293|gb|ACM21265.1| protein of unknown function DUF329 [Geobacter sp. FRC-32] Length = 59 Score = 35.8 bits (81), Expect = 1.8, Method: Compositional matrix adjust. Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 4/55 (7%) Query: 7 RSLKSICPECRKGSMVE---FYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 ++ K CP C+K + PFCS +C+ IDL W Y I E + SE+E Sbjct: 3 KTAKHFCPHCQKEVSWQDNPHRPFCSERCKMIDLGSWFSENYKIPG-EKKPSEDE 56 >gi|332526515|ref|ZP_08402627.1| hypothetical protein RBXJA2T_11563 [Rubrivivax benzoatilyticus JA2] gi|332110783|gb|EGJ10960.1| hypothetical protein RBXJA2T_11563 [Rubrivivax benzoatilyticus JA2] Length = 66 Score = 35.8 bits (81), Expect = 1.9, Method: Compositional matrix adjust. Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 4/52 (7%) Query: 13 CPECRKGSMV----EFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK 60 CP C+ + + PFCS +CRS+DL W Y +AA + E+ Sbjct: 9 CPACKTPTPYSPQNRWRPFCSERCRSLDLGAWASESYRVAAEAPPDAGEDTP 60 >gi|91203325|emb|CAJ72964.1| conserved hypothetical protein [Candidatus Kuenenia stuttgartiensis] Length = 67 Score = 35.8 bits (81), Expect = 1.9, Method: Compositional matrix adjust. Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 6/42 (14%) Query: 13 CPECRKGSMVE------FYPFCSTQCRSIDLSRWLHGEYVIA 48 CP CRK + ++PFCS +C+ +D WL Y I Sbjct: 6 CPNCRKILFYQVIKDLPYFPFCSNRCKLVDFGAWLDESYCIG 47 >gi|84394294|ref|ZP_00993019.1| zinc-binding protein [Vibrio splendidus 12B01] gi|84375097|gb|EAP92019.1| zinc-binding protein [Vibrio splendidus 12B01] Length = 65 Score = 35.8 bits (81), Expect = 1.9, Method: Compositional matrix adjust. Identities = 17/44 (38%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVED 52 CP+C G PFCS QC+ ID W E IA D Sbjct: 10 CPQCNADVEWGEQSPHRPFCSKQCQMIDFGEWADEENSIAGAPD 53 >gi|323527417|ref|YP_004229570.1| hypothetical protein BC1001_3096 [Burkholderia sp. CCGE1001] gi|323384419|gb|ADX56510.1| protein of unknown function DUF329 [Burkholderia sp. CCGE1001] Length = 65 Score = 35.8 bits (81), Expect = 1.9, Method: Compositional matrix adjust. Identities = 17/51 (33%), Positives = 23/51 (45%), Gaps = 4/51 (7%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEV 59 CP C K F PFCS +C+ IDL W +Y I + + +E Sbjct: 7 CPTCGKDVRWTPENRFRPFCSERCKQIDLGAWATEKYKIGGTDQDAPSDET 57 >gi|153004844|ref|YP_001379169.1| hypothetical protein Anae109_1982 [Anaeromyxobacter sp. Fw109-5] gi|152028417|gb|ABS26185.1| protein of unknown function DUF329 [Anaeromyxobacter sp. Fw109-5] Length = 66 Score = 35.8 bits (81), Expect = 1.9, Method: Compositional matrix adjust. Identities = 14/33 (42%), Positives = 18/33 (54%) Query: 25 YPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 +PFCS +CR +DL +WL EY I E Sbjct: 21 FPFCSPRCRLLDLGKWLGEEYRIPGPRPGDGAE 53 >gi|113460605|ref|YP_718670.1| hypothetical protein HS_0460 [Haemophilus somnus 129PT] gi|170718927|ref|YP_001784096.1| hypothetical protein HSM_0758 [Haemophilus somnus 2336] gi|112822648|gb|ABI24737.1| conserved hypothetical protein [Haemophilus somnus 129PT] gi|168827056|gb|ACA32427.1| protein of unknown function DUF329 [Haemophilus somnus 2336] Length = 64 Score = 35.8 bits (81), Expect = 1.9, Method: Compositional matrix adjust. Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 4/43 (9%) Query: 13 CPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVE 51 CP C+K + F PFCS +C+ IDL W E +I E Sbjct: 10 CPNCKKEVLWSEENRFRPFCSKRCQLIDLGEWATEEKIIPGSE 52 >gi|148979238|ref|ZP_01815392.1| zinc-binding protein [Vibrionales bacterium SWAT-3] gi|145961886|gb|EDK27177.1| zinc-binding protein [Vibrionales bacterium SWAT-3] Length = 65 Score = 35.8 bits (81), Expect = 2.0, Method: Compositional matrix adjust. Identities = 17/44 (38%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVED 52 CP+C G PFCS QC+ ID W E IA D Sbjct: 10 CPQCNTDVEWGEQSPHRPFCSKQCQMIDFGEWADEENSIAGAPD 53 >gi|77461045|ref|YP_350552.1| zinc-binding protein [Pseudomonas fluorescens Pf0-1] gi|123603250|sp|Q3K6P3|Y4824_PSEPF RecName: Full=UPF0243 zinc-binding protein Pfl01_4824 gi|77385048|gb|ABA76561.1| conserved hypothetical protein [Pseudomonas fluorescens Pf0-1] Length = 66 Score = 35.8 bits (81), Expect = 2.0, Method: Compositional matrix adjust. Identities = 20/50 (40%), Positives = 25/50 (50%), Gaps = 8/50 (16%) Query: 13 CPECRKGSMVEFYP------FCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 CP C G+ VEF P FCS +C+ IDL W E+ I D + E Sbjct: 9 CPTC--GAPVEFTPENKYRPFCSDRCKLIDLGAWASEEHKIPVAPDAEDE 56 >gi|168264012|ref|ZP_02685985.1| conserved domain protein [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] gi|205347516|gb|EDZ34147.1| conserved domain protein [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] Length = 63 Score = 35.8 bits (81), Expect = 2.1, Method: Compositional matrix adjust. Identities = 18/41 (43%), Positives = 22/41 (53%), Gaps = 4/41 (9%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAA 49 CP C K G + F PFCS +C+ IDL W E IA+ Sbjct: 9 CPTCGKPVVWGEISPFRPFCSKRCQLIDLGEWAAEEKRIAS 49 >gi|254786986|ref|YP_003074415.1| hypothetical protein TERTU_3039 [Teredinibacter turnerae T7901] gi|237686679|gb|ACR13943.1| conserved hypothetical protein [Teredinibacter turnerae T7901] Length = 66 Score = 35.8 bits (81), Expect = 2.2, Method: Compositional matrix adjust. Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 4/46 (8%) Query: 6 FRSLKSICPECRKGSMVE----FYPFCSTQCRSIDLSRWLHGEYVI 47 F++L CP C K ++ + PFCS +C++ID W + VI Sbjct: 3 FKTLAVKCPTCDKQVLMTDDFPYRPFCSDRCKTIDFGGWAAEKNVI 48 >gi|124514348|gb|EAY55861.1| hypothetical protein UBAL2_86920016 [Leptospirillum rubarum] Length = 73 Score = 35.8 bits (81), Expect = 2.2, Method: Compositional matrix adjust. Identities = 14/21 (66%), Positives = 17/21 (80%) Query: 27 FCSTQCRSIDLSRWLHGEYVI 47 FCS +CR IDL+RWL+ EY I Sbjct: 26 FCSQRCRKIDLARWLNEEYRI 46 >gi|54310294|ref|YP_131314.1| zinc-binding protein [Photobacterium profundum SS9] gi|67462044|sp|Q6LMG5|Y3206_PHOPR RecName: Full=UPF0243 zinc-binding protein PBPRA3206 gi|46914735|emb|CAG21512.1| conserved hypothetical protein [Photobacterium profundum SS9] Length = 76 Score = 35.8 bits (81), Expect = 2.2, Method: Compositional matrix adjust. Identities = 16/44 (36%), Positives = 21/44 (47%), Gaps = 4/44 (9%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVED 52 CP C+K G + PFC+ +C+ IDL W E I D Sbjct: 20 CPTCKKEVEWGEQSPYRPFCTKRCQLIDLGEWAEEEKSIPGAPD 63 >gi|156975739|ref|YP_001446646.1| zinc-binding protein [Vibrio harveyi ATCC BAA-1116] gi|156527333|gb|ABU72419.1| hypothetical protein VIBHAR_03474 [Vibrio harveyi ATCC BAA-1116] Length = 66 Score = 35.8 bits (81), Expect = 2.3, Method: Compositional matrix adjust. Identities = 17/44 (38%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVED 52 CP+C G PFCS QC+ ID W E IA D Sbjct: 11 CPQCGADVEWGEQSPHRPFCSKQCQMIDFGEWADEENTIAGAPD 54 >gi|88811826|ref|ZP_01127079.1| Hypothetical UPF0243 zinc-binding protein-related protein [Nitrococcus mobilis Nb-231] gi|88790710|gb|EAR21824.1| Hypothetical UPF0243 zinc-binding protein-related protein [Nitrococcus mobilis Nb-231] Length = 65 Score = 35.8 bits (81), Expect = 2.3, Method: Compositional matrix adjust. Identities = 19/54 (35%), Positives = 25/54 (46%), Gaps = 5/54 (9%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVE-DEKSEEEVKD 61 CP C + + PFCS +C+ IDL WL G + I E D +S D Sbjct: 5 CPTCNRPVEWSQHSPYRPFCSRRCKLIDLGAWLDGSHRIPGSELDGESSSTAGD 58 >gi|118595235|ref|ZP_01552582.1| Uncharacterized zinc finger protein [Methylophilales bacterium HTCC2181] gi|118441013|gb|EAV47640.1| Uncharacterized zinc finger protein [Methylophilales bacterium HTCC2181] Length = 55 Score = 35.4 bits (80), Expect = 2.3, Method: Compositional matrix adjust. Identities = 20/52 (38%), Positives = 26/52 (50%), Gaps = 8/52 (15%) Query: 13 CPECRKGSMVEFY------PFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C+K +E+ PFCS +C+ IDL W EY I DE + E Sbjct: 5 CPTCKK--KIEYSLSNLSRPFCSEKCKLIDLGAWASEEYHIPGDNDEINYNE 54 >gi|307252502|ref|ZP_07534398.1| hypothetical protein appser6_10190 [Actinobacillus pleuropneumoniae serovar 6 str. Femo] gi|306860094|gb|EFM92111.1| hypothetical protein appser6_10190 [Actinobacillus pleuropneumoniae serovar 6 str. Femo] Length = 48 Score = 35.4 bits (80), Expect = 2.4, Method: Compositional matrix adjust. Identities = 15/31 (48%), Positives = 22/31 (70%) Query: 23 EFYPFCSTQCRSIDLSRWLHGEYVIAAVEDE 53 ++ PFCS +C+ IDL W + E IAAVE++ Sbjct: 8 KYRPFCSERCQLIDLGEWANEEKRIAAVEND 38 >gi|218710515|ref|YP_002418136.1| zinc-binding protein [Vibrio splendidus LGP32] gi|218323534|emb|CAV19729.1| conserved hypothetical protein [Vibrio splendidus LGP32] Length = 65 Score = 35.4 bits (80), Expect = 2.5, Method: Compositional matrix adjust. Identities = 17/44 (38%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVED 52 CP+C G PFCS QC+ ID W E IA D Sbjct: 10 CPQCNTDVEWGEQSPHRPFCSKQCQIIDFGEWADEENSIAGAPD 53 >gi|194290799|ref|YP_002006706.1| hypothetical protein RALTA_A2715 [Cupriavidus taiwanensis LMG 19424] gi|193224634|emb|CAQ70645.1| conserved hypothetical protein, DUF329 [Cupriavidus taiwanensis LMG 19424] Length = 62 Score = 35.4 bits (80), Expect = 2.6, Method: Compositional matrix adjust. Identities = 15/39 (38%), Positives = 19/39 (48%) Query: 23 EFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 +F PFCS +C+ IDL W +YVI E D Sbjct: 21 KFRPFCSERCKQIDLGAWASEKYVIGGKPGESPAGPPDD 59 >gi|206602769|gb|EDZ39250.1| Hypothetical protein CGL2_11212101 [Leptospirillum sp. Group II '5-way CG'] Length = 67 Score = 35.4 bits (80), Expect = 2.7, Method: Compositional matrix adjust. Identities = 14/21 (66%), Positives = 17/21 (80%) Query: 27 FCSTQCRSIDLSRWLHGEYVI 47 FCS +CR IDL+RWL+ EY I Sbjct: 26 FCSQRCRKIDLARWLNEEYRI 46 >gi|120555599|ref|YP_959950.1| hypothetical protein Maqu_2688 [Marinobacter aquaeolei VT8] gi|120325448|gb|ABM19763.1| protein of unknown function DUF329 [Marinobacter aquaeolei VT8] Length = 62 Score = 35.4 bits (80), Expect = 2.7, Method: Compositional matrix adjust. Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 4/41 (9%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAA 49 CP C+K + PFCS +C+ IDL W + EY + A Sbjct: 5 CPTCKKSVEWSETNPWRPFCSERCKLIDLGAWANEEYRVPA 45 >gi|206578507|ref|YP_002240428.1| zinc-binding protein YacG [Klebsiella pneumoniae 342] gi|288937128|ref|YP_003441187.1| hypothetical protein Kvar_4278 [Klebsiella variicola At-22] gi|290512551|ref|ZP_06551917.1| zinc-binding protein [Klebsiella sp. 1_1_55] gi|226706233|sp|B5Y1T7|Y4637_KLEP3 RecName: Full=UPF0243 zinc-binding protein KPK_4637 gi|206567565|gb|ACI09341.1| zinc-binding protein YacG [Klebsiella pneumoniae 342] gi|288891837|gb|ADC60155.1| protein of unknown function DUF329 [Klebsiella variicola At-22] gi|289774892|gb|EFD82894.1| zinc-binding protein [Klebsiella sp. 1_1_55] Length = 64 Score = 35.4 bits (80), Expect = 2.8, Method: Compositional matrix adjust. Identities = 18/44 (40%), Positives = 21/44 (47%), Gaps = 4/44 (9%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVED 52 CP C K G F PFCS +C+ IDL W E I + D Sbjct: 9 CPTCGKNVVWGEQSPFRPFCSKRCQLIDLGEWAAEEKRIPSAGD 52 >gi|332281211|ref|ZP_08393624.1| zinc-binding protein [Shigella sp. D9] gi|332103563|gb|EGJ06909.1| zinc-binding protein [Shigella sp. D9] Length = 67 Score = 35.4 bits (80), Expect = 2.8, Method: Compositional matrix adjust. Identities = 18/44 (40%), Positives = 22/44 (50%), Gaps = 4/44 (9%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVED 52 CP C K G + F PFCS +C+ IDL W E I + D Sbjct: 11 CPTCGKTVVWGEISPFRPFCSKRCQLIDLGEWAAEEKRIPSSGD 54 >gi|257455883|ref|ZP_05621102.1| conserved hypothetical protein [Enhydrobacter aerosaccus SK60] gi|257446731|gb|EEV21755.1| conserved hypothetical protein [Enhydrobacter aerosaccus SK60] Length = 85 Score = 35.4 bits (80), Expect = 2.8, Method: Compositional matrix adjust. Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 3/48 (6%) Query: 13 CPECRKGSM---VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP C K ++ PFCS +C+ IDL W + +Y + A + S+E Sbjct: 33 CPRCGKPTVWADNPTKPFCSARCKLIDLGAWANEDYKVGAEDTPFSDE 80 >gi|197122407|ref|YP_002134358.1| hypothetical protein AnaeK_2001 [Anaeromyxobacter sp. K] gi|196172256|gb|ACG73229.1| protein of unknown function DUF329 [Anaeromyxobacter sp. K] Length = 67 Score = 35.4 bits (80), Expect = 2.9, Method: Compositional matrix adjust. Identities = 13/25 (52%), Positives = 17/25 (68%) Query: 25 YPFCSTQCRSIDLSRWLHGEYVIAA 49 +PFCS +C+ IDL +WL EY I Sbjct: 22 FPFCSDRCKLIDLGKWLGEEYRIPG 46 >gi|220917189|ref|YP_002492493.1| protein of unknown function DUF329 [Anaeromyxobacter dehalogenans 2CP-1] gi|219955043|gb|ACL65427.1| protein of unknown function DUF329 [Anaeromyxobacter dehalogenans 2CP-1] Length = 67 Score = 35.4 bits (80), Expect = 2.9, Method: Compositional matrix adjust. Identities = 13/25 (52%), Positives = 17/25 (68%) Query: 25 YPFCSTQCRSIDLSRWLHGEYVIAA 49 +PFCS +C+ IDL +WL EY I Sbjct: 22 FPFCSDRCKLIDLGKWLGEEYRIPG 46 >gi|152968685|ref|YP_001333794.1| zinc-binding protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] gi|238893080|ref|YP_002917814.1| zinc-binding protein [Klebsiella pneumoniae NTUH-K2044] gi|262044856|ref|ZP_06017899.1| conserved hypothetical protein [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884] gi|330011997|ref|ZP_08307214.1| hypothetical protein HMPREF9538_04918 [Klebsiella sp. MS 92-3] gi|166926153|sp|A6T4P3|Y103_KLEP7 RecName: Full=UPF0243 zinc-binding protein KPN78578_01030 gi|150953534|gb|ABR75564.1| zinc-binding protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] gi|238545396|dbj|BAH61747.1| zinc-binding protein [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044] gi|259037825|gb|EEW39053.1| conserved hypothetical protein [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884] gi|328533986|gb|EGF60638.1| hypothetical protein HMPREF9538_04918 [Klebsiella sp. MS 92-3] Length = 64 Score = 35.4 bits (80), Expect = 2.9, Method: Compositional matrix adjust. Identities = 18/44 (40%), Positives = 21/44 (47%), Gaps = 4/44 (9%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVED 52 CP C K G F PFCS +C+ IDL W E I + D Sbjct: 9 CPTCGKTVVWGEQSPFRPFCSKRCQLIDLGEWAAEEKRIPSAGD 52 >gi|313497006|gb|ADR58372.1| Zinc-binding protein [Pseudomonas putida BIRD-1] Length = 66 Score = 35.4 bits (80), Expect = 3.0, Method: Compositional matrix adjust. Identities = 21/56 (37%), Positives = 28/56 (50%), Gaps = 8/56 (14%) Query: 7 RSLKSICPECRKGSMVE------FYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 + L CP C G+ VE F PFCS +C+ IDL W E+ I E+ + E Sbjct: 3 QPLTVDCPTC--GAPVEWSEKNAFRPFCSDRCKLIDLGAWAAEEHKIPGSEESEDE 56 >gi|86158283|ref|YP_465068.1| hypothetical protein Adeh_1859 [Anaeromyxobacter dehalogenans 2CP-C] gi|85774794|gb|ABC81631.1| protein of unknown function DUF329 [Anaeromyxobacter dehalogenans 2CP-C] Length = 67 Score = 35.0 bits (79), Expect = 3.0, Method: Compositional matrix adjust. Identities = 13/25 (52%), Positives = 17/25 (68%) Query: 25 YPFCSTQCRSIDLSRWLHGEYVIAA 49 +PFCS +C+ IDL +WL EY I Sbjct: 22 FPFCSDRCKLIDLGKWLGEEYRIPG 46 >gi|288939911|ref|YP_003442151.1| hypothetical protein Alvin_0150 [Allochromatium vinosum DSM 180] gi|288895283|gb|ADC61119.1| protein of unknown function DUF329 [Allochromatium vinosum DSM 180] Length = 67 Score = 35.0 bits (79), Expect = 3.1, Method: Compositional matrix adjust. Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP C + + PFCS +CR IDL WL + + A + E E+ D Sbjct: 7 CPHCGRPVPWTPDSRWRPFCSERCRLIDLGDWLEERHRLPADDSETPGEDAPD 59 >gi|15799785|ref|NP_285797.1| zinc-binding protein [Escherichia coli O157:H7 EDL933] gi|15829359|ref|NP_308132.1| zinc-binding protein [Escherichia coli O157:H7 str. Sakai] gi|16128094|ref|NP_414643.1| DNA gyrase inhibitor [Escherichia coli str. K-12 substr. MG1655] gi|24111546|ref|NP_706056.1| zinc-binding protein [Shigella flexneri 2a str. 301] gi|30061668|ref|NP_835839.1| zinc-binding protein [Shigella flexneri 2a str. 2457T] gi|74310720|ref|YP_309139.1| zinc-binding protein [Shigella sonnei Ss046] gi|82542705|ref|YP_406652.1| zinc-binding protein [Shigella boydii Sb227] gi|82775508|ref|YP_401855.1| zinc-binding protein [Shigella dysenteriae Sd197] gi|89106983|ref|AP_000763.1| hypothetical protein [Escherichia coli str. K-12 substr. W3110] gi|91209164|ref|YP_539150.1| zinc-binding protein [Escherichia coli UTI89] gi|110640313|ref|YP_668041.1| zinc-binding protein [Escherichia coli 536] gi|110804164|ref|YP_687684.1| zinc-binding protein [Shigella flexneri 5 str. 8401] gi|157155357|ref|YP_001461271.1| zinc-binding protein [Escherichia coli E24377A] gi|157159571|ref|YP_001456889.1| zinc-binding protein [Escherichia coli HS] gi|168752858|ref|ZP_02777880.1| zinc-binding protein YacG [Escherichia coli O157:H7 str. EC4113] gi|168755710|ref|ZP_02780717.1| zinc-binding protein YacG [Escherichia coli O157:H7 str. EC4401] gi|168770432|ref|ZP_02795439.1| zinc-binding protein YacG [Escherichia coli O157:H7 str. EC4486] gi|168776809|ref|ZP_02801816.1| zinc-binding protein YacG [Escherichia coli O157:H7 str. EC4196] gi|168781987|ref|ZP_02806994.1| zinc-binding protein YacG [Escherichia coli O157:H7 str. EC4076] gi|168789629|ref|ZP_02814636.1| zinc-binding protein YacG [Escherichia coli O157:H7 str. EC869] gi|170021544|ref|YP_001726498.1| zinc-binding protein [Escherichia coli ATCC 8739] gi|170079739|ref|YP_001729059.1| zinc-binding protein [Escherichia coli str. K-12 substr. DH10B] gi|170683016|ref|YP_001742222.1| zinc-binding protein [Escherichia coli SMS-3-5] gi|187730244|ref|YP_001878911.1| zinc-binding protein [Shigella boydii CDC 3083-94] gi|188493366|ref|ZP_03000636.1| zinc-binding protein [Escherichia coli 53638] gi|191169647|ref|ZP_03031351.1| zinc-binding protein YacG [Escherichia coli B7A] gi|191174255|ref|ZP_03035765.1| zinc-binding protein YacG [Escherichia coli F11] gi|193063249|ref|ZP_03044340.1| zinc-binding protein YacG [Escherichia coli E22] gi|193071231|ref|ZP_03052152.1| zinc-binding protein YacG [Escherichia coli E110019] gi|194430299|ref|ZP_03062793.1| zinc-binding protein YacG [Escherichia coli B171] gi|195938218|ref|ZP_03083600.1| zinc-binding protein [Escherichia coli O157:H7 str. EC4024] gi|208806134|ref|ZP_03248471.1| zinc-binding protein YacG [Escherichia coli O157:H7 str. EC4206] gi|208813702|ref|ZP_03255031.1| zinc-binding protein YacG [Escherichia coli O157:H7 str. EC4045] gi|208819732|ref|ZP_03260052.1| zinc-binding protein YacG [Escherichia coli O157:H7 str. EC4042] gi|209400277|ref|YP_002268708.1| zinc-binding protein YacG [Escherichia coli O157:H7 str. EC4115] gi|209917293|ref|YP_002291377.1| zinc-binding protein [Escherichia coli SE11] gi|215485266|ref|YP_002327697.1| zinc-binding protein [Escherichia coli O127:H6 str. E2348/69] gi|217326198|ref|ZP_03442282.1| zinc-binding protein YacG [Escherichia coli O157:H7 str. TW14588] gi|218557040|ref|YP_002389953.1| zinc-binding protein [Escherichia coli S88] gi|237704249|ref|ZP_04534730.1| zinc-binding protein yacG [Escherichia sp. 3_2_53FAA] gi|238899501|ref|YP_002925297.1| hypothetical protein BWG_0095 [Escherichia coli BW2952] gi|253774870|ref|YP_003037701.1| zinc-binding protein [Escherichia coli 'BL21-Gold(DE3)pLysS AG'] gi|254037516|ref|ZP_04871593.1| zinc-binding protein [Escherichia sp. 1_1_43] gi|254160222|ref|YP_003043330.1| zinc-binding protein [Escherichia coli B str. REL606] gi|254791237|ref|YP_003076074.1| zinc-binding protein [Escherichia coli O157:H7 str. TW14359] gi|256020062|ref|ZP_05433927.1| zinc-binding protein [Shigella sp. D9] gi|256025414|ref|ZP_05439279.1| zinc-binding protein [Escherichia sp. 4_1_40B] gi|260842336|ref|YP_003220114.1| hypothetical protein ECO103_0102 [Escherichia coli O103:H2 str. 12009] gi|260853314|ref|YP_003227205.1| hypothetical protein ECO26_0104 [Escherichia coli O26:H11 str. 11368] gi|260866253|ref|YP_003232655.1| hypothetical protein ECO111_0103 [Escherichia coli O111:H- str. 11128] gi|261226857|ref|ZP_05941138.1| zinc-binding protein [Escherichia coli O157:H7 str. FRIK2000] gi|261255261|ref|ZP_05947794.1| hypothetical protein EscherichiacoliO157EcO_05469 [Escherichia coli O157:H7 str. FRIK966] gi|291280926|ref|YP_003497744.1| hypothetical protein G2583_0105 [Escherichia coli O55:H7 str. CB9615] gi|293403172|ref|ZP_06647269.1| zinc-binding protein [Escherichia coli FVEC1412] gi|293408192|ref|ZP_06652032.1| conserved hypothetical protein [Escherichia coli B354] gi|293417976|ref|ZP_06660598.1| zinc-binding protein [Escherichia coli B185] gi|293476761|ref|ZP_06665169.1| hypothetical protein ECCG_03084 [Escherichia coli B088] gi|297517770|ref|ZP_06936156.1| zinc-binding protein [Escherichia coli OP50] gi|298378704|ref|ZP_06988588.1| zinc-binding protein [Escherichia coli FVEC1302] gi|300816138|ref|ZP_07096361.1| conserved hypothetical protein [Escherichia coli MS 107-1] gi|300821895|ref|ZP_07102039.1| conserved hypothetical protein [Escherichia coli MS 119-7] gi|300900869|ref|ZP_07119006.1| conserved hypothetical protein [Escherichia coli MS 198-1] gi|300905510|ref|ZP_07123274.1| hypothetical protein HMPREF9536_03528 [Escherichia coli MS 84-1] gi|300919656|ref|ZP_07136147.1| conserved hypothetical protein [Escherichia coli MS 115-1] gi|300923117|ref|ZP_07139177.1| hypothetical protein HMPREF9548_01326 [Escherichia coli MS 182-1] gi|300931773|ref|ZP_07147073.1| conserved hypothetical protein [Escherichia coli MS 187-1] gi|300938495|ref|ZP_07153235.1| conserved hypothetical protein [Escherichia coli MS 21-1] gi|300949880|ref|ZP_07163844.1| conserved hypothetical protein [Escherichia coli MS 116-1] gi|300955966|ref|ZP_07168299.1| hypothetical protein HMPREF9547_01822 [Escherichia coli MS 175-1] gi|300984522|ref|ZP_07177014.1| hypothetical protein HMPREF9553_02720 [Escherichia coli MS 200-1] gi|301026091|ref|ZP_07189566.1| conserved hypothetical protein [Escherichia coli MS 69-1] gi|301028583|ref|ZP_07191813.1| conserved hypothetical protein [Escherichia coli MS 196-1] gi|301303798|ref|ZP_07209918.1| hypothetical protein HMPREF9347_02400 [Escherichia coli MS 124-1] gi|301330118|ref|ZP_07222787.1| conserved hypothetical protein [Escherichia coli MS 78-1] gi|301646414|ref|ZP_07246296.1| conserved hypothetical protein [Escherichia coli MS 146-1] gi|306815302|ref|ZP_07449451.1| zinc-binding protein [Escherichia coli NC101] gi|307136701|ref|ZP_07496057.1| zinc-binding protein [Escherichia coli H736] gi|307311449|ref|ZP_07591091.1| protein of unknown function DUF329 [Escherichia coli W] gi|309796090|ref|ZP_07690502.1| conserved hypothetical protein [Escherichia coli MS 145-7] gi|312966229|ref|ZP_07780455.1| conserved hypothetical protein [Escherichia coli 2362-75] gi|312970195|ref|ZP_07784377.1| conserved hypothetical protein [Escherichia coli 1827-70] gi|331640553|ref|ZP_08341701.1| putative cytoplasmic protein [Escherichia coli H736] gi|331645211|ref|ZP_08346322.1| putative cytoplasmic protein [Escherichia coli M605] gi|331650998|ref|ZP_08352026.1| putative cytoplasmic protein [Escherichia coli M718] gi|331661146|ref|ZP_08362078.1| putative cytoplasmic protein [Escherichia coli TA206] gi|331661474|ref|ZP_08362398.1| putative cytoplasmic protein [Escherichia coli TA143] gi|331666337|ref|ZP_08367218.1| putative cytoplasmic protein [Escherichia coli TA271] gi|331671617|ref|ZP_08372415.1| putative cytoplasmic protein [Escherichia coli TA280] gi|331680674|ref|ZP_08381333.1| putative cytoplasmic protein [Escherichia coli H591] gi|331681485|ref|ZP_08382122.1| putative cytoplasmic protein [Escherichia coli H299] gi|67476023|sp|P0A8H8|YACG_ECOLI RecName: Full=UPF0243 zinc-binding protein yacG gi|67476024|sp|P0A8H9|YACG_ECO57 RecName: Full=UPF0243 zinc-binding protein yacG gi|67476025|sp|P0A8I0|YACG_SHIFL RecName: Full=UPF0243 zinc-binding protein yacG gi|122425013|sp|Q1RG95|YACG_ECOUT RecName: Full=UPF0243 zinc-binding protein yacG gi|123049507|sp|Q0TLN9|YACG_ECOL5 RecName: Full=UPF0243 zinc-binding protein yacG gi|123147288|sp|Q0T897|YACG_SHIF8 RecName: Full=UPF0243 zinc-binding protein yacG gi|123560580|sp|Q326D4|YACG_SHIBS RecName: Full=UPF0243 zinc-binding protein yacG gi|123563512|sp|Q32JZ1|YACG_SHIDS RecName: Full=UPF0243 zinc-binding protein yacG gi|123618072|sp|Q3Z5Q8|YACG_SHISS RecName: Full=UPF0243 zinc-binding protein yacG gi|166919041|sp|A7ZHJ2|YACG_ECO24 RecName: Full=UPF0243 zinc-binding protein yacG gi|166919042|sp|A7ZW52|YACG_ECOHS RecName: Full=UPF0243 zinc-binding protein yacG gi|189040672|sp|B1IR78|YACG_ECOLC RecName: Full=UPF0243 zinc-binding protein yacG gi|226708835|sp|B7MAM3|YACG_ECO45 RecName: Full=UPF0243 zinc-binding protein yacG gi|226708836|sp|B5YZD6|YACG_ECO5E RecName: Full=UPF0243 zinc-binding protein yacG gi|226708837|sp|B1XC77|YACG_ECODH RecName: Full=UPF0243 zinc-binding protein yacG gi|226708838|sp|B6HZ78|YACG_ECOSE RecName: Full=UPF0243 zinc-binding protein yacG gi|226708839|sp|B1LG37|YACG_ECOSM RecName: Full=UPF0243 zinc-binding protein yacG gi|226708849|sp|B2U2A6|YACG_SHIB3 RecName: Full=UPF0243 zinc-binding protein yacG gi|254807327|sp|B7UIF0|YACG_ECO27 RecName: Full=UPF0243 zinc-binding protein yacG gi|259710194|sp|C4ZRJ5|YACG_ECOBW RecName: Full=UPF0243 zinc-binding protein yacG gi|12512807|gb|AAG54405.1|AE005186_11 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933] gi|1786290|gb|AAC73212.1| DNA gyrase inhibitor [Escherichia coli str. K-12 substr. MG1655] gi|13359561|dbj|BAB33528.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai] gi|24050305|gb|AAN41763.1| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301] gi|30039910|gb|AAP15644.1| hypothetical protein S0100 [Shigella flexneri 2a str. 2457T] gi|73854197|gb|AAZ86904.1| conserved hypothetical protein [Shigella sonnei Ss046] gi|81239656|gb|ABB60366.1| conserved hypothetical protein [Shigella dysenteriae Sd197] gi|81244116|gb|ABB64824.1| conserved hypothetical protein [Shigella boydii Sb227] gi|85674326|dbj|BAB96668.2| conserved hypothetical protein [Escherichia coli str. K12 substr. W3110] gi|91070738|gb|ABE05619.1| conserved hypothetical protein [Escherichia coli UTI89] gi|110341905|gb|ABG68142.1| hypothetical protein YacG [Escherichia coli 536] gi|110613712|gb|ABF02379.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401] gi|157065251|gb|ABV04506.1| zinc-binding protein YacG [Escherichia coli HS] gi|157077387|gb|ABV17095.1| zinc-binding protein YacG [Escherichia coli E24377A] gi|169756472|gb|ACA79171.1| protein of unknown function DUF329 [Escherichia coli ATCC 8739] gi|169887574|gb|ACB01281.1| zinc-binding protein [Escherichia coli str. K-12 substr. DH10B] gi|170520734|gb|ACB18912.1| zinc-binding protein YacG [Escherichia coli SMS-3-5] gi|187427236|gb|ACD06510.1| zinc-binding protein YacG [Shigella boydii CDC 3083-94] gi|187767853|gb|EDU31697.1| zinc-binding protein YacG [Escherichia coli O157:H7 str. EC4196] gi|188013500|gb|EDU51622.1| zinc-binding protein YacG [Escherichia coli O157:H7 str. EC4113] gi|188488565|gb|EDU63668.1| zinc-binding protein [Escherichia coli 53638] gi|189000417|gb|EDU69403.1| zinc-binding protein YacG [Escherichia coli O157:H7 str. EC4076] gi|189356980|gb|EDU75399.1| zinc-binding protein YacG [Escherichia coli O157:H7 str. EC4401] gi|189360723|gb|EDU79142.1| zinc-binding protein YacG [Escherichia coli O157:H7 str. EC4486] gi|189370809|gb|EDU89225.1| zinc-binding protein YacG [Escherichia coli O157:H7 str. EC869] gi|190900314|gb|EDV60159.1| zinc-binding protein YacG [Escherichia coli B7A] gi|190905488|gb|EDV65117.1| zinc-binding protein YacG [Escherichia coli F11] gi|192931157|gb|EDV83760.1| zinc-binding protein YacG [Escherichia coli E22] gi|192955441|gb|EDV85923.1| zinc-binding protein YacG [Escherichia coli E110019] gi|194411654|gb|EDX27982.1| zinc-binding protein YacG [Escherichia coli B171] gi|208725935|gb|EDZ75536.1| zinc-binding protein YacG [Escherichia coli O157:H7 str. EC4206] gi|208734979|gb|EDZ83666.1| zinc-binding protein YacG [Escherichia coli O157:H7 str. EC4045] gi|208739855|gb|EDZ87537.1| zinc-binding protein YacG [Escherichia coli O157:H7 str. EC4042] gi|209161677|gb|ACI39110.1| zinc-binding protein YacG [Escherichia coli O157:H7 str. EC4115] gi|209746434|gb|ACI71524.1| hypothetical protein ECs0105 [Escherichia coli] gi|209746436|gb|ACI71525.1| hypothetical protein ECs0105 [Escherichia coli] gi|209746438|gb|ACI71526.1| hypothetical protein ECs0105 [Escherichia coli] gi|209746440|gb|ACI71527.1| hypothetical protein ECs0105 [Escherichia coli] gi|209746442|gb|ACI71528.1| hypothetical protein ECs0105 [Escherichia coli] gi|209910552|dbj|BAG75626.1| conserved hypothetical protein [Escherichia coli SE11] gi|215263338|emb|CAS07653.1| predicted protein [Escherichia coli O127:H6 str. E2348/69] gi|217322419|gb|EEC30843.1| zinc-binding protein YacG [Escherichia coli O157:H7 str. TW14588] gi|218363809|emb|CAR01469.1| conserved hypothetical protein [Escherichia coli S88] gi|222031931|emb|CAP74669.1| UPF0243 zinc-binding protein yacG [Escherichia coli LF82] gi|226840622|gb|EEH72624.1| zinc-binding protein [Escherichia sp. 1_1_43] gi|226902161|gb|EEH88420.1| zinc-binding protein yacG [Escherichia sp. 3_2_53FAA] gi|238860266|gb|ACR62264.1| conserved protein [Escherichia coli BW2952] gi|242375936|emb|CAQ30617.1| DNA gyrase inhibitor YacG [Escherichia coli BL21(DE3)] gi|253325914|gb|ACT30516.1| protein of unknown function DUF329 [Escherichia coli 'BL21-Gold(DE3)pLysS AG'] gi|253972123|gb|ACT37794.1| zinc-binding protein [Escherichia coli B str. REL606] gi|253976332|gb|ACT42002.1| zinc-binding protein [Escherichia coli BL21(DE3)] gi|254590637|gb|ACT69998.1| zinc-binding protein [Escherichia coli O157:H7 str. TW14359] gi|257751963|dbj|BAI23465.1| conserved predicted protein [Escherichia coli O26:H11 str. 11368] gi|257757483|dbj|BAI28980.1| conserved predicted protein [Escherichia coli O103:H2 str. 12009] gi|257762609|dbj|BAI34104.1| conserved predicted protein [Escherichia coli O111:H- str. 11128] gi|260450693|gb|ACX41115.1| protein of unknown function DUF329 [Escherichia coli DH1] gi|281177320|dbj|BAI53650.1| conserved hypothetical protein [Escherichia coli SE15] gi|281599463|gb|ADA72447.1| zinc-binding protein yacG [Shigella flexneri 2002017] gi|290760799|gb|ADD54760.1| Uncharacterized protein conserved in bacteria [Escherichia coli O55:H7 str. CB9615] gi|291321214|gb|EFE60656.1| hypothetical protein ECCG_03084 [Escherichia coli B088] gi|291430087|gb|EFF03101.1| zinc-binding protein [Escherichia coli FVEC1412] gi|291430694|gb|EFF03692.1| zinc-binding protein [Escherichia coli B185] gi|291472443|gb|EFF14925.1| conserved hypothetical protein [Escherichia coli B354] gi|294491402|gb|ADE90158.1| zinc-binding protein YacG [Escherichia coli IHE3034] gi|298281038|gb|EFI22539.1| zinc-binding protein [Escherichia coli FVEC1302] gi|299878394|gb|EFI86605.1| conserved hypothetical protein [Escherichia coli MS 196-1] gi|300306691|gb|EFJ61211.1| hypothetical protein HMPREF9553_02720 [Escherichia coli MS 200-1] gi|300317186|gb|EFJ66970.1| hypothetical protein HMPREF9547_01822 [Escherichia coli MS 175-1] gi|300355633|gb|EFJ71503.1| conserved hypothetical protein [Escherichia coli MS 198-1] gi|300395662|gb|EFJ79200.1| conserved hypothetical protein [Escherichia coli MS 69-1] gi|300402660|gb|EFJ86198.1| hypothetical protein HMPREF9536_03528 [Escherichia coli MS 84-1] gi|300413296|gb|EFJ96606.1| conserved hypothetical protein [Escherichia coli MS 115-1] gi|300420572|gb|EFK03883.1| hypothetical protein HMPREF9548_01326 [Escherichia coli MS 182-1] gi|300450744|gb|EFK14364.1| conserved hypothetical protein [Escherichia coli MS 116-1] gi|300456564|gb|EFK20057.1| conserved hypothetical protein [Escherichia coli MS 21-1] gi|300460433|gb|EFK23926.1| conserved hypothetical protein [Escherichia coli MS 187-1] gi|300525495|gb|EFK46564.1| conserved hypothetical protein [Escherichia coli MS 119-7] gi|300531345|gb|EFK52407.1| conserved hypothetical protein [Escherichia coli MS 107-1] gi|300840925|gb|EFK68685.1| hypothetical protein HMPREF9347_02400 [Escherichia coli MS 124-1] gi|300843865|gb|EFK71625.1| conserved hypothetical protein [Escherichia coli MS 78-1] gi|301075384|gb|EFK90190.1| conserved hypothetical protein [Escherichia coli MS 146-1] gi|305850964|gb|EFM51419.1| zinc-binding protein [Escherichia coli NC101] gi|306908428|gb|EFN38926.1| protein of unknown function DUF329 [Escherichia coli W] gi|307629673|gb|ADN73977.1| zinc-binding protein [Escherichia coli UM146] gi|308120332|gb|EFO57594.1| conserved hypothetical protein [Escherichia coli MS 145-7] gi|310337693|gb|EFQ02804.1| conserved hypothetical protein [Escherichia coli 1827-70] gi|312289472|gb|EFR17366.1| conserved hypothetical protein [Escherichia coli 2362-75] gi|312944706|gb|ADR25533.1| zinc-binding protein [Escherichia coli O83:H1 str. NRG 857C] gi|313646517|gb|EFS10978.1| hypothetical protein SF2457T_5038 [Shigella flexneri 2a str. 2457T] gi|315059323|gb|ADT73650.1| DNA gyrase inhibitor [Escherichia coli W] gi|315134794|dbj|BAJ41953.1| hypothetical protein ECDH1ME8569_0097 [Escherichia coli DH1] gi|315254900|gb|EFU34868.1| conserved domain protein [Escherichia coli MS 85-1] gi|315285154|gb|EFU44599.1| conserved hypothetical protein [Escherichia coli MS 110-3] gi|315299999|gb|EFU59237.1| conserved hypothetical protein [Escherichia coli MS 16-3] gi|315616121|gb|EFU96740.1| conserved hypothetical protein [Escherichia coli 3431] gi|320172809|gb|EFW48041.1| zinc-binding protein [Shigella dysenteriae CDC 74-1112] gi|320183613|gb|EFW58456.1| hypothetical protein SGF_04186 [Shigella flexneri CDC 796-83] gi|320190377|gb|EFW65027.1| zinc-binding protein [Escherichia coli O157:H7 str. EC1212] gi|320200381|gb|EFW74967.1| hypothetical protein ECoL_01943 [Escherichia coli EC4100B] gi|320642139|gb|EFX11490.1| DNA gyrase inhibitor [Escherichia coli O157:H7 str. G5101] gi|320647502|gb|EFX16297.1| DNA gyrase inhibitor [Escherichia coli O157:H- str. 493-89] gi|320652836|gb|EFX21074.1| DNA gyrase inhibitor [Escherichia coli O157:H- str. H 2687] gi|320658225|gb|EFX25954.1| DNA gyrase inhibitor [Escherichia coli O55:H7 str. 3256-97 TW 07815] gi|320663534|gb|EFX30818.1| DNA gyrase inhibitor [Escherichia coli O55:H7 str. USDA 5905] gi|320668846|gb|EFX35641.1| DNA gyrase inhibitor [Escherichia coli O157:H7 str. LSU-61] gi|323157831|gb|EFZ43934.1| hypothetical protein ECEPECA14_0287 [Escherichia coli EPECa14] gi|323160102|gb|EFZ46063.1| hypothetical protein ECE128010_3624 [Escherichia coli E128010] gi|323165983|gb|EFZ51763.1| hypothetical protein SS53G_3696 [Shigella sonnei 53G] gi|323176408|gb|EFZ62000.1| hypothetical protein ECOK1180_5102 [Escherichia coli 1180] gi|323181797|gb|EFZ67210.1| hypothetical protein ECOK1357_4914 [Escherichia coli 1357] gi|323190218|gb|EFZ75494.1| hypothetical protein ECRN5871_1373 [Escherichia coli RN587/1] gi|323380119|gb|ADX52387.1| protein of unknown function DUF329 [Escherichia coli KO11] gi|323935152|gb|EGB31519.1| zinc-binding protein [Escherichia coli E1520] gi|323939860|gb|EGB36060.1| zinc-binding protein [Escherichia coli E482] gi|323945729|gb|EGB41777.1| zinc-binding protein [Escherichia coli H120] gi|323950904|gb|EGB46781.1| zinc-binding protein [Escherichia coli H252] gi|323955298|gb|EGB51071.1| zinc-binding protein [Escherichia coli H263] gi|323960046|gb|EGB55692.1| zinc-binding protein [Escherichia coli H489] gi|323964803|gb|EGB60270.1| zinc-binding protein [Escherichia coli M863] gi|323970772|gb|EGB66026.1| zinc-binding protein [Escherichia coli TA007] gi|324008335|gb|EGB77554.1| hypothetical protein HMPREF9532_01971 [Escherichia coli MS 57-2] gi|324012263|gb|EGB81482.1| hypothetical protein HMPREF9533_03716 [Escherichia coli MS 60-1] gi|324017739|gb|EGB86958.1| hypothetical protein HMPREF9542_03598 [Escherichia coli MS 117-3] gi|324118450|gb|EGC12344.1| zinc-binding protein [Escherichia coli E1167] gi|326345180|gb|EGD68923.1| hypothetical protein ECF_01066 [Escherichia coli O157:H7 str. 1125] gi|326346966|gb|EGD70700.1| zinc-binding protein [Escherichia coli O157:H7 str. 1044] gi|327255079|gb|EGE66682.1| hypothetical protein ECSTEC7V_0107 [Escherichia coli STEC_7v] gi|330909947|gb|EGH38457.1| zinc-binding protein [Escherichia coli AA86] gi|331040299|gb|EGI12506.1| putative cytoplasmic protein [Escherichia coli H736] gi|331045968|gb|EGI18087.1| putative cytoplasmic protein [Escherichia coli M605] gi|331051452|gb|EGI23501.1| putative cytoplasmic protein [Escherichia coli M718] gi|331052188|gb|EGI24227.1| putative cytoplasmic protein [Escherichia coli TA206] gi|331061389|gb|EGI33352.1| putative cytoplasmic protein [Escherichia coli TA143] gi|331066548|gb|EGI38425.1| putative cytoplasmic protein [Escherichia coli TA271] gi|331071462|gb|EGI42819.1| putative cytoplasmic protein [Escherichia coli TA280] gi|331072137|gb|EGI43473.1| putative cytoplasmic protein [Escherichia coli H591] gi|331081706|gb|EGI52867.1| putative cytoplasmic protein [Escherichia coli H299] gi|332098964|gb|EGJ03915.1| hypothetical protein SB359474_0059 [Shigella boydii 3594-74] gi|332341432|gb|AEE54766.1| zinc-binding protein YacG [Escherichia coli UMNK88] gi|332762102|gb|EGJ92371.1| hypothetical protein SF434370_0248 [Shigella flexneri 4343-70] gi|332762281|gb|EGJ92548.1| hypothetical protein SF274771_0094 [Shigella flexneri 2747-71] gi|332768890|gb|EGJ99069.1| hypothetical protein SF293071_0188 [Shigella flexneri 2930-71] gi|333009433|gb|EGK28889.1| hypothetical protein SFK218_0341 [Shigella flexneri K-218] gi|333010596|gb|EGK30029.1| hypothetical protein SFVA6_0392 [Shigella flexneri VA-6] gi|333022427|gb|EGK41665.1| hypothetical protein SFK304_0211 [Shigella flexneri K-304] Length = 65 Score = 35.0 bits (79), Expect = 3.1, Method: Compositional matrix adjust. Identities = 18/44 (40%), Positives = 22/44 (50%), Gaps = 4/44 (9%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVED 52 CP C K G + F PFCS +C+ IDL W E I + D Sbjct: 9 CPTCGKTVVWGEISPFRPFCSKRCQLIDLGEWAAEEKRIPSSGD 52 >gi|323975735|gb|EGB70831.1| zinc-binding protein [Escherichia coli TW10509] Length = 64 Score = 35.0 bits (79), Expect = 3.1, Method: Compositional matrix adjust. Identities = 18/44 (40%), Positives = 22/44 (50%), Gaps = 4/44 (9%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVED 52 CP C K G + F PFCS +C+ IDL W E I + D Sbjct: 9 CPTCGKTVVWGEISPFRPFCSKRCQLIDLGEWAAEEKRIPSSGD 52 >gi|192360822|ref|YP_001983193.1| hypothetical protein CJA_2734 [Cellvibrio japonicus Ueda107] gi|190686987|gb|ACE84665.1| Domain of unknown function (DUF329) family [Cellvibrio japonicus Ueda107] Length = 73 Score = 35.0 bits (79), Expect = 3.1, Method: Compositional matrix adjust. Identities = 18/46 (39%), Positives = 22/46 (47%), Gaps = 4/46 (8%) Query: 8 SLKSICPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAA 49 +L CP C+K F PFCS +CR IDL W + IA Sbjct: 16 ALTLKCPSCQKIVFWNDDYPFRPFCSDRCRLIDLGEWASENHRIAG 61 >gi|218547557|ref|YP_002381348.1| zinc-binding protein [Escherichia fergusonii ATCC 35469] gi|226708840|sp|B7LWG6|YACG_ESCF3 RecName: Full=UPF0243 zinc-binding protein yacG gi|218355098|emb|CAQ87705.1| conserved hypothetical protein [Escherichia fergusonii ATCC 35469] gi|324112487|gb|EGC06464.1| zinc-binding protein [Escherichia fergusonii B253] Length = 64 Score = 35.0 bits (79), Expect = 3.2, Method: Compositional matrix adjust. Identities = 18/44 (40%), Positives = 22/44 (50%), Gaps = 4/44 (9%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVED 52 CP C K G + F PFCS +C+ IDL W E I + D Sbjct: 9 CPTCGKTVVWGEISPFRPFCSKRCQLIDLGEWAAEEKRIPSSGD 52 >gi|24158901|pdb|1LV3|A Chain A, Solution Nmr Structure Of Zinc Finger Protein Yacg From Escherichia Coli. Northeast Structural Genomics Consortium Target Et92 Length = 68 Score = 35.0 bits (79), Expect = 3.2, Method: Compositional matrix adjust. Identities = 18/44 (40%), Positives = 22/44 (50%), Gaps = 4/44 (9%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVED 52 CP C K G + F PFCS +C+ IDL W E I + D Sbjct: 12 CPTCGKTVVWGEISPFRPFCSKRCQLIDLGEWAAEEKRIPSSGD 55 >gi|308048080|ref|YP_003911646.1| hypothetical protein Fbal_0358 [Ferrimonas balearica DSM 9799] gi|307630270|gb|ADN74572.1| protein of unknown function DUF329 [Ferrimonas balearica DSM 9799] Length = 74 Score = 35.0 bits (79), Expect = 3.3, Method: Compositional matrix adjust. Identities = 17/46 (36%), Positives = 22/46 (47%), Gaps = 4/46 (8%) Query: 8 SLKSICPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAA 49 +LK CP C+ F PFCS +C+ IDL W + IA Sbjct: 2 TLKVECPTCQAEVSWDEQHPFRPFCSERCKLIDLGEWAEERHAIAG 47 >gi|268591744|ref|ZP_06125965.1| conserved domain protein [Providencia rettgeri DSM 1131] gi|291312705|gb|EFE53158.1| conserved domain protein [Providencia rettgeri DSM 1131] Length = 65 Score = 35.0 bits (79), Expect = 3.4, Method: Compositional matrix adjust. Identities = 18/44 (40%), Positives = 22/44 (50%), Gaps = 4/44 (9%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVED 52 CP C+K F PFCS +C+ IDL W E IA+ D Sbjct: 9 CPTCKKIVVWNENSPFRPFCSKRCQLIDLGEWASEEKRIASQGD 52 >gi|320179662|gb|EFW54611.1| zinc-binding protein [Shigella boydii ATCC 9905] gi|332095391|gb|EGJ00414.1| hypothetical protein SB521682_0101 [Shigella boydii 5216-82] Length = 65 Score = 35.0 bits (79), Expect = 3.4, Method: Compositional matrix adjust. Identities = 18/44 (40%), Positives = 22/44 (50%), Gaps = 4/44 (9%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVED 52 CP C K G + F PFCS +C+ IDL W E I + D Sbjct: 9 CPTCGKTVVWGEISPFRPFCSKRCQLIDLGEWAAEEKRIPSNGD 52 >gi|323171264|gb|EFZ56912.1| hypothetical protein ECLT68_4200 [Escherichia coli LT-68] gi|332764946|gb|EGJ95174.1| hypothetical protein SFK671_0095 [Shigella flexneri K-671] Length = 59 Score = 35.0 bits (79), Expect = 3.5, Method: Compositional matrix adjust. Identities = 18/44 (40%), Positives = 22/44 (50%), Gaps = 4/44 (9%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVED 52 CP C K G + F PFCS +C+ IDL W E I + D Sbjct: 3 CPTCGKTVVWGEISPFRPFCSKRCQLIDLGEWAAEEKRIPSSGD 46 >gi|167550665|ref|ZP_02344422.1| conserved domain protein [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] gi|205324465|gb|EDZ12304.1| conserved domain protein [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] Length = 63 Score = 35.0 bits (79), Expect = 3.5, Method: Compositional matrix adjust. Identities = 18/40 (45%), Positives = 21/40 (52%), Gaps = 4/40 (10%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIA 48 CP C K G + F PFCS +C+ IDL W E IA Sbjct: 9 CPTCGKLVVWGEISPFRPFCSKRCQLIDLGEWAAEEKRIA 48 >gi|157147476|ref|YP_001454795.1| zinc-binding protein [Citrobacter koseri ATCC BAA-895] gi|166229100|sp|A8ALJ6|Y3275_CITK8 RecName: Full=UPF0243 zinc-binding protein CKO_03275 gi|157084681|gb|ABV14359.1| hypothetical protein CKO_03275 [Citrobacter koseri ATCC BAA-895] Length = 64 Score = 35.0 bits (79), Expect = 3.5, Method: Compositional matrix adjust. Identities = 18/44 (40%), Positives = 22/44 (50%), Gaps = 4/44 (9%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVED 52 CP C K G + F PFCS +C+ IDL W E I + D Sbjct: 9 CPTCGKTVVWGEVSPFRPFCSKRCQLIDLGEWAAEEKRIPSSGD 52 >gi|313667732|ref|YP_004048016.1| UPF0243 zinc-binding protein ORFY [Neisseria lactamica ST-640] gi|313005194|emb|CBN86627.1| UPF0243 zinc-binding protein ORFY [Neisseria lactamica 020-06] Length = 69 Score = 35.0 bits (79), Expect = 3.5, Method: Compositional matrix adjust. Identities = 12/25 (48%), Positives = 17/25 (68%) Query: 24 FYPFCSTQCRSIDLSRWLHGEYVIA 48 F PFCS +C+ IDL W G+Y ++ Sbjct: 28 FRPFCSQRCKLIDLGGWADGKYTVS 52 >gi|170768598|ref|ZP_02903051.1| zinc-binding protein YacG [Escherichia albertii TW07627] gi|170122702|gb|EDS91633.1| zinc-binding protein YacG [Escherichia albertii TW07627] Length = 65 Score = 35.0 bits (79), Expect = 3.5, Method: Compositional matrix adjust. Identities = 18/44 (40%), Positives = 22/44 (50%), Gaps = 4/44 (9%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVED 52 CP C K G + F PFCS +C+ IDL W E I + D Sbjct: 9 CPTCGKTVVWGEVSPFRPFCSKRCQLIDLGEWAAEEKRIPSSGD 52 >gi|56412412|ref|YP_149487.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] gi|197361348|ref|YP_002140983.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601] gi|67461911|sp|Q5PDD8|YACG_SALPA RecName: Full=UPF0243 zinc-binding protein yacG gi|226708847|sp|B5BLD4|YACG_SALPK RecName: Full=UPF0243 zinc-binding protein yacG gi|56126669|gb|AAV76175.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] gi|197092823|emb|CAR58249.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601] Length = 63 Score = 35.0 bits (79), Expect = 3.7, Method: Compositional matrix adjust. Identities = 18/40 (45%), Positives = 21/40 (52%), Gaps = 4/40 (10%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIA 48 CP C K G + F PFCS +C+ IDL W E IA Sbjct: 9 CPTCGKPVVWGEISPFRPFCSKRCQLIDLGEWAAEEKRIA 48 >gi|16759135|ref|NP_454752.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Typhi str. CT18] gi|16763528|ref|NP_459143.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2] gi|29140685|ref|NP_804027.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] gi|62178707|ref|YP_215124.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] gi|161612483|ref|YP_001586448.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] gi|167990012|ref|ZP_02571112.1| conserved domain protein [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] gi|168230419|ref|ZP_02655477.1| zinc-binding protein YacG [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] gi|168234904|ref|ZP_02659962.1| conserved domain protein [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] gi|168243446|ref|ZP_02668378.1| conserved domain protein [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] gi|168464309|ref|ZP_02698212.1| zinc-binding protein YacG [Salmonella enterica subsp. enterica serovar Newport str. SL317] gi|168820866|ref|ZP_02832866.1| conserved domain protein [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] gi|194444422|ref|YP_002039370.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Newport str. SL254] gi|194448599|ref|YP_002044108.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] gi|194469830|ref|ZP_03075814.1| zinc-binding protein YacG [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] gi|194734113|ref|YP_002113155.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] gi|197248595|ref|YP_002145125.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Agona str. SL483] gi|197262442|ref|ZP_03162516.1| zinc-binding protein YacG [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] gi|198242997|ref|YP_002214091.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] gi|200387032|ref|ZP_03213644.1| zinc-binding protein YacG [Salmonella enterica subsp. enterica serovar Virchow str. SL491] gi|204926779|ref|ZP_03217981.1| conserved domain protein [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] gi|205351479|ref|YP_002225280.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91] gi|207855653|ref|YP_002242304.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109] gi|213023098|ref|ZP_03337545.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Typhi str. 404ty] gi|213161255|ref|ZP_03346965.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Typhi str. E00-7866] gi|213420662|ref|ZP_03353728.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Typhi str. E01-6750] gi|213427397|ref|ZP_03360147.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Typhi str. E02-1180] gi|213585941|ref|ZP_03367767.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Typhi str. E98-0664] gi|213618657|ref|ZP_03372483.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Typhi str. E98-2068] gi|213648258|ref|ZP_03378311.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Typhi str. J185] gi|213857983|ref|ZP_03384954.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Typhi str. M223] gi|224581983|ref|YP_002635781.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594] gi|238911196|ref|ZP_04655033.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Tennessee str. CDC07-0191] gi|289823722|ref|ZP_06543334.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Typhi str. E98-3139] gi|54040052|sp|P67482|YACG_SALTI RecName: Full=UPF0243 zinc-binding protein yacG gi|54042761|sp|P67481|YACG_SALTY RecName: Full=UPF0243 zinc-binding protein yacG gi|75484856|sp|Q57TB8|YACG_SALCH RecName: Full=UPF0243 zinc-binding protein yacG gi|189040674|sp|A9MZN0|YACG_SALPB RecName: Full=UPF0243 zinc-binding protein yacG gi|226708841|sp|B5F7X5|YACG_SALA4 RecName: Full=UPF0243 zinc-binding protein yacG gi|226708842|sp|B5FI83|YACG_SALDC RecName: Full=UPF0243 zinc-binding protein yacG gi|226708843|sp|B5R2N6|YACG_SALEP RecName: Full=UPF0243 zinc-binding protein yacG gi|226708844|sp|B5RH76|YACG_SALG2 RecName: Full=UPF0243 zinc-binding protein yacG gi|226708845|sp|B4TJ97|YACG_SALHS RecName: Full=UPF0243 zinc-binding protein yacG gi|226708846|sp|B4SU60|YACG_SALNS RecName: Full=UPF0243 zinc-binding protein yacG gi|226708848|sp|B4TXI7|YACG_SALSV RecName: Full=UPF0243 zinc-binding protein yacG gi|254807328|sp|C0Q5J8|YACG_SALPC RecName: Full=UPF0243 zinc-binding protein yacG gi|25513271|pir||AI0519 conserved hypothetical protein yacG [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) gi|16418638|gb|AAL19102.1| putative cytoplasmic protein [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2] gi|16501425|emb|CAD01297.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Typhi] gi|29136309|gb|AAO67876.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] gi|62126340|gb|AAX64043.1| putative cytoplasmic protein [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] gi|161361847|gb|ABX65615.1| hypothetical protein SPAB_00173 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] gi|194403085|gb|ACF63307.1| zinc-binding protein YacG [Salmonella enterica subsp. enterica serovar Newport str. SL254] gi|194406903|gb|ACF67122.1| conserved domain protein [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] gi|194456194|gb|EDX45033.1| zinc-binding protein YacG [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] gi|194709615|gb|ACF88836.1| conserved domain protein [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] gi|195632894|gb|EDX51348.1| zinc-binding protein YacG [Salmonella enterica subsp. enterica serovar Newport str. SL317] gi|197212298|gb|ACH49695.1| zinc-binding protein YacG [Salmonella enterica subsp. enterica serovar Agona str. SL483] gi|197240697|gb|EDY23317.1| zinc-binding protein YacG [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] gi|197292056|gb|EDY31406.1| conserved domain protein [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] gi|197937513|gb|ACH74846.1| conserved domain protein [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] gi|199604130|gb|EDZ02675.1| zinc-binding protein YacG [Salmonella enterica subsp. enterica serovar Virchow str. SL491] gi|204323444|gb|EDZ08639.1| conserved domain protein [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] gi|205271260|emb|CAR36048.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91] gi|205331485|gb|EDZ18249.1| conserved domain protein [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] gi|205335201|gb|EDZ21965.1| zinc-binding protein YacG [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] gi|205337530|gb|EDZ24294.1| conserved domain protein [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] gi|205342417|gb|EDZ29181.1| conserved domain protein [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] gi|206707456|emb|CAR31730.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109] gi|224466510|gb|ACN44340.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594] gi|261245371|emb|CBG23160.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Typhimurium str. D23580] gi|267991817|gb|ACY86702.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S] gi|301156766|emb|CBW16241.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344] gi|312911108|dbj|BAJ35082.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Typhimurium str. T000240] gi|320084384|emb|CBY94177.1| UPF0243 zinc-binding protein ESA_03238 [Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1] gi|321222287|gb|EFX47359.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Typhimurium str. TN061786] gi|322615960|gb|EFY12877.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. 315996572] gi|322620744|gb|EFY17604.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. 495297-1] gi|322623904|gb|EFY20741.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. 495297-3] gi|322627352|gb|EFY24143.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. 495297-4] gi|322630659|gb|EFY27423.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. 515920-1] gi|322638121|gb|EFY34822.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. 515920-2] gi|322640607|gb|EFY37258.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. 531954] gi|322647748|gb|EFY44233.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. NC_MB110209-0054] gi|322648097|gb|EFY44564.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. OH_2009072675] gi|322656870|gb|EFY53156.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. CASC_09SCPH15965] gi|322657419|gb|EFY53691.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. 19N] gi|322663738|gb|EFY59938.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. 81038-01] gi|322666571|gb|EFY62749.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. MD_MDA09249507] gi|322672270|gb|EFY68382.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. 414877] gi|322676418|gb|EFY72489.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. 366867] gi|322679489|gb|EFY75534.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. 413180] gi|322686182|gb|EFY82166.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. 446600] gi|322713160|gb|EFZ04731.1| conserved domain protein [Salmonella enterica subsp. enterica serovar Choleraesuis str. A50] gi|323128458|gb|ADX15888.1| conserved domain protein [Salmonella enterica subsp. enterica serovar Typhimurium str. 4/74] gi|323195026|gb|EFZ80212.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. 609458-1] gi|323200065|gb|EFZ85152.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. 556150-1] gi|323201114|gb|EFZ86183.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. 609460] gi|323209511|gb|EFZ94444.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. 507440-20] gi|323212237|gb|EFZ97061.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. 556152] gi|323216542|gb|EGA01268.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. MB101509-0077] gi|323219891|gb|EGA04369.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. MB102109-0047] gi|323225829|gb|EGA10049.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. MB110209-0055] gi|323228629|gb|EGA12758.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. MB111609-0052] gi|323236757|gb|EGA20833.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. 2009083312] gi|323239742|gb|EGA23789.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. 2009085258] gi|323242210|gb|EGA26239.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. 315731156] gi|323249366|gb|EGA33282.1| DNA gyrase inhibitor [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2009159199] gi|323252301|gb|EGA36152.1| DNA gyrase inhibitor [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008282] gi|323256609|gb|EGA40339.1| DNA gyrase inhibitor [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008283] gi|323262978|gb|EGA46528.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008284] gi|323265463|gb|EGA48959.1| DNA gyrase inhibitor [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008285] gi|323271749|gb|EGA55167.1| DNA gyrase inhibitor [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008287] gi|326626506|gb|EGE32849.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Gallinarum str. 9] gi|332987091|gb|AEF06074.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Typhimurium str. UK-1] Length = 63 Score = 35.0 bits (79), Expect = 3.7, Method: Compositional matrix adjust. Identities = 18/40 (45%), Positives = 21/40 (52%), Gaps = 4/40 (10%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIA 48 CP C K G + F PFCS +C+ IDL W E IA Sbjct: 9 CPTCGKPVVWGEISPFRPFCSKRCQLIDLGEWAAEEKRIA 48 >gi|319761629|ref|YP_004125566.1| hypothetical protein Alide_0913 [Alicycliphilus denitrificans BC] gi|330823495|ref|YP_004386798.1| hypothetical protein Alide2_0869 [Alicycliphilus denitrificans K601] gi|317116190|gb|ADU98678.1| protein of unknown function DUF329 [Alicycliphilus denitrificans BC] gi|329308867|gb|AEB83282.1| Uncharacterized zinc-binding family protein [Alicycliphilus denitrificans K601] Length = 68 Score = 35.0 bits (79), Expect = 3.7, Method: Compositional matrix adjust. Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 5/53 (9%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP C G F PFCS +C+ IDL W + ++ + A E + E D Sbjct: 12 CPTCGGPSLYGPANPFRPFCSERCKQIDLGAWANEDFRVPA-ESPPEDAEYGD 63 >gi|213857981|ref|ZP_03384952.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Typhi str. M223] Length = 61 Score = 35.0 bits (79), Expect = 3.8, Method: Compositional matrix adjust. Identities = 18/44 (40%), Positives = 22/44 (50%), Gaps = 4/44 (9%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVED 52 CP C K G + F PFCS +C+ IDL W E I + D Sbjct: 9 CPTCGKTVVWGEISPFRPFCSKRCQLIDLGEWAAEEKRIPSSGD 52 >gi|91786748|ref|YP_547700.1| hypothetical protein Bpro_0846 [Polaromonas sp. JS666] gi|91695973|gb|ABE42802.1| protein of unknown function DUF329 [Polaromonas sp. JS666] Length = 68 Score = 35.0 bits (79), Expect = 3.9, Method: Compositional matrix adjust. Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 5/52 (9%) Query: 3 TSDFRSLKSI-CPECRKGSMV----EFYPFCSTQCRSIDLSRWLHGEYVIAA 49 D R +K + CP C S+ F PFCS +C+++DL W E+ + A Sbjct: 2 NEDSRPVKRVACPGCGGESIYAPSNPFRPFCSERCKNLDLGAWASEEFRMPA 53 >gi|325273280|ref|ZP_08139558.1| DNA gyrase inhibitor [Pseudomonas sp. TJI-51] gi|324101611|gb|EGB99179.1| DNA gyrase inhibitor [Pseudomonas sp. TJI-51] Length = 66 Score = 35.0 bits (79), Expect = 3.9, Method: Compositional matrix adjust. Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 8/56 (14%) Query: 7 RSLKSICPECRKGSMVE------FYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 + L CP C G+ VE F PFCS +C+ IDL W E+ I ++ + E Sbjct: 3 QPLTVDCPTC--GAPVEWTEKSAFRPFCSDRCKLIDLGAWAAEEHKIPGAQESEDE 56 >gi|82702135|ref|YP_411701.1| hypothetical protein Nmul_A1006 [Nitrosospira multiformis ATCC 25196] gi|123544785|sp|Q2YAB2|Y1006_NITMU RecName: Full=UPF0243 zinc-binding protein Nmul_A1006 gi|82410200|gb|ABB74309.1| Protein of unknown function DUF329 [Nitrosospira multiformis ATCC 25196] Length = 65 Score = 34.7 bits (78), Expect = 4.0, Method: Compositional matrix adjust. Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 4/50 (8%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP+C K + F PFCS +C+ IDL +W Y I + ++E Sbjct: 8 CPQCGKSVAWDNSNPFRPFCSERCKLIDLGQWATESYRIPDTGKDSEKQE 57 >gi|149191269|ref|ZP_01869524.1| zinc-binding protein [Vibrio shilonii AK1] gi|148834867|gb|EDL51849.1| zinc-binding protein [Vibrio shilonii AK1] Length = 64 Score = 34.7 bits (78), Expect = 4.1, Method: Compositional matrix adjust. Identities = 16/44 (36%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVED 52 CP+C+ F PFCS QC+ ID W E I D Sbjct: 9 CPQCKAEVVWNEDSPFRPFCSKQCQMIDFGEWADEENTIPGAPD 52 >gi|326576433|gb|EGE26342.1| hypothetical protein EA1_05737 [Moraxella catarrhalis O35E] Length = 61 Score = 34.7 bits (78), Expect = 4.1, Method: Compositional matrix adjust. Identities = 18/37 (48%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Query: 26 PFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE-EEVKD 61 PFCS +C+ IDL W EY+IA E E EV D Sbjct: 24 PFCSKRCKLIDLGAWASDEYLIAGDELPSPEYHEVTD 60 >gi|289805854|ref|ZP_06536483.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Typhi str. AG3] Length = 60 Score = 34.7 bits (78), Expect = 4.2, Method: Compositional matrix adjust. Identities = 18/40 (45%), Positives = 21/40 (52%), Gaps = 4/40 (10%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIA 48 CP C K G + F PFCS +C+ IDL W E IA Sbjct: 6 CPTCGKPVVWGEISPFRPFCSKRCQLIDLGEWAAEEKRIA 45 >gi|161504734|ref|YP_001571846.1| zinc-binding protein [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980] gi|189040673|sp|A9MQA6|YACG_SALAR RecName: Full=UPF0243 zinc-binding protein yacG gi|160866081|gb|ABX22704.1| hypothetical protein SARI_02857 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] Length = 63 Score = 34.7 bits (78), Expect = 4.3, Method: Compositional matrix adjust. Identities = 18/40 (45%), Positives = 21/40 (52%), Gaps = 4/40 (10%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIA 48 CP C K G + F PFCS +C+ IDL W E IA Sbjct: 9 CPTCGKPVVWGEVSPFRPFCSKRCQLIDLGEWAAEEKRIA 48 >gi|296113413|ref|YP_003627351.1| hypothetical protein MCR_1194 [Moraxella catarrhalis RH4] gi|295921107|gb|ADG61458.1| conserved hypothetical protein [Moraxella catarrhalis RH4] gi|326559257|gb|EGE09688.1| hypothetical protein E9M_09494 [Moraxella catarrhalis 46P47B1] gi|326559896|gb|EGE10296.1| hypothetical protein E9G_07670 [Moraxella catarrhalis 7169] gi|326566594|gb|EGE16737.1| hypothetical protein E9O_01902 [Moraxella catarrhalis 12P80B1] gi|326569619|gb|EGE19671.1| hypothetical protein E9Q_01688 [Moraxella catarrhalis BC1] gi|326570098|gb|EGE20143.1| hypothetical protein E9U_04345 [Moraxella catarrhalis BC8] gi|326574385|gb|EGE24327.1| hypothetical protein E9Y_05437 [Moraxella catarrhalis 101P30B1] Length = 61 Score = 34.7 bits (78), Expect = 4.3, Method: Compositional matrix adjust. Identities = 18/37 (48%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Query: 26 PFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE-EEVKD 61 PFCS +C+ IDL W EY+IA E E EV D Sbjct: 24 PFCSKRCKLIDLGAWASDEYLIAGDELPSPEHHEVTD 60 >gi|226939595|ref|YP_002794668.1| hypothetical protein LHK_00666 [Laribacter hongkongensis HLHK9] gi|226714521|gb|ACO73659.1| DUF329 domain containing protein [Laribacter hongkongensis HLHK9] Length = 61 Score = 34.7 bits (78), Expect = 4.3, Method: Compositional matrix adjust. Identities = 19/53 (35%), Positives = 26/53 (49%), Gaps = 5/53 (9%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP C G + PFCS +C+ IDL +W Y I A ED ++ + D Sbjct: 7 CPTCGAAVEWGPQSPWRPFCSQRCKLIDLGQWADEGYRIPA-EDGQNPPDDPD 58 >gi|71909319|ref|YP_286906.1| hypothetical protein Daro_3707 [Dechloromonas aromatica RCB] gi|123626452|sp|Q479P5|Y3707_DECAR RecName: Full=UPF0243 zinc-binding protein Daro_3707 gi|71848940|gb|AAZ48436.1| Protein of unknown function DUF329 [Dechloromonas aromatica RCB] Length = 65 Score = 34.7 bits (78), Expect = 4.4, Method: Compositional matrix adjust. Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 4/47 (8%) Query: 10 KSICPECRKGSMV----EFYPFCSTQCRSIDLSRWLHGEYVIAAVED 52 K CP+C K ++ + PFCS +C+ IDL W Y I +D Sbjct: 5 KVRCPQCGKDALWAPENPWRPFCSERCKQIDLGCWASDSYRIPVPDD 51 >gi|311280920|ref|YP_003943151.1| hypothetical protein Entcl_3626 [Enterobacter cloacae SCF1] gi|308750115|gb|ADO49867.1| protein of unknown function DUF329 [Enterobacter cloacae SCF1] Length = 64 Score = 34.7 bits (78), Expect = 4.5, Method: Compositional matrix adjust. Identities = 18/44 (40%), Positives = 21/44 (47%), Gaps = 4/44 (9%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVED 52 CP C K G F PFCS +C+ IDL W E I + D Sbjct: 9 CPTCGKTVIWGEQSPFRPFCSKRCQLIDLGEWAAEEKRIPSSGD 52 >gi|37527507|ref|NP_930851.1| zinc-binding protein [Photorhabdus luminescens subsp. laumondii TTO1] gi|47117427|sp|Q7N157|Y3643_PHOLL RecName: Full=UPF0243 zinc-binding protein plu3643 gi|36786942|emb|CAE16016.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii TTO1] Length = 65 Score = 34.7 bits (78), Expect = 4.5, Method: Compositional matrix adjust. Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 4/41 (9%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAA 49 CP C K G + + PFCS +C+ IDL +W + E I + Sbjct: 9 CPTCGKTVVWGEISPYRPFCSKRCQLIDLGQWANEEKRIPS 49 >gi|322834408|ref|YP_004214435.1| hypothetical protein Rahaq_3719 [Rahnella sp. Y9602] gi|321169609|gb|ADW75308.1| protein of unknown function DUF329 [Rahnella sp. Y9602] Length = 65 Score = 34.7 bits (78), Expect = 4.6, Method: Compositional matrix adjust. Identities = 21/56 (37%), Positives = 28/56 (50%), Gaps = 9/56 (16%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVE-----DEKSEEEV 59 CP C+K G + PFCS +C+ IDL W E I + D+ SEEE+ Sbjct: 10 CPTCQKIVVWGEQSPYRPFCSKRCQLIDLGEWADEEKRIPSKGDVNDLDDWSEEEI 65 >gi|157373561|ref|YP_001472161.1| hypothetical protein Ssed_0420 [Shewanella sediminis HAW-EB3] gi|189040283|sp|A8FQB0|Y420_SHESH RecName: Full=UPF0243 zinc-binding protein Ssed_0420 gi|157315935|gb|ABV35033.1| protein of unknown function DUF329 [Shewanella sediminis HAW-EB3] Length = 70 Score = 34.7 bits (78), Expect = 4.6, Method: Compositional matrix adjust. Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 4/39 (10%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVI 47 CP C+K S +F PFCS +C+ IDL W ++ I Sbjct: 7 CPTCQKEVIWNSESKFKPFCSDRCKLIDLGDWASEKHAI 45 >gi|326560755|gb|EGE11122.1| hypothetical protein E9K_08989 [Moraxella catarrhalis 103P14B1] gi|326576021|gb|EGE25944.1| hypothetical protein E9W_03635 [Moraxella catarrhalis CO72] Length = 61 Score = 34.7 bits (78), Expect = 4.6, Method: Compositional matrix adjust. Identities = 18/37 (48%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Query: 26 PFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE-EEVKD 61 PFCS +C+ IDL W EY+IA E E EV D Sbjct: 24 PFCSKRCKLIDLGAWASDEYLIAGDELPSPEHHEVTD 60 >gi|330811791|ref|YP_004356253.1| hypothetical protein PSEBR_a4830 [Pseudomonas brassicacearum subsp. brassicacearum NFM421] gi|327379899|gb|AEA71249.1| Conserved hypothetical protein [Pseudomonas brassicacearum subsp. brassicacearum NFM421] Length = 68 Score = 34.7 bits (78), Expect = 4.7, Method: Compositional matrix adjust. Identities = 20/50 (40%), Positives = 25/50 (50%), Gaps = 8/50 (16%) Query: 13 CPECRKGSMVE------FYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 CP C G+ VE F PFCS +C+ IDL W E+ I D + E Sbjct: 9 CPTC--GAPVEWSPESKFRPFCSDRCKLIDLGAWASEEHKIPVSPDAEDE 56 >gi|121603682|ref|YP_981011.1| hypothetical protein Pnap_0771 [Polaromonas naphthalenivorans CJ2] gi|120592651|gb|ABM36090.1| protein of unknown function DUF329 [Polaromonas naphthalenivorans CJ2] Length = 68 Score = 34.7 bits (78), Expect = 4.8, Method: Compositional matrix adjust. Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 4/42 (9%) Query: 12 ICPECRKGSMV----EFYPFCSTQCRSIDLSRWLHGEYVIAA 49 +CP C S+ F PFCS +C++IDL W ++ + A Sbjct: 12 VCPGCGGPSVYASSNPFRPFCSERCKNIDLGAWASEDFRLPA 53 >gi|333011488|gb|EGK30902.1| hypothetical protein SFK272_0446 [Shigella flexneri K-272] gi|333021732|gb|EGK40981.1| hypothetical protein SFK227_0103 [Shigella flexneri K-227] Length = 65 Score = 34.7 bits (78), Expect = 5.0, Method: Compositional matrix adjust. Identities = 18/44 (40%), Positives = 21/44 (47%), Gaps = 4/44 (9%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVED 52 CP C K G + F PFCS +C+ IDL W E I D Sbjct: 9 CPTCGKTVVWGEISPFRPFCSKRCQLIDLGEWAAEEKRIPNSGD 52 >gi|160900925|ref|YP_001566507.1| hypothetical protein Daci_5493 [Delftia acidovorans SPH-1] gi|160366509|gb|ABX38122.1| protein of unknown function DUF329 [Delftia acidovorans SPH-1] Length = 87 Score = 34.7 bits (78), Expect = 5.0, Method: Compositional matrix adjust. Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 4/41 (9%) Query: 13 CPECRKGSMV----EFYPFCSTQCRSIDLSRWLHGEYVIAA 49 CP C S+ F PFCS +C IDL W + E+ + A Sbjct: 31 CPTCSGPSLFAPANRFRPFCSERCYQIDLGAWANEEFRVPA 71 >gi|167622405|ref|YP_001672699.1| hypothetical protein Shal_0465 [Shewanella halifaxensis HAW-EB4] gi|189040207|sp|B0TQP7|Y465_SHEHH RecName: Full=UPF0243 zinc-binding protein Shal_0465 gi|167352427|gb|ABZ75040.1| protein of unknown function DUF329 [Shewanella halifaxensis HAW-EB4] Length = 79 Score = 34.3 bits (77), Expect = 5.4, Method: Compositional matrix adjust. Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 4/45 (8%) Query: 8 SLKSICPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIA 48 SL CP C+ + EF PFCS +C+ IDL W + VI Sbjct: 2 SLTVKCPTCQAPVTWSADSEFKPFCSERCKLIDLGDWASEKNVIP 46 >gi|156935380|ref|YP_001439296.1| hypothetical protein ESA_03238 [Cronobacter sakazakii ATCC BAA-894] gi|166229091|sp|A7MQ61|Y3238_ENTS8 RecName: Full=UPF0243 zinc-binding protein ESA_03238 gi|156533634|gb|ABU78460.1| hypothetical protein ESA_03238 [Cronobacter sakazakii ATCC BAA-894] Length = 67 Score = 34.3 bits (77), Expect = 5.5, Method: Compositional matrix adjust. Identities = 18/44 (40%), Positives = 21/44 (47%), Gaps = 4/44 (9%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVED 52 CP C K G F PFCS +C+ IDL W E I + D Sbjct: 10 CPTCGKEVIWGEKSPFRPFCSKRCQLIDLGEWAAEEKRIPSSGD 53 >gi|229588334|ref|YP_002870453.1| zinc-binding protein [Pseudomonas fluorescens SBW25] gi|259647124|sp|C3KE92|Y788_PSEFS RecName: Full=UPF0243 zinc-binding protein PFLU_0788 gi|229360200|emb|CAY47057.1| conserved hypothetical protein [Pseudomonas fluorescens SBW25] Length = 66 Score = 34.3 bits (77), Expect = 5.6, Method: Compositional matrix adjust. Identities = 20/56 (35%), Positives = 27/56 (48%), Gaps = 8/56 (14%) Query: 7 RSLKSICPECRKGSMVEFY------PFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 + L CP C G+ VE+ PFCS +C+ IDL W E+ I D + E Sbjct: 3 QPLTVDCPTC--GAPVEWTAANLNRPFCSDRCKLIDLGAWAAEEHKIPVAPDAEDE 56 >gi|225024583|ref|ZP_03713775.1| hypothetical protein EIKCOROL_01460 [Eikenella corrodens ATCC 23834] gi|224942734|gb|EEG23943.1| hypothetical protein EIKCOROL_01460 [Eikenella corrodens ATCC 23834] Length = 60 Score = 34.3 bits (77), Expect = 5.9, Method: Compositional matrix adjust. Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 4/48 (8%) Query: 13 CPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 CP C+K + + PFCS +C+ IDL W Y I + E+ + Sbjct: 8 CPTCQKPVLWNENSPYRPFCSQRCKMIDLGTWADESYRIPSQEEAPPQ 55 >gi|260775495|ref|ZP_05884392.1| zinc-binding protein [Vibrio coralliilyticus ATCC BAA-450] gi|260608676|gb|EEX34841.1| zinc-binding protein [Vibrio coralliilyticus ATCC BAA-450] Length = 64 Score = 34.3 bits (77), Expect = 6.1, Method: Compositional matrix adjust. Identities = 16/44 (36%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVED 52 CP+C G + PFCS QC+ ID W E I D Sbjct: 9 CPKCGTEVEWGEQSPYRPFCSKQCQMIDFGEWADEENSIPGAPD 52 >gi|94312044|ref|YP_585254.1| hypothetical protein Rmet_3113 [Cupriavidus metallidurans CH34] gi|93355896|gb|ABF09985.1| conserved hypothetical protein [Cupriavidus metallidurans CH34] Length = 63 Score = 34.3 bits (77), Expect = 6.1, Method: Compositional matrix adjust. Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 4/53 (7%) Query: 13 CPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP C K +F PFCS +C+ IDL W +YV E ++ + Sbjct: 7 CPTCGKEVAWVPDNKFRPFCSERCKQIDLGAWASEKYVFGGKPGETPSPDLPE 59 >gi|261211525|ref|ZP_05925813.1| zinc-binding protein [Vibrio sp. RC341] gi|260839480|gb|EEX66106.1| zinc-binding protein [Vibrio sp. RC341] Length = 65 Score = 34.3 bits (77), Expect = 6.4, Method: Compositional matrix adjust. Identities = 16/44 (36%), Positives = 18/44 (40%), Gaps = 4/44 (9%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVED 52 CP+C G PFCS QC+ ID W E I D Sbjct: 10 CPQCGTDVEWGEQSPHRPFCSKQCQMIDFGEWAEEEKAIPGAPD 53 >gi|294139023|ref|YP_003555001.1| hypothetical protein SVI_0252 [Shewanella violacea DSS12] gi|293325492|dbj|BAJ00223.1| conserved hypothetical protein [Shewanella violacea DSS12] Length = 70 Score = 34.3 bits (77), Expect = 6.6, Method: Compositional matrix adjust. Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 4/41 (9%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAA 49 CP C+ S +F PFCS +C+ IDL W ++ I A Sbjct: 7 CPTCQAEVIWNSESKFRPFCSDRCKLIDLGDWASEKHAIPA 47 >gi|157960237|ref|YP_001500271.1| hypothetical protein Spea_0408 [Shewanella pealeana ATCC 700345] gi|189040273|sp|A8GZJ9|Y408_SHEPA RecName: Full=UPF0243 zinc-binding protein Spea_0408 gi|157845237|gb|ABV85736.1| protein of unknown function DUF329 [Shewanella pealeana ATCC 700345] Length = 79 Score = 34.3 bits (77), Expect = 6.7, Method: Compositional matrix adjust. Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 4/44 (9%) Query: 8 SLKSICPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVI 47 SL CP C+ + EF PFCS +C+ IDL W + I Sbjct: 2 SLTVKCPTCQTPVTWNAEAEFKPFCSERCKLIDLGDWASEKNAI 45 >gi|312958902|ref|ZP_07773421.1| zinc-binding protein [Pseudomonas fluorescens WH6] gi|311286672|gb|EFQ65234.1| zinc-binding protein [Pseudomonas fluorescens WH6] Length = 66 Score = 33.9 bits (76), Expect = 6.8, Method: Compositional matrix adjust. Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 8/50 (16%) Query: 13 CPECRKGSMVEF------YPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 CP C G+ VE+ PFCS +C+ IDL W E+ I D + E Sbjct: 9 CPTC--GAPVEWKATNLNRPFCSDRCKLIDLGAWAAEEHKIPVAPDAEDE 56 >gi|309700311|emb|CBI99599.1| putative zinc binding protein [Escherichia coli ETEC H10407] Length = 65 Score = 33.9 bits (76), Expect = 6.8, Method: Compositional matrix adjust. Identities = 18/44 (40%), Positives = 21/44 (47%), Gaps = 4/44 (9%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVED 52 CP C K G + F PFCS C+ IDL W E I + D Sbjct: 9 CPTCGKTVVWGEISPFRPFCSKLCQLIDLGEWAAEEKRIPSSGD 52 >gi|322419465|ref|YP_004198688.1| hypothetical protein GM18_1949 [Geobacter sp. M18] gi|320125852|gb|ADW13412.1| protein of unknown function DUF329 [Geobacter sp. M18] Length = 62 Score = 33.9 bits (76), Expect = 6.9, Method: Compositional matrix adjust. Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 3/52 (5%) Query: 13 CPECRKGSMV---EFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP C++ + + + PFCS +C+ IDL W Y I + E+ +D Sbjct: 9 CPHCKREAQLAGNPYRPFCSERCKMIDLGTWASEGYRIPGEKAPHHEDNDED 60 >gi|262393313|ref|YP_003285167.1| zinc-binding protein [Vibrio sp. Ex25] gi|262336907|gb|ACY50702.1| zinc-binding protein [Vibrio sp. Ex25] Length = 64 Score = 33.9 bits (76), Expect = 6.9, Method: Compositional matrix adjust. Identities = 16/44 (36%), Positives = 18/44 (40%), Gaps = 4/44 (9%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVED 52 CP+C G PFCS QC+ ID W E I D Sbjct: 9 CPQCGADVEWGEQSPHRPFCSKQCQMIDFGEWADEENTIPGAPD 52 >gi|28899303|ref|NP_798908.1| zinc-binding protein [Vibrio parahaemolyticus RIMD 2210633] gi|153838714|ref|ZP_01991381.1| conserved domain protein [Vibrio parahaemolyticus AQ3810] gi|260363570|ref|ZP_05776396.1| conserved domain protein [Vibrio parahaemolyticus K5030] gi|260879005|ref|ZP_05891360.1| conserved domain protein [Vibrio parahaemolyticus AN-5034] gi|260897209|ref|ZP_05905705.1| conserved domain protein [Vibrio parahaemolyticus Peru-466] gi|260900215|ref|ZP_05908610.1| conserved domain protein [Vibrio parahaemolyticus AQ4037] gi|31563243|sp|Q87LT2|Y2529_VIBPA RecName: Full=UPF0243 zinc-binding protein VP2529 gi|28807527|dbj|BAC60792.1| conserved hypothetical protein [Vibrio parahaemolyticus RIMD 2210633] gi|149747874|gb|EDM58752.1| conserved domain protein [Vibrio parahaemolyticus AQ3810] gi|308088449|gb|EFO38144.1| conserved domain protein [Vibrio parahaemolyticus Peru-466] gi|308089595|gb|EFO39290.1| conserved domain protein [Vibrio parahaemolyticus AN-5034] gi|308110275|gb|EFO47815.1| conserved domain protein [Vibrio parahaemolyticus AQ4037] gi|308113408|gb|EFO50948.1| conserved domain protein [Vibrio parahaemolyticus K5030] gi|328474164|gb|EGF44969.1| DNA gyrase inhibitor [Vibrio parahaemolyticus 10329] Length = 64 Score = 33.9 bits (76), Expect = 6.9, Method: Compositional matrix adjust. Identities = 16/44 (36%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVED 52 CP+C G PFCS +C+ ID W E IA D Sbjct: 9 CPQCGTDVEWGEQSPHRPFCSKKCQMIDFGEWADEENAIAGAPD 52 >gi|293392848|ref|ZP_06637166.1| conserved hypothetical protein [Serratia odorifera DSM 4582] gi|291424707|gb|EFE97918.1| conserved hypothetical protein [Serratia odorifera DSM 4582] Length = 65 Score = 33.9 bits (76), Expect = 7.5, Method: Compositional matrix adjust. Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 4/50 (8%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C KG + + PFCS +C+ IDL W E I + D +E Sbjct: 7 CPTCGKGVVWGEVSPYRPFCSKRCQLIDLGEWADEEKRIPSNGDLNESDE 56 >gi|238918689|ref|YP_002932203.1| hypothetical protein NT01EI_0747 [Edwardsiella ictaluri 93-146] gi|259647116|sp|C5B9G7|Y747_EDWI9 RecName: Full=UPF0243 zinc-binding protein NT01EI_0747 gi|238868257|gb|ACR67968.1| conserved hypothetical protein [Edwardsiella ictaluri 93-146] Length = 66 Score = 33.9 bits (76), Expect = 7.7, Method: Compositional matrix adjust. Identities = 18/54 (33%), Positives = 25/54 (46%), Gaps = 4/54 (7%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 CP C G + PFCS +C+ IDL W + E IA+ EE ++ Sbjct: 10 CPTCGSAVIWGEQSPYRPFCSKRCQLIDLGEWANEEKRIASDATHSDSEEWSEV 63 >gi|119897020|ref|YP_932233.1| hypothetical protein azo0729 [Azoarcus sp. BH72] gi|119669433|emb|CAL93346.1| conserved hypothetical protein [Azoarcus sp. BH72] Length = 66 Score = 33.9 bits (76), Expect = 7.7, Method: Compositional matrix adjust. Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 8/50 (16%) Query: 13 CPECRKGSMVE------FYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 CP C G+ V + PFCS +CR IDL W EY + + ++ Sbjct: 11 CPTC--GAQVPWVPESRYRPFCSARCRQIDLGAWASEEYKVPTSPPDDTD 58 >gi|218671897|ref|ZP_03521566.1| zinc-binding protein [Rhizobium etli GR56] Length = 40 Score = 33.9 bits (76), Expect = 7.7, Method: Compositional matrix adjust. Identities = 14/21 (66%), Positives = 15/21 (71%) Query: 13 CPECRKGSMVEFYPFCSTQCR 33 CPEC K S E YPFCS +CR Sbjct: 20 CPECGKQSNREHYPFCSNRCR 40 >gi|196228934|ref|ZP_03127800.1| protein of unknown function DUF329 [Chthoniobacter flavus Ellin428] gi|196227215|gb|EDY21719.1| protein of unknown function DUF329 [Chthoniobacter flavus Ellin428] Length = 70 Score = 33.9 bits (76), Expect = 7.7, Method: Compositional matrix adjust. Identities = 15/41 (36%), Positives = 26/41 (63%), Gaps = 7/41 (17%) Query: 13 CPECRKGSMVEFY-----PFCSTQCRSIDLSRWLHGEYVIA 48 CP C++ + +F+ PFCS +C+ +DL +WL EY ++ Sbjct: 9 CPICQREN--DFFAEPVGPFCSNRCKMVDLGKWLGEEYRVS 47 >gi|147673953|ref|YP_001217930.1| zinc-binding protein [Vibrio cholerae O395] gi|153214087|ref|ZP_01949221.1| conserved hypothetical protein [Vibrio cholerae 1587] gi|153802790|ref|ZP_01957376.1| conserved hypothetical protein [Vibrio cholerae MZO-3] gi|153827236|ref|ZP_01979903.1| conserved hypothetical protein [Vibrio cholerae MZO-2] gi|153830650|ref|ZP_01983317.1| conserved hypothetical protein [Vibrio cholerae 623-39] gi|229514055|ref|ZP_04403517.1| hypothetical protein VCB_001702 [Vibrio cholerae TMA 21] gi|229521257|ref|ZP_04410677.1| hypothetical protein VIF_001783 [Vibrio cholerae TM 11079-80] gi|229524414|ref|ZP_04413819.1| hypothetical protein VCA_002006 [Vibrio cholerae bv. albensis VL426] gi|229527035|ref|ZP_04416430.1| hypothetical protein VCG_000101 [Vibrio cholerae 12129(1)] gi|258625149|ref|ZP_05720066.1| conserved hypothetical protein [Vibrio mimicus VM603] gi|262168409|ref|ZP_06036106.1| zinc-binding protein [Vibrio cholerae RC27] gi|262170625|ref|ZP_06038303.1| hypothetical protein VII_001436 [Vibrio mimicus MB-451] gi|262404741|ref|ZP_06081296.1| zinc-binding protein [Vibrio sp. RC586] gi|297581053|ref|ZP_06942978.1| conserved hypothetical protein [Vibrio cholerae RC385] gi|124115513|gb|EAY34333.1| conserved hypothetical protein [Vibrio cholerae 1587] gi|124121655|gb|EAY40398.1| conserved hypothetical protein [Vibrio cholerae MZO-3] gi|146315836|gb|ABQ20375.1| conserved hypothetical protein [Vibrio cholerae O395] gi|148873859|gb|EDL71994.1| conserved hypothetical protein [Vibrio cholerae 623-39] gi|149738850|gb|EDM53186.1| conserved hypothetical protein [Vibrio cholerae MZO-2] gi|227014321|gb|ACP10531.1| conserved hypothetical protein [Vibrio cholerae O395] gi|229335432|gb|EEO00914.1| hypothetical protein VCG_000101 [Vibrio cholerae 12129(1)] gi|229337995|gb|EEO03012.1| hypothetical protein VCA_002006 [Vibrio cholerae bv. albensis VL426] gi|229341789|gb|EEO06791.1| hypothetical protein VIF_001783 [Vibrio cholerae TM 11079-80] gi|229349236|gb|EEO14193.1| hypothetical protein VCB_001702 [Vibrio cholerae TMA 21] gi|258582600|gb|EEW07432.1| conserved hypothetical protein [Vibrio mimicus VM603] gi|261891701|gb|EEY37687.1| hypothetical protein VII_001436 [Vibrio mimicus MB-451] gi|262023301|gb|EEY42005.1| zinc-binding protein [Vibrio cholerae RC27] gi|262349773|gb|EEY98911.1| zinc-binding protein [Vibrio sp. RC586] gi|297534879|gb|EFH73715.1| conserved hypothetical protein [Vibrio cholerae RC385] Length = 65 Score = 33.9 bits (76), Expect = 7.7, Method: Compositional matrix adjust. Identities = 16/44 (36%), Positives = 18/44 (40%), Gaps = 4/44 (9%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVED 52 CP+C G PFCS QC+ ID W E I D Sbjct: 10 CPQCGTDVEWGEQSPHRPFCSKQCQMIDFGEWADEEKAIPGAPD 53 >gi|121729931|ref|ZP_01682353.1| conserved hypothetical protein [Vibrio cholerae V52] gi|121628319|gb|EAX60826.1| conserved hypothetical protein [Vibrio cholerae V52] Length = 65 Score = 33.9 bits (76), Expect = 7.8, Method: Compositional matrix adjust. Identities = 16/44 (36%), Positives = 18/44 (40%), Gaps = 4/44 (9%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVED 52 CP+C G PFCS QC+ ID W E I D Sbjct: 10 CPQCGTDVEWGEQSPHRPFCSKQCQMIDFGEWADEEKAIPGAPD 53 >gi|110833471|ref|YP_692330.1| hypothetical protein ABO_0610 [Alcanivorax borkumensis SK2] gi|110646582|emb|CAL16058.1| conserved hypothetical protein [Alcanivorax borkumensis SK2] Length = 66 Score = 33.9 bits (76), Expect = 8.3, Method: Compositional matrix adjust. Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 3/49 (6%) Query: 13 CPECR---KGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP+C+ + + PFCS +C+ IDL W + I +D + E Sbjct: 16 CPQCKSLTRWDNNAWRPFCSERCKLIDLGDWATERHAIPGADDAPGDFE 64 >gi|254291775|ref|ZP_04962560.1| conserved hypothetical protein [Vibrio cholerae AM-19226] gi|150422287|gb|EDN14249.1| conserved hypothetical protein [Vibrio cholerae AM-19226] Length = 65 Score = 33.9 bits (76), Expect = 8.5, Method: Compositional matrix adjust. Identities = 16/44 (36%), Positives = 18/44 (40%), Gaps = 4/44 (9%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVED 52 CP+C G PFCS QC+ ID W E I D Sbjct: 10 CPQCGTDVEWGEQSPHRPFCSKQCQMIDFGEWADEEKAIPGAPD 53 >gi|71065617|ref|YP_264344.1| hypothetical protein Psyc_1058 [Psychrobacter arcticus 273-4] gi|71038602|gb|AAZ18910.1| conserved hypothetical protein [Psychrobacter arcticus 273-4] Length = 65 Score = 33.5 bits (75), Expect = 8.9, Method: Compositional matrix adjust. Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 3/48 (6%) Query: 13 CPECRKGSMVE---FYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP C ++ + + PFCS +C+ IDL W + +Y + + S+E Sbjct: 17 CPRCGTQTLWQDNKYKPFCSHRCKLIDLGAWANEDYTLPSESTPFSDE 64 >gi|91776580|ref|YP_546336.1| hypothetical protein Mfla_2228 [Methylobacillus flagellatus KT] gi|91710567|gb|ABE50495.1| protein of unknown function DUF329 [Methylobacillus flagellatus KT] Length = 62 Score = 33.5 bits (75), Expect = 9.2, Method: Compositional matrix adjust. Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 4/50 (8%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP+C + S + PFCS +CR IDL +W Y I + + E Sbjct: 11 CPQCGELSEYSSANPYRPFCSERCRLIDLGQWASESYRIPDNNPKPDDSE 60 >gi|183599890|ref|ZP_02961383.1| hypothetical protein PROSTU_03411 [Providencia stuartii ATCC 25827] gi|188022165|gb|EDU60205.1| hypothetical protein PROSTU_03411 [Providencia stuartii ATCC 25827] Length = 65 Score = 33.5 bits (75), Expect = 9.5, Method: Compositional matrix adjust. Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 4/44 (9%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVED 52 CP C+K G + PFCS +C+ IDL W E I + D Sbjct: 9 CPTCQKVVVWGEESPYRPFCSKRCQLIDLGEWAAEEKRITSQGD 52 >gi|329912561|ref|ZP_08275776.1| zinc-binding protein [Oxalobacteraceae bacterium IMCC9480] gi|327545591|gb|EGF30759.1| zinc-binding protein [Oxalobacteraceae bacterium IMCC9480] Length = 60 Score = 33.5 bits (75), Expect = 9.6, Method: Compositional matrix adjust. Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 8/43 (18%) Query: 13 CPECRKGSMVE------FYPFCSTQCRSIDLSRWLHGEYVIAA 49 CP C G+ VE + PFCS +C+ IDL W +Y I Sbjct: 3 CPTC--GTKVEWSEASKYRPFCSERCKQIDLGAWAEEKYTIPG 43 >gi|163751663|ref|ZP_02158883.1| hypothetical protein KT99_07414 [Shewanella benthica KT99] gi|161328489|gb|EDP99644.1| hypothetical protein KT99_07414 [Shewanella benthica KT99] Length = 70 Score = 33.5 bits (75), Expect = 9.8, Method: Compositional matrix adjust. Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 4/41 (9%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAA 49 CP C+ S +F PFCS +C+ IDL W ++VI Sbjct: 7 CPTCQTEVIWNSESKFRPFCSDRCKLIDLGDWASEKHVIPV 47 >gi|152996339|ref|YP_001341174.1| hypothetical protein Mmwyl1_2317 [Marinomonas sp. MWYL1] gi|150837263|gb|ABR71239.1| protein of unknown function DUF329 [Marinomonas sp. MWYL1] Length = 74 Score = 33.5 bits (75), Expect = 10.0, Method: Compositional matrix adjust. Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 4/55 (7%) Query: 13 CPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDIL 63 CP C+K S PFCS +C+ IDL W Y I E+ E +D++ Sbjct: 12 CPTCQKKSPWSKENPDRPFCSPRCKLIDLGAWASESYAIPQQTSEEDEIFSEDLV 66 Searching..................................................done Results from round 2 >gi|254780469|ref|YP_003064882.1| zinc-binding protein [Candidatus Liberibacter asiaticus str. psy62] gi|254040146|gb|ACT56942.1| zinc-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 63 Score = 92.4 bits (228), Expect = 2e-17, Method: Composition-based stats. Identities = 63/63 (100%), Positives = 63/63 (100%) Query: 1 MQTSDFRSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK 60 MQTSDFRSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK Sbjct: 1 MQTSDFRSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK 60 Query: 61 DIL 63 DIL Sbjct: 61 DIL 63 >gi|110632547|ref|YP_672755.1| zinc-binding protein [Mesorhizobium sp. BNC1] gi|110283531|gb|ABG61590.1| protein of unknown function DUF329 [Chelativorans sp. BNC1] Length = 70 Score = 80.9 bits (198), Expect = 6e-14, Method: Composition-based stats. Identities = 28/53 (52%), Positives = 33/53 (62%) Query: 10 KSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 K CPEC K S EFYPFCS +C+ IDL+RWL G YVI E+ E+E Sbjct: 17 KRPCPECGKPSSREFYPFCSKRCKDIDLNRWLSGSYVIPGRPAEEEEDESGSA 69 >gi|154246663|ref|YP_001417621.1| hypothetical protein Xaut_2724 [Xanthobacter autotrophicus Py2] gi|154160748|gb|ABS67964.1| protein of unknown function DUF329 [Xanthobacter autotrophicus Py2] Length = 76 Score = 79.3 bits (194), Expect = 2e-13, Method: Composition-based stats. Identities = 24/58 (41%), Positives = 32/58 (55%) Query: 4 SDFRSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 S R + CP C K S F+PFCS +C +DL RWL G Y I +E+ + E +D Sbjct: 17 SASRYVSKPCPICSKPSAERFHPFCSKRCADVDLHRWLSGSYAIPGRPEEEEDGEAQD 74 >gi|49476076|ref|YP_034117.1| zinc-binding protein [Bartonella henselae str. Houston-1] gi|49238884|emb|CAF28177.1| hypothetical protein BH14120 [Bartonella henselae str. Houston-1] Length = 94 Score = 79.3 bits (194), Expect = 2e-13, Method: Composition-based stats. Identities = 23/60 (38%), Positives = 38/60 (63%), Gaps = 2/60 (3%) Query: 1 MQTSDFRSLKSI--CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 ++ ++ S++ CP C + + YPFCST+CR+IDL+RWL G Y++ + + EEE Sbjct: 35 VKQTEISSIRPPHLCPICGQMAQQNAYPFCSTRCRAIDLNRWLSGSYILPPLPQKADEEE 94 >gi|27376371|ref|NP_767900.1| zinc-binding protein [Bradyrhizobium japonicum USDA 110] gi|31563248|sp|Q89UZ9|Y1260_BRAJA RecName: Full=UPF0243 zinc-binding protein bsr1260 gi|27349511|dbj|BAC46525.1| bsr1260 [Bradyrhizobium japonicum USDA 110] Length = 60 Score = 78.5 bits (192), Expect = 3e-13, Method: Composition-based stats. Identities = 22/48 (45%), Positives = 31/48 (64%) Query: 11 SICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K ++ +PFCS++CR +DL+RWL G YVI +DE + E Sbjct: 13 KTCPICGKPAVQATHPFCSSRCRDVDLNRWLKGSYVIPGRDDEVDDVE 60 >gi|163761349|ref|ZP_02168424.1| zinc-binding protein [Hoeflea phototrophica DFL-43] gi|162281506|gb|EDQ31802.1| zinc-binding protein [Hoeflea phototrophica DFL-43] Length = 67 Score = 77.8 bits (190), Expect = 4e-13, Method: Composition-based stats. Identities = 26/50 (52%), Positives = 33/50 (66%) Query: 12 ICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CPEC++ S E YPFCS +CR+IDL+RWL G Y I E E + +E D Sbjct: 15 PCPECKRPSTRESYPFCSERCRNIDLNRWLGGSYAIPVTEVEDNHDEDFD 64 >gi|319899329|ref|YP_004159426.1| hypothetical protein BARCL_1184 [Bartonella clarridgeiae 73] gi|319403297|emb|CBI76856.1| conserved protein of unknown function [Bartonella clarridgeiae 73] Length = 74 Score = 77.8 bits (190), Expect = 5e-13, Method: Composition-based stats. Identities = 27/58 (46%), Positives = 39/58 (67%), Gaps = 1/58 (1%) Query: 1 MQTSDFRSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 +Q ++ RS + CPEC K S + YPFCS++CR++DL+RWL G YV+ + EEE Sbjct: 18 LQKNNLRSSR-PCPECGKISQQDSYPFCSSRCRAVDLNRWLSGAYVLPPPPQKTDEEE 74 >gi|15964369|ref|NP_384722.1| zinc-binding protein [Sinorhizobium meliloti 1021] gi|307307087|ref|ZP_07586826.1| protein of unknown function DUF329 [Sinorhizobium meliloti BL225C] gi|307321489|ref|ZP_07600885.1| protein of unknown function DUF329 [Sinorhizobium meliloti AK83] gi|31563281|sp|Q92S21|Y616_RHIME RecName: Full=UPF0243 zinc-binding protein R00616 gi|15073546|emb|CAC45188.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021] gi|306892874|gb|EFN23664.1| protein of unknown function DUF329 [Sinorhizobium meliloti AK83] gi|306902027|gb|EFN32626.1| protein of unknown function DUF329 [Sinorhizobium meliloti BL225C] Length = 70 Score = 77.8 bits (190), Expect = 5e-13, Method: Composition-based stats. Identities = 22/60 (36%), Positives = 33/60 (55%) Query: 2 QTSDFRSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 + C EC + S+ E YPFCS +CR++DL+RWL G Y I +DE ++ + Sbjct: 10 SNVEPLRATRPCAECGRPSVREHYPFCSERCRNVDLNRWLSGSYAIPVADDESKADDGDE 69 >gi|240851126|ref|YP_002972528.1| zinc-binding protein [Bartonella grahamii as4aup] gi|240268249|gb|ACS51837.1| zinc-binding protein [Bartonella grahamii as4aup] Length = 94 Score = 77.4 bits (189), Expect = 6e-13, Method: Composition-based stats. Identities = 23/49 (46%), Positives = 30/49 (61%) Query: 10 KSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C + S YPFCST+CR+IDL+RWL G Y++ + EEE Sbjct: 46 PHPCPICGQMSQQNAYPFCSTRCRAIDLNRWLSGAYILPPPPQKSDEEE 94 >gi|319407683|emb|CBI81331.1| conserved hypothetical protein [Bartonella sp. 1-1C] Length = 74 Score = 77.4 bits (189), Expect = 6e-13, Method: Composition-based stats. Identities = 27/57 (47%), Positives = 37/57 (64%), Gaps = 1/57 (1%) Query: 2 QTSDFRSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 Q ++ R + CPEC K S + YPFCS++CR+IDL+RWL G YV+ + EEE Sbjct: 19 QKNNLRPSR-PCPECGKMSQQDSYPFCSSRCRAIDLNRWLSGAYVLPPPPQKTDEEE 74 >gi|150395440|ref|YP_001325907.1| zinc-binding protein [Sinorhizobium medicae WSM419] gi|166227666|sp|A6U5Z2|Y213_SINMW RecName: Full=UPF0243 zinc-binding protein Smed_0213 gi|150026955|gb|ABR59072.1| protein of unknown function DUF329 [Sinorhizobium medicae WSM419] Length = 70 Score = 76.6 bits (187), Expect = 1e-12, Method: Composition-based stats. Identities = 24/61 (39%), Positives = 36/61 (59%), Gaps = 2/61 (3%) Query: 3 TSDFRSLK--SICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK 60 S+ L+ C EC + S+ E YPFCS +CR++DL+RWL G Y I +DE ++ Sbjct: 9 ASNVEPLRATRPCAECGRPSVREHYPFCSERCRNVDLNRWLSGSYAIPVADDESKADDED 68 Query: 61 D 61 + Sbjct: 69 E 69 >gi|126726689|ref|ZP_01742529.1| hypothetical protein RB2150_17204 [Rhodobacterales bacterium HTCC2150] gi|126704018|gb|EBA03111.1| hypothetical protein RB2150_17204 [Rhodobacterales bacterium HTCC2150] Length = 60 Score = 76.2 bits (186), Expect = 1e-12, Method: Composition-based stats. Identities = 24/50 (48%), Positives = 34/50 (68%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 CP C+K ++VEF PFCS +C IDL RW+ G+Y I AV+++ +E I Sbjct: 3 CPICKKSTVVEFRPFCSLRCADIDLGRWVTGKYAIPAVDEDSIDEAADAI 52 >gi|319406203|emb|CBI79840.1| conserved hypothetical protein [Bartonella sp. AR 15-3] Length = 74 Score = 75.8 bits (185), Expect = 2e-12, Method: Composition-based stats. Identities = 26/58 (44%), Positives = 37/58 (63%), Gaps = 1/58 (1%) Query: 1 MQTSDFRSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 +Q ++ R + CPEC K S + YPFCS +CR+IDL+RWL G Y++ + EEE Sbjct: 18 LQKNNLRPSR-PCPECGKMSQQDSYPFCSARCRAIDLNRWLSGAYILPPPPQKTDEEE 74 >gi|49474628|ref|YP_032670.1| zinc-binding protein [Bartonella quintana str. Toulouse] gi|49240132|emb|CAF26579.1| hypothetical protein BQ11180 [Bartonella quintana str. Toulouse] Length = 100 Score = 75.8 bits (185), Expect = 2e-12, Method: Composition-based stats. Identities = 20/57 (35%), Positives = 31/57 (54%) Query: 2 QTSDFRSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 + + CP C + + YPFCST+C++IDL+RWL G Y+ + EE+ Sbjct: 44 KKTSPTRPPHPCPICGQMAQQNVYPFCSTRCQAIDLNRWLSGSYIFPPPLQKTDEEK 100 >gi|260431289|ref|ZP_05785260.1| conserved domain protein [Silicibacter lacuscaerulensis ITI-1157] gi|260415117|gb|EEX08376.1| conserved domain protein [Silicibacter lacuscaerulensis ITI-1157] Length = 60 Score = 75.8 bits (185), Expect = 2e-12, Method: Composition-based stats. Identities = 20/51 (39%), Positives = 33/51 (64%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDIL 63 CP C + ++ F PFCS +C IDL +WL+G Y + + +E +EE++D + Sbjct: 3 CPICGEDTVKPFRPFCSKRCADIDLGKWLNGSYAVPSQREEDVDEEIQDAV 53 >gi|154250985|ref|YP_001411809.1| hypothetical protein Plav_0529 [Parvibaculum lavamentivorans DS-1] gi|154154935|gb|ABS62152.1| protein of unknown function DUF329 [Parvibaculum lavamentivorans DS-1] Length = 75 Score = 75.5 bits (184), Expect = 2e-12, Method: Composition-based stats. Identities = 23/51 (45%), Positives = 29/51 (56%) Query: 10 KSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK 60 CP C + S+ EF+PFCS C +DL+RWL G Y I AVE +E Sbjct: 14 PRPCPICARKSVPEFHPFCSKHCADVDLNRWLKGGYAIPAVEPPDEWDEAS 64 >gi|227820811|ref|YP_002824781.1| zinc-binding protein [Sinorhizobium fredii NGR234] gi|254801295|sp|C3MFX7|Y229_RHISN RecName: Full=UPF0243 zinc-binding protein NGR_c02290 gi|227339810|gb|ACP24028.1| hypothetical protein contains zinc-binding domain [Sinorhizobium fredii NGR234] Length = 69 Score = 75.1 bits (183), Expect = 3e-12, Method: Composition-based stats. Identities = 25/57 (43%), Positives = 36/57 (63%), Gaps = 2/57 (3%) Query: 4 SDFRSLKS--ICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 S+ L+ CPEC + S+ E YPFCS +CR++DL+RWL G Y I +DE ++ Sbjct: 10 SNVEPLRPTRPCPECGRPSVRERYPFCSERCRNVDLNRWLSGSYAIPVADDESKADD 66 >gi|84499989|ref|ZP_00998255.1| hypothetical protein OB2597_08614 [Oceanicola batsensis HTCC2597] gi|84391923|gb|EAQ04191.1| hypothetical protein OB2597_08614 [Oceanicola batsensis HTCC2597] Length = 66 Score = 74.7 bits (182), Expect = 4e-12, Method: Composition-based stats. Identities = 21/50 (42%), Positives = 27/50 (54%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 CP C K S + PFCS C +DL+RW G Y I + E EE ++ I Sbjct: 3 CPICHKPSEATYRPFCSKHCADVDLARWFKGGYTIPSTNPEDVEEAIEAI 52 >gi|315122075|ref|YP_004062564.1| zinc-binding protein [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495477|gb|ADR52076.1| zinc-binding protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 62 Score = 74.7 bits (182), Expect = 4e-12, Method: Composition-based stats. Identities = 34/58 (58%), Positives = 41/58 (70%) Query: 1 MQTSDFRSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 MQ SD ++ +CPECRK S+ FYPFCST+CRSIDLSRWL YVI E+E +E Sbjct: 1 MQKSDCELVRCLCPECRKDSVSAFYPFCSTRCRSIDLSRWLSDGYVIVRTENEAFNKE 58 >gi|295690489|ref|YP_003594182.1| hypothetical protein Cseg_3124 [Caulobacter segnis ATCC 21756] gi|295432392|gb|ADG11564.1| protein of unknown function DUF329 [Caulobacter segnis ATCC 21756] Length = 57 Score = 74.7 bits (182), Expect = 4e-12, Method: Composition-based stats. Identities = 20/54 (37%), Positives = 28/54 (51%) Query: 9 LKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 + + CP C K F PFCS +C +DL RWL G YV+ +D+ + I Sbjct: 1 MSTGCPICGKPVEKAFRPFCSKRCADVDLQRWLVGRYVVPGGDDDAENPSSEAI 54 >gi|99078527|ref|YP_611785.1| hypothetical protein TM1040_3554 [Ruegeria sp. TM1040] gi|99035665|gb|ABF62523.1| protein of unknown function DUF329 [Ruegeria sp. TM1040] Length = 60 Score = 74.7 bits (182), Expect = 4e-12, Method: Composition-based stats. Identities = 18/49 (36%), Positives = 29/49 (59%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP C K + PFCS +C +DL++WL+G Y + + + E E ++D Sbjct: 3 CPICGKPTQQSVRPFCSKRCADLDLAKWLNGAYAVPSEDQEDLENALED 51 >gi|239831086|ref|ZP_04679415.1| zinc-binding protein [Ochrobactrum intermedium LMG 3301] gi|239823353|gb|EEQ94921.1| zinc-binding protein [Ochrobactrum intermedium LMG 3301] Length = 71 Score = 74.7 bits (182), Expect = 5e-12, Method: Composition-based stats. Identities = 26/48 (54%), Positives = 32/48 (66%) Query: 11 SICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CPEC K S E YPFCS +C+SIDL+RWL G YV+ ++ EEE Sbjct: 22 RPCPECGKPSTRESYPFCSPRCKSIDLNRWLSGSYVLPGKPIDEEEEE 69 >gi|86356238|ref|YP_468130.1| zinc-binding protein [Rhizobium etli CFN 42] gi|123513090|sp|Q2KCN3|Y586_RHIEC RecName: Full=UPF0243 zinc-binding protein RHE_CH00586 gi|86280340|gb|ABC89403.1| hypothetical conserved protein [Rhizobium etli CFN 42] Length = 70 Score = 74.3 bits (181), Expect = 5e-12, Method: Composition-based stats. Identities = 25/55 (45%), Positives = 30/55 (54%) Query: 3 TSDFRSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 + CPEC K S E YPFCS +CR +DLSRWL G Y I +DE + Sbjct: 10 KVEPLRKTRPCPECGKPSNREHYPFCSNRCREVDLSRWLTGSYAIPVADDETKAD 64 >gi|316936027|ref|YP_004111009.1| hypothetical protein Rpdx1_4729 [Rhodopseudomonas palustris DX-1] gi|315603741|gb|ADU46276.1| protein of unknown function DUF329 [Rhodopseudomonas palustris DX-1] Length = 64 Score = 73.9 bits (180), Expect = 6e-12, Method: Composition-based stats. Identities = 20/47 (42%), Positives = 27/47 (57%) Query: 11 SICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP C K + E +PFCS +CR +DL+RWL G Y I + E+ Sbjct: 18 KPCPVCGKPATAESHPFCSERCRDVDLNRWLSGSYAIPGRPADDEED 64 >gi|209547853|ref|YP_002279770.1| zinc-binding protein [Rhizobium leguminosarum bv. trifolii WSM2304] gi|254801337|sp|B5ZPM7|Y244_RHILW RecName: Full=UPF0243 zinc-binding protein Rleg2_0244 gi|209533609|gb|ACI53544.1| protein of unknown function DUF329 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 70 Score = 73.9 bits (180), Expect = 7e-12, Method: Composition-based stats. Identities = 26/55 (47%), Positives = 30/55 (54%) Query: 3 TSDFRSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 + CPEC K S E YPFCS +CR +DLSRWL G Y I +DE E Sbjct: 10 KVEPLRKARPCPECGKPSHREHYPFCSNRCREVDLSRWLTGAYAIPVADDETKAE 64 >gi|192293376|ref|YP_001993981.1| zinc-binding protein [Rhodopseudomonas palustris TIE-1] gi|192287125|gb|ACF03506.1| protein of unknown function DUF329 [Rhodopseudomonas palustris TIE-1] Length = 60 Score = 73.9 bits (180), Expect = 8e-12, Method: Composition-based stats. Identities = 20/55 (36%), Positives = 29/55 (52%) Query: 3 TSDFRSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 R+ CP C K + + +PFCS +CR +DL+RWL G Y I + E+ Sbjct: 6 ARPKRNGAKPCPVCGKPATAQSHPFCSERCRDVDLNRWLSGAYAIPGRLADDEED 60 >gi|89055358|ref|YP_510809.1| hypothetical protein Jann_2867 [Jannaschia sp. CCS1] gi|88864907|gb|ABD55784.1| protein of unknown function DUF329 [Jannaschia sp. CCS1] Length = 60 Score = 73.5 bits (179), Expect = 8e-12, Method: Composition-based stats. Identities = 17/51 (33%), Positives = 31/51 (60%) Query: 12 ICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 CP C K + + PFCS +C ++DL RWL+G Y + + + + E+ +++ Sbjct: 2 PCPICEKETDAAYRPFCSKRCANVDLGRWLNGAYAVPSTDPDDIEQALEEA 52 >gi|121601685|ref|YP_988549.1| hypothetical protein BARBAKC583_0213 [Bartonella bacilliformis KC583] gi|120613862|gb|ABM44463.1| conserved hypothetical protein [Bartonella bacilliformis KC583] Length = 60 Score = 73.5 bits (179), Expect = 8e-12, Method: Composition-based stats. Identities = 27/60 (45%), Positives = 35/60 (58%), Gaps = 2/60 (3%) Query: 1 MQTSDFRSLKSI--CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 MQ L+ CPEC + S YPFCS++CR+IDL+RWL G Y++ E EEE Sbjct: 1 MQNQPIHPLRPPRPCPECGQKSQYNTYPFCSSRCRAIDLNRWLSGSYILPPPSQESDEEE 60 >gi|163868984|ref|YP_001610214.1| zinc-binding protein [Bartonella tribocorum CIP 105476] gi|161018661|emb|CAK02219.1| hypothetical protein BT_2033 [Bartonella tribocorum CIP 105476] Length = 93 Score = 73.5 bits (179), Expect = 9e-12, Method: Composition-based stats. Identities = 22/49 (44%), Positives = 29/49 (59%) Query: 10 KSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C + S YPFCS++CR+IDL+RWL G Y++ EEE Sbjct: 45 PHPCPICGQMSQTSAYPFCSSRCRAIDLNRWLSGSYILPPPPQVSDEEE 93 >gi|170742435|ref|YP_001771090.1| hypothetical protein M446_4313 [Methylobacterium sp. 4-46] gi|168196709|gb|ACA18656.1| protein of unknown function DUF329 [Methylobacterium sp. 4-46] Length = 65 Score = 73.5 bits (179), Expect = 9e-12, Method: Composition-based stats. Identities = 23/56 (41%), Positives = 29/56 (51%) Query: 6 FRSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 + + CP C + + F PFCS +C +DL RWL G Y I A EDE EE Sbjct: 8 PEAKRPPCPICGRPAAEPFRPFCSKRCADVDLQRWLSGRYAIPAREDEGPGEEDSG 63 >gi|16126579|ref|NP_421143.1| hypothetical protein CC_2340 [Caulobacter crescentus CB15] gi|221235361|ref|YP_002517798.1| non-essential pilus assembly protein [Caulobacter crescentus NA1000] gi|31563285|sp|Q9A5V7|Y2340_CAUCR RecName: Full=UPF0243 zinc-binding protein CC_2340 gi|254801326|sp|B8GYW7|Y2425_CAUCN RecName: Full=UPF0243 zinc-binding protein CCNA_02425 gi|13423867|gb|AAK24311.1| conserved hypothetical protein [Caulobacter crescentus CB15] gi|220964534|gb|ACL95890.1| non-essential pilus assembly protein [Caulobacter crescentus NA1000] Length = 57 Score = 73.5 bits (179), Expect = 1e-11, Method: Composition-based stats. Identities = 22/54 (40%), Positives = 31/54 (57%) Query: 9 LKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 + + CP C K F PFCS +C +DL RWL G YV+A +D++ +DI Sbjct: 1 MSAKCPICAKPVDSAFRPFCSKRCADVDLQRWLSGRYVVAGGDDDEENPPSQDI 54 >gi|209883883|ref|YP_002287740.1| hypothetical protein OCAR_4734 [Oligotropha carboxidovorans OM5] gi|209872079|gb|ACI91875.1| conserved domain protein [Oligotropha carboxidovorans OM5] Length = 64 Score = 73.5 bits (179), Expect = 1e-11, Method: Composition-based stats. Identities = 21/53 (39%), Positives = 30/53 (56%) Query: 8 SLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK 60 + + CP C K + PFCS +CR +DL+RWL G Y I A + E ++E Sbjct: 2 TRQKPCPICGKPATHASRPFCSERCRDVDLNRWLSGAYAIPARDMETDDDEEP 54 >gi|153007666|ref|YP_001368881.1| zinc-binding protein [Ochrobactrum anthropi ATCC 49188] gi|151559554|gb|ABS13052.1| protein of unknown function DUF329 [Ochrobactrum anthropi ATCC 49188] Length = 71 Score = 73.5 bits (179), Expect = 1e-11, Method: Composition-based stats. Identities = 25/47 (53%), Positives = 31/47 (65%) Query: 11 SICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CPEC K S E YPFCS +C+SIDL+RWL G YV+ ++ EE Sbjct: 22 RPCPECGKPSSRESYPFCSPRCKSIDLNRWLSGSYVLPGKPIDEEEE 68 >gi|144897400|emb|CAM74264.1| Protein of unknown function DUF329 [Magnetospirillum gryphiswaldense MSR-1] Length = 61 Score = 73.1 bits (178), Expect = 1e-11, Method: Composition-based stats. Identities = 20/56 (35%), Positives = 27/56 (48%) Query: 6 FRSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 + CP C K +F PFC ++C +DL+RWL G Y + E E E D Sbjct: 3 PANSNKPCPVCGKPPQPKFLPFCCSRCADVDLNRWLGGVYRVETNETEHQHEPDGD 58 >gi|329115668|ref|ZP_08244390.1| UPF0243 zinc-binding protein [Acetobacter pomorum DM001] gi|326695096|gb|EGE46815.1| UPF0243 zinc-binding protein [Acetobacter pomorum DM001] Length = 61 Score = 72.8 bits (177), Expect = 1e-11, Method: Composition-based stats. Identities = 21/54 (38%), Positives = 27/54 (50%) Query: 8 SLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 S + CP C K + EF PFCS +C IDL RW G+Y I +E + Sbjct: 3 SKPAKCPVCGKPAQAEFRPFCSKRCADIDLGRWFSGDYRIPGAPVLIENDEKAE 56 >gi|190890287|ref|YP_001976829.1| hypothetical protein RHECIAT_CH0000661 [Rhizobium etli CIAT 652] gi|254806566|sp|B3PNT8|Y661_RHIE6 RecName: Full=UPF0243 zinc-binding protein RHECIAT_CH0000661 gi|190695566|gb|ACE89651.1| hypothetical conserved protein [Rhizobium etli CIAT 652] Length = 70 Score = 72.8 bits (177), Expect = 1e-11, Method: Composition-based stats. Identities = 26/55 (47%), Positives = 30/55 (54%) Query: 3 TSDFRSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 + CPEC K S E YPFCS +CR +DLSRWL G Y I EDE + Sbjct: 10 KVEPLRKTRPCPECGKPSNREHYPFCSNRCREVDLSRWLTGSYAIPVAEDETKAD 64 >gi|126735246|ref|ZP_01750992.1| hypothetical protein RCCS2_15254 [Roseobacter sp. CCS2] gi|126715801|gb|EBA12666.1| hypothetical protein RCCS2_15254 [Roseobacter sp. CCS2] Length = 61 Score = 72.8 bits (177), Expect = 1e-11, Method: Composition-based stats. Identities = 19/45 (42%), Positives = 27/45 (60%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP C K + F PFCS +C +DL++W G Y I A + E +E+ Sbjct: 3 CPICDKPTETAFRPFCSKRCADVDLAKWFTGGYAIPADDPEDAED 47 >gi|294084880|ref|YP_003551640.1| hypothetical protein SAR116_1313 [Candidatus Puniceispirillum marinum IMCC1322] gi|292664455|gb|ADE39556.1| Protein of unknown function DUF329 [Candidatus Puniceispirillum marinum IMCC1322] Length = 87 Score = 72.8 bits (177), Expect = 2e-11, Method: Composition-based stats. Identities = 22/56 (39%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Query: 1 MQTSDFRSLKS-ICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKS 55 M S +LK CP C + PFCS++C IDL RW G+Y I AV+ Sbjct: 1 MSASSKSNLKPVKCPTCGDMASNAARPFCSSRCADIDLGRWFQGKYAIPAVDAADD 56 >gi|254471921|ref|ZP_05085322.1| conserved domain protein [Pseudovibrio sp. JE062] gi|211959123|gb|EEA94322.1| conserved domain protein [Pseudovibrio sp. JE062] Length = 65 Score = 72.8 bits (177), Expect = 2e-11, Method: Composition-based stats. Identities = 22/53 (41%), Positives = 34/53 (64%) Query: 10 KSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 + CP C K + PFCS +C+ +DL++WL G Y + AVE+E SE ++ D+ Sbjct: 6 SAKCPICEKPTQEATKPFCSDRCKQVDLNKWLSGHYSVPAVEEEFSESDISDL 58 >gi|325291922|ref|YP_004277786.1| hypothetical protein AGROH133_03916 [Agrobacterium sp. H13-3] gi|325059775|gb|ADY63466.1| hypothetical protein AGROH133_03916 [Agrobacterium sp. H13-3] Length = 75 Score = 72.8 bits (177), Expect = 2e-11, Method: Composition-based stats. Identities = 26/50 (52%), Positives = 33/50 (66%) Query: 9 LKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CPEC + S E YPFCS +CRS+DL+RWL+G Y I +DE S +E Sbjct: 17 KTKPCPECGRPSTREDYPFCSDRCRSLDLARWLNGSYAIPVADDESSADE 66 >gi|300024214|ref|YP_003756825.1| hypothetical protein Hden_2708 [Hyphomicrobium denitrificans ATCC 51888] gi|299526035|gb|ADJ24504.1| protein of unknown function DUF329 [Hyphomicrobium denitrificans ATCC 51888] Length = 73 Score = 72.4 bits (176), Expect = 2e-11, Method: Composition-based stats. Identities = 20/56 (35%), Positives = 33/56 (58%) Query: 3 TSDFRSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 +S+ S CP CRK + + PFCS +C IDL++WL G Y + E+++ + + Sbjct: 4 SSEPASKPVRCPICRKPAAEAYRPFCSKRCADIDLAKWLGGAYAVPGREEDEGDGD 59 >gi|254465224|ref|ZP_05078635.1| conserved domain protein [Rhodobacterales bacterium Y4I] gi|206686132|gb|EDZ46614.1| conserved domain protein [Rhodobacterales bacterium Y4I] Length = 67 Score = 72.4 bits (176), Expect = 2e-11, Method: Composition-based stats. Identities = 19/50 (38%), Positives = 27/50 (54%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 CP C S F PFCS +C IDL +WL G Y + + + E E +++ Sbjct: 3 CPICGGESQKSFRPFCSKRCADIDLGKWLTGVYSVPSQDPEDIENALEEA 52 >gi|218514742|ref|ZP_03511582.1| zinc-binding protein [Rhizobium etli 8C-3] Length = 84 Score = 72.4 bits (176), Expect = 2e-11, Method: Composition-based stats. Identities = 25/55 (45%), Positives = 30/55 (54%) Query: 3 TSDFRSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 + CPEC K S E YPFCS +CR +DLSRWL G Y I +DE + Sbjct: 10 KVEPLRKTRPCPECGKPSNREHYPFCSNRCREVDLSRWLTGSYAIPVADDETKAD 64 >gi|86751447|ref|YP_487943.1| zinc-binding protein [Rhodopseudomonas palustris HaA2] gi|86574475|gb|ABD09032.1| Protein of unknown function DUF329 [Rhodopseudomonas palustris HaA2] Length = 64 Score = 72.4 bits (176), Expect = 2e-11, Method: Composition-based stats. Identities = 20/47 (42%), Positives = 26/47 (55%) Query: 11 SICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP C K + PFCS +CR +DL+RWL G Y I A + E+ Sbjct: 17 KPCPICGKPATEASRPFCSERCRDVDLNRWLSGSYKIPAAPADDDED 63 >gi|116250390|ref|YP_766228.1| zinc-binding protein [Rhizobium leguminosarum bv. viciae 3841] gi|254806540|sp|Q1MLP1|Y618_RHIL3 RecName: Full=UPF0243 zinc-binding protein RL0618 gi|115255038|emb|CAK06112.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae 3841] Length = 70 Score = 72.0 bits (175), Expect = 3e-11, Method: Composition-based stats. Identities = 26/55 (47%), Positives = 29/55 (52%) Query: 3 TSDFRSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 + CPEC K S E YPFCS +CR DLSRWL G Y I +DE E Sbjct: 10 KVEPLRKTRPCPECGKPSNREHYPFCSNRCREADLSRWLTGAYAIPVADDETKAE 64 >gi|83949643|ref|ZP_00958376.1| hypothetical protein ISM_01075 [Roseovarius nubinhibens ISM] gi|83837542|gb|EAP76838.1| hypothetical protein ISM_01075 [Roseovarius nubinhibens ISM] Length = 64 Score = 72.0 bits (175), Expect = 3e-11, Method: Composition-based stats. Identities = 21/51 (41%), Positives = 29/51 (56%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDIL 63 CP C K + F PFCS +C +DL++WL G Y I + + E EE + L Sbjct: 3 CPICDKETDKRFRPFCSKRCADVDLAKWLSGSYAIPSDDPEDMEEALDAAL 53 >gi|258543062|ref|YP_003188495.1| hypothetical protein APA01_19930 [Acetobacter pasteurianus IFO 3283-01] gi|256634140|dbj|BAI00116.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01] gi|256637200|dbj|BAI03169.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-03] gi|256640252|dbj|BAI06214.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-07] gi|256643309|dbj|BAI09264.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-22] gi|256646364|dbj|BAI12312.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-26] gi|256649417|dbj|BAI15358.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-32] gi|256652403|dbj|BAI18337.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01-42C] gi|256655461|dbj|BAI21388.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-12] Length = 61 Score = 72.0 bits (175), Expect = 3e-11, Method: Composition-based stats. Identities = 20/54 (37%), Positives = 27/54 (50%) Query: 8 SLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 S + CP C K + EF PFCS +C +DL RW G+Y I +E + Sbjct: 3 SKPAKCPVCGKPAQAEFRPFCSKRCADVDLGRWFSGDYRIPGAPAPIENDEKAE 56 >gi|294678069|ref|YP_003578684.1| hypothetical protein RCAP_rcc02547 [Rhodobacter capsulatus SB 1003] gi|294476889|gb|ADE86277.1| protein of unknown function DUF329 [Rhodobacter capsulatus SB 1003] Length = 57 Score = 72.0 bits (175), Expect = 3e-11, Method: Composition-based stats. Identities = 20/49 (40%), Positives = 28/49 (57%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP C K + + PFCS +C +DL+RWL+G YVI E + +D Sbjct: 3 CPICGKATAANYRPFCSKRCADVDLARWLNGSYVIPGDIAEAEDRPGED 51 >gi|86137058|ref|ZP_01055636.1| hypothetical protein MED193_15327 [Roseobacter sp. MED193] gi|85826382|gb|EAQ46579.1| hypothetical protein MED193_15327 [Roseobacter sp. MED193] Length = 67 Score = 72.0 bits (175), Expect = 3e-11, Method: Composition-based stats. Identities = 18/51 (35%), Positives = 29/51 (56%) Query: 12 ICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 ICP C + PFCS +C +DL++WL+G Y + + E E +K++ Sbjct: 2 ICPICGTETEKSHRPFCSKRCADLDLAKWLNGSYALPSDNPEDVENALKEL 52 >gi|222147500|ref|YP_002548457.1| hypothetical protein Avi_0636 [Agrobacterium vitis S4] gi|254806556|sp|B9JR40|Y636_AGRVS RecName: Full=UPF0243 zinc-binding protein Avi_0636 gi|221734490|gb|ACM35453.1| conserved hypothetical protein [Agrobacterium vitis S4] Length = 69 Score = 71.6 bits (174), Expect = 3e-11, Method: Composition-based stats. Identities = 25/58 (43%), Positives = 31/58 (53%) Query: 3 TSDFRSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK 60 + CPEC S E YPFCS +CR+ DLSRWL G Y I EDE + ++ Sbjct: 10 KVEPLRKPLPCPECGHPSHREHYPFCSDRCRTQDLSRWLKGSYAIPVAEDESNPDDDG 67 >gi|167647544|ref|YP_001685207.1| hypothetical protein Caul_3582 [Caulobacter sp. K31] gi|167349974|gb|ABZ72709.1| protein of unknown function DUF329 [Caulobacter sp. K31] Length = 60 Score = 71.6 bits (174), Expect = 3e-11, Method: Composition-based stats. Identities = 19/52 (36%), Positives = 30/52 (57%) Query: 11 SICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 S CP C+K + F PFCS +C +DL+RWL YV+ ++++ D+ Sbjct: 2 SACPICKKPTDPAFRPFCSKRCADVDLNRWLSDRYVVPGGDEDEENPPSTDL 53 >gi|182678648|ref|YP_001832794.1| hypothetical protein Bind_1674 [Beijerinckia indica subsp. indica ATCC 9039] gi|182634531|gb|ACB95305.1| protein of unknown function DUF329 [Beijerinckia indica subsp. indica ATCC 9039] Length = 72 Score = 71.6 bits (174), Expect = 3e-11, Method: Composition-based stats. Identities = 20/52 (38%), Positives = 28/52 (53%) Query: 11 SICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 CP C K + F PFCS +C +DL RWL G YV+A + + E+ + Sbjct: 18 RSCPICGKPQVQTFRPFCSKRCADVDLHRWLSGAYVVAGESNSQKPEDSDET 69 >gi|126738150|ref|ZP_01753871.1| hypothetical protein RSK20926_06437 [Roseobacter sp. SK209-2-6] gi|126720647|gb|EBA17352.1| hypothetical protein RSK20926_06437 [Roseobacter sp. SK209-2-6] Length = 67 Score = 71.6 bits (174), Expect = 3e-11, Method: Composition-based stats. Identities = 17/50 (34%), Positives = 29/50 (58%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 CP C S + PFCS +C +DL++WL+G Y + + + E E+ ++ Sbjct: 3 CPICDAESQKAYRPFCSKRCADLDLAKWLNGSYTLPSQDPEDLEKALEAT 52 >gi|241203026|ref|YP_002974122.1| zinc-binding protein [Rhizobium leguminosarum bv. trifolii WSM1325] gi|240856916|gb|ACS54583.1| protein of unknown function DUF329 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 70 Score = 71.6 bits (174), Expect = 4e-11, Method: Composition-based stats. Identities = 25/55 (45%), Positives = 29/55 (52%) Query: 3 TSDFRSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 + CPEC K S E YPFCS +CR DLSRWL G Y I +DE + Sbjct: 10 KVEPLRKTRPCPECGKPSHREHYPFCSNRCREADLSRWLTGAYAIPVADDETKAD 64 >gi|259415507|ref|ZP_05739428.1| conserved domain protein [Silicibacter sp. TrichCH4B] gi|259348737|gb|EEW60499.1| conserved domain protein [Silicibacter sp. TrichCH4B] Length = 60 Score = 71.6 bits (174), Expect = 4e-11, Method: Composition-based stats. Identities = 16/48 (33%), Positives = 30/48 (62%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK 60 CP C + ++ + PFCS +C +DL++WL+G Y + + + E E ++ Sbjct: 3 CPICGEPTLQSYRPFCSKRCADLDLAKWLNGGYSVPSEDQEDLENALE 50 >gi|92115920|ref|YP_575649.1| zinc-binding protein [Nitrobacter hamburgensis X14] gi|122418833|sp|Q1QRF8|Y293_NITHX RecName: Full=UPF0243 zinc-binding protein Nham_0293 gi|91798814|gb|ABE61189.1| protein of unknown function DUF329 [Nitrobacter hamburgensis X14] Length = 60 Score = 71.6 bits (174), Expect = 4e-11, Method: Composition-based stats. Identities = 20/48 (41%), Positives = 28/48 (58%) Query: 11 SICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K ++ PFCS +CR +DL+RWL G YVI + + + E Sbjct: 13 KPCPICGKPAVAASRPFCSERCRDVDLNRWLSGSYVIPVSKTDGEDAE 60 >gi|163741998|ref|ZP_02149387.1| hypothetical protein RG210_05492 [Phaeobacter gallaeciensis 2.10] gi|161384719|gb|EDQ09099.1| hypothetical protein RG210_05492 [Phaeobacter gallaeciensis 2.10] Length = 60 Score = 71.2 bits (173), Expect = 4e-11, Method: Composition-based stats. Identities = 17/50 (34%), Positives = 31/50 (62%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 CP C + + ++ PFCS +C IDL++WL+G Y + + E E ++++ Sbjct: 3 CPICAEETQKDYRPFCSRRCADIDLAKWLNGAYATPSTDPEDIENALEEV 52 >gi|85704671|ref|ZP_01035773.1| hypothetical protein ROS217_06314 [Roseovarius sp. 217] gi|85671079|gb|EAQ25938.1| hypothetical protein ROS217_06314 [Roseovarius sp. 217] Length = 60 Score = 71.2 bits (173), Expect = 5e-11, Method: Composition-based stats. Identities = 18/51 (35%), Positives = 28/51 (54%) Query: 12 ICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 CP C+K + + PFCS +C IDL +W G+Y + + E EE + + Sbjct: 2 TCPICQKKTDPAYRPFCSRRCADIDLGKWFAGDYAVPSTEPADLEEAIDAL 52 >gi|296117422|ref|ZP_06836010.1| hypothetical protein GXY_16429 [Gluconacetobacter hansenii ATCC 23769] gi|295976024|gb|EFG82814.1| hypothetical protein GXY_16429 [Gluconacetobacter hansenii ATCC 23769] Length = 68 Score = 70.8 bits (172), Expect = 5e-11, Method: Composition-based stats. Identities = 19/51 (37%), Positives = 26/51 (50%) Query: 8 SLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 + CP C K + + PFCS +C IDL RW G+Y + A D +E Sbjct: 5 ATPPPCPVCGKPMVQAYRPFCSRRCADIDLGRWFTGQYRVPADNDFNDMDE 55 >gi|220923267|ref|YP_002498569.1| hypothetical protein Mnod_3343 [Methylobacterium nodulans ORS 2060] gi|219947874|gb|ACL58266.1| protein of unknown function DUF329 [Methylobacterium nodulans ORS 2060] Length = 65 Score = 70.8 bits (172), Expect = 5e-11, Method: Composition-based stats. Identities = 19/47 (40%), Positives = 25/47 (53%) Query: 15 ECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 C K + +F PFCS +C +DL RWL G Y I ED+ E + Sbjct: 17 ICGKPADPKFRPFCSKRCADVDLQRWLSGRYAIPGREDDALGREDEG 63 >gi|115526469|ref|YP_783380.1| zinc-binding protein [Rhodopseudomonas palustris BisA53] gi|115520416|gb|ABJ08400.1| protein of unknown function DUF329 [Rhodopseudomonas palustris BisA53] Length = 61 Score = 70.8 bits (172), Expect = 6e-11, Method: Composition-based stats. Identities = 18/56 (32%), Positives = 27/56 (48%) Query: 3 TSDFRSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 + CP C K ++ PFCS +CR +DL+RWL G Y I + + + Sbjct: 6 KQPAAARAKRCPICGKPAVEASRPFCSERCRDVDLNRWLSGSYAIPGAPEPDDDAD 61 >gi|75674474|ref|YP_316895.1| zinc-binding protein [Nitrobacter winogradskyi Nb-255] gi|74419344|gb|ABA03543.1| Protein of unknown function DUF329 [Nitrobacter winogradskyi Nb-255] Length = 65 Score = 70.8 bits (172), Expect = 6e-11, Method: Composition-based stats. Identities = 20/48 (41%), Positives = 27/48 (56%) Query: 11 SICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K + + PFCS +CR +DL+RWL G Y I A + + E Sbjct: 18 KPCPICGKPAAEDSRPFCSERCRDVDLNRWLSGSYAIPASRADDDDAE 65 >gi|254476716|ref|ZP_05090102.1| conserved domain protein [Ruegeria sp. R11] gi|214030959|gb|EEB71794.1| conserved domain protein [Ruegeria sp. R11] Length = 60 Score = 70.5 bits (171), Expect = 7e-11, Method: Composition-based stats. Identities = 17/50 (34%), Positives = 30/50 (60%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 CP C + + E+ PFCS +C +DL++WL+G Y + + E E +++ Sbjct: 3 CPICGEETRREYRPFCSRRCADVDLAKWLNGAYATPSTDPEDIEIALEEA 52 >gi|225851799|ref|YP_002732032.1| zinc-binding protein [Brucella melitensis ATCC 23457] gi|225640164|gb|ACO00078.1| protein of unknown function DUF329 [Brucella melitensis ATCC 23457] gi|326408293|gb|ADZ65358.1| zinc-binding protein [Brucella melitensis M28] gi|326538007|gb|ADZ86222.1| conserved hypothetical protein [Brucella melitensis M5-90] Length = 71 Score = 70.5 bits (171), Expect = 7e-11, Method: Composition-based stats. Identities = 25/50 (50%), Positives = 31/50 (62%) Query: 11 SICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK 60 CPEC K S E YPFCS +C++IDL+RWL G YVIA + +E Sbjct: 22 RPCPECGKPSTREAYPFCSPRCKNIDLNRWLSGSYVIAGKPLGEEDENDS 71 >gi|217976942|ref|YP_002361089.1| protein of unknown function DUF329 [Methylocella silvestris BL2] gi|217502318|gb|ACK49727.1| protein of unknown function DUF329 [Methylocella silvestris BL2] Length = 73 Score = 70.5 bits (171), Expect = 8e-11, Method: Composition-based stats. Identities = 20/50 (40%), Positives = 29/50 (58%) Query: 10 KSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEV 59 + CP C K ++ PFCS +C +DL RWL G Y I A E E++ ++ Sbjct: 19 RRPCPICGKPAVAAMRPFCSKRCADVDLHRWLGGVYAIPASETEEAAKDS 68 >gi|260574873|ref|ZP_05842875.1| protein of unknown function DUF329 [Rhodobacter sp. SW2] gi|259022878|gb|EEW26172.1| protein of unknown function DUF329 [Rhodobacter sp. SW2] Length = 58 Score = 70.5 bits (171), Expect = 8e-11, Method: Composition-based stats. Identities = 20/49 (40%), Positives = 27/49 (55%) Query: 12 ICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK 60 CP C K + ++ PFCS +C +DL RWL G YVI A E ++ Sbjct: 2 TCPICAKPTDPKYRPFCSRRCADVDLGRWLAGSYVIPAEAAEDDDQSSD 50 >gi|17987956|ref|NP_540590.1| zinc-binding protein [Brucella melitensis bv. 1 str. 16M] gi|148559915|ref|YP_001258295.1| zinc-binding protein [Brucella ovis ATCC 25840] gi|161618228|ref|YP_001592115.1| zinc-binding protein [Brucella canis ATCC 23365] gi|163842532|ref|YP_001626936.1| zinc-binding protein [Brucella suis ATCC 23445] gi|225626778|ref|ZP_03784817.1| zinc-binding protein [Brucella ceti str. Cudo] gi|254690566|ref|ZP_05153820.1| zinc-binding protein [Brucella abortus bv. 6 str. 870] gi|254695057|ref|ZP_05156885.1| zinc-binding protein [Brucella abortus bv. 3 str. Tulya] gi|254705421|ref|ZP_05167249.1| zinc-binding protein [Brucella suis bv. 3 str. 686] gi|254708003|ref|ZP_05169831.1| zinc-binding protein [Brucella pinnipedialis M163/99/10] gi|254709417|ref|ZP_05171228.1| zinc-binding protein [Brucella pinnipedialis B2/94] gi|254713163|ref|ZP_05174974.1| zinc-binding protein [Brucella ceti M644/93/1] gi|254716483|ref|ZP_05178294.1| zinc-binding protein [Brucella ceti M13/05/1] gi|254718455|ref|ZP_05180266.1| zinc-binding protein [Brucella sp. 83/13] gi|256030911|ref|ZP_05444525.1| zinc-binding protein [Brucella pinnipedialis M292/94/1] gi|256046062|ref|ZP_05448934.1| zinc-binding protein [Brucella melitensis bv. 1 str. Rev.1] gi|256060404|ref|ZP_05450577.1| zinc-binding protein [Brucella neotomae 5K33] gi|256112774|ref|ZP_05453695.1| zinc-binding protein [Brucella melitensis bv. 3 str. Ether] gi|256158951|ref|ZP_05456794.1| zinc-binding protein [Brucella ceti M490/95/1] gi|256254316|ref|ZP_05459852.1| zinc-binding protein [Brucella ceti B1/94] gi|256258821|ref|ZP_05464357.1| zinc-binding protein [Brucella abortus bv. 9 str. C68] gi|260169812|ref|ZP_05756623.1| zinc-binding protein [Brucella sp. F5/99] gi|260563340|ref|ZP_05833826.1| zinc-binding protein [Brucella melitensis bv. 1 str. 16M] gi|260567124|ref|ZP_05837594.1| zinc-binding protein [Brucella suis bv. 4 str. 40] gi|261218274|ref|ZP_05932555.1| zinc-binding protein [Brucella ceti M13/05/1] gi|261221473|ref|ZP_05935754.1| zinc-binding protein [Brucella ceti B1/94] gi|265983422|ref|ZP_06096157.1| zinc-binding protein [Brucella sp. 83/13] gi|265987972|ref|ZP_06100529.1| zinc-binding protein [Brucella pinnipedialis M292/94/1] gi|265997434|ref|ZP_06109991.1| zinc-binding protein [Brucella ceti M490/95/1] gi|294851642|ref|ZP_06792315.1| hypothetical protein BAZG_00553 [Brucella sp. NVSL 07-0026] gi|297247660|ref|ZP_06931378.1| conserved hypothetical protein [Brucella abortus bv. 5 str. B3196] gi|306840167|ref|ZP_07472951.1| zinc-binding protein [Brucella sp. NF 2653] gi|306842475|ref|ZP_07475126.1| zinc-binding protein [Brucella sp. BO2] gi|306844896|ref|ZP_07477478.1| zinc-binding protein [Brucella sp. BO1] gi|17983696|gb|AAL52854.1| non-essential pilus assembly protein [Brucella melitensis bv. 1 str. 16M] gi|148371172|gb|ABQ61151.1| conserved hypothetical protein [Brucella ovis ATCC 25840] gi|161335039|gb|ABX61344.1| protein of unknown function DUF329 [Brucella canis ATCC 23365] gi|163673255|gb|ABY37366.1| protein of unknown function DUF329 [Brucella suis ATCC 23445] gi|225618435|gb|EEH15478.1| zinc-binding protein [Brucella ceti str. Cudo] gi|260153356|gb|EEW88448.1| zinc-binding protein [Brucella melitensis bv. 1 str. 16M] gi|260156642|gb|EEW91722.1| zinc-binding protein [Brucella suis bv. 4 str. 40] gi|260920057|gb|EEX86710.1| zinc-binding protein [Brucella ceti B1/94] gi|260923363|gb|EEX89931.1| zinc-binding protein [Brucella ceti M13/05/1] gi|262551902|gb|EEZ07892.1| zinc-binding protein [Brucella ceti M490/95/1] gi|264660169|gb|EEZ30430.1| zinc-binding protein [Brucella pinnipedialis M292/94/1] gi|264662014|gb|EEZ32275.1| zinc-binding protein [Brucella sp. 83/13] gi|294820231|gb|EFG37230.1| hypothetical protein BAZG_00553 [Brucella sp. NVSL 07-0026] gi|297174829|gb|EFH34176.1| conserved hypothetical protein [Brucella abortus bv. 5 str. B3196] gi|306274725|gb|EFM56509.1| zinc-binding protein [Brucella sp. BO1] gi|306287331|gb|EFM58811.1| zinc-binding protein [Brucella sp. BO2] gi|306404765|gb|EFM61060.1| zinc-binding protein [Brucella sp. NF 2653] Length = 71 Score = 70.5 bits (171), Expect = 9e-11, Method: Composition-based stats. Identities = 25/50 (50%), Positives = 31/50 (62%) Query: 11 SICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK 60 CPEC K S E YPFCS +C++IDL+RWL G YVIA + +E Sbjct: 22 RPCPECGKPSTREAYPFCSPRCKNIDLNRWLSGSYVIAGKPLGEEDENDS 71 >gi|149913557|ref|ZP_01902090.1| hypothetical protein RAZWK3B_09651 [Roseobacter sp. AzwK-3b] gi|149812677|gb|EDM72506.1| hypothetical protein RAZWK3B_09651 [Roseobacter sp. AzwK-3b] Length = 60 Score = 70.1 bits (170), Expect = 9e-11, Method: Composition-based stats. Identities = 17/51 (33%), Positives = 28/51 (54%) Query: 12 ICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 CP C+K + F PFCS +C +DL +W G+Y + + + E E ++ Sbjct: 2 TCPICQKPTDTRFRPFCSKRCADVDLGKWFGGDYAVPSQDPEDIERAFEEA 52 >gi|163737328|ref|ZP_02144746.1| hypothetical protein RGBS107_04258 [Phaeobacter gallaeciensis BS107] gi|161389932|gb|EDQ14283.1| hypothetical protein RGBS107_04258 [Phaeobacter gallaeciensis BS107] Length = 60 Score = 70.1 bits (170), Expect = 9e-11, Method: Composition-based stats. Identities = 17/50 (34%), Positives = 30/50 (60%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 CP C + + ++ PFCS +C IDL++WL+G Y + + E E +++ Sbjct: 3 CPICAEETQKDYRPFCSRRCADIDLAKWLNGAYATPSTDPEDIENALEEA 52 >gi|84683717|ref|ZP_01011620.1| hypothetical protein 1099457000264_RB2654_20128 [Maritimibacter alkaliphilus HTCC2654] gi|84668460|gb|EAQ14927.1| hypothetical protein RB2654_20128 [Rhodobacterales bacterium HTCC2654] Length = 64 Score = 70.1 bits (170), Expect = 9e-11, Method: Composition-based stats. Identities = 20/50 (40%), Positives = 30/50 (60%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 CP C K + + PFCS +C +DL +WL+G Y I + + E +E V +I Sbjct: 3 CPICAKDTDPAYRPFCSKRCADVDLGKWLNGSYRIPSEDPEDLDELVDEI 52 >gi|319782084|ref|YP_004141560.1| hypothetical protein Mesci_2363 [Mesorhizobium ciceri biovar biserrulae WSM1271] gi|317167972|gb|ADV11510.1| protein of unknown function DUF329 [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 65 Score = 70.1 bits (170), Expect = 9e-11, Method: Composition-based stats. Identities = 26/52 (50%), Positives = 34/52 (65%) Query: 10 KSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 K CPEC K S + +PFCST+C+ IDL+RWL G YVI A +DE+ + Sbjct: 13 KRPCPECGKPSARDSFPFCSTRCKDIDLNRWLKGAYVIKARDDEEETDPDAP 64 >gi|85713842|ref|ZP_01044832.1| zinc-binding protein [Nitrobacter sp. Nb-311A] gi|85699746|gb|EAQ37613.1| zinc-binding protein [Nitrobacter sp. Nb-311A] Length = 60 Score = 70.1 bits (170), Expect = 9e-11, Method: Composition-based stats. Identities = 21/48 (43%), Positives = 27/48 (56%) Query: 11 SICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K S+ PFCS +CR +DL+RWL G YVI + + E Sbjct: 13 KPCPICGKPSVEASRPFCSERCRDVDLNRWLSGSYVIPVSRSDDEDAE 60 >gi|254701071|ref|ZP_05162899.1| zinc-binding protein [Brucella suis bv. 5 str. 513] Length = 71 Score = 70.1 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 25/50 (50%), Positives = 31/50 (62%) Query: 11 SICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK 60 CPEC K S E YPFCS +C++IDL+RWL G YVIA + +E Sbjct: 22 RPCPECGKPSTREAYPFCSPRCKNIDLNRWLSGSYVIAGKPLGEKDENDS 71 >gi|23501154|ref|NP_697281.1| zinc-binding protein [Brucella suis 1330] gi|256368708|ref|YP_003106214.1| zinc-binding protein [Brucella microti CCM 4915] gi|260756135|ref|ZP_05868483.1| zinc-binding protein [Brucella abortus bv. 6 str. 870] gi|260885154|ref|ZP_05896768.1| zinc-binding protein [Brucella abortus bv. 9 str. C68] gi|261215409|ref|ZP_05929690.1| zinc-binding protein [Brucella abortus bv. 3 str. Tulya] gi|261315497|ref|ZP_05954694.1| zinc-binding protein [Brucella pinnipedialis M163/99/10] gi|261316935|ref|ZP_05956132.1| zinc-binding protein [Brucella pinnipedialis B2/94] gi|261320878|ref|ZP_05960075.1| zinc-binding protein [Brucella ceti M644/93/1] gi|261324390|ref|ZP_05963587.1| zinc-binding protein [Brucella neotomae 5K33] gi|261756138|ref|ZP_05999847.1| zinc-binding protein [Brucella suis bv. 3 str. 686] gi|261759357|ref|ZP_06003066.1| zinc-binding protein [Brucella sp. F5/99] gi|265992476|ref|ZP_06105033.1| zinc-binding protein [Brucella melitensis bv. 1 str. Rev.1] gi|265994217|ref|ZP_06106774.1| zinc-binding protein [Brucella melitensis bv. 3 str. Ether] gi|265999635|ref|ZP_05467216.2| zinc-binding protein [Brucella melitensis bv. 2 str. 63/9] gi|54039925|sp|P67480|Y247_BRUSU RecName: Full=UPF0243 zinc-binding protein BR0247 gi|54042760|sp|P67479|Y1673_BRUME RecName: Full=UPF0243 zinc-binding protein BMEI1673 gi|23347030|gb|AAN29196.1| conserved hypothetical protein [Brucella suis 1330] gi|255998866|gb|ACU47265.1| zinc-binding protein [Brucella microti CCM 4915] gi|260676243|gb|EEX63064.1| zinc-binding protein [Brucella abortus bv. 6 str. 870] gi|260874682|gb|EEX81751.1| zinc-binding protein [Brucella abortus bv. 9 str. C68] gi|260917016|gb|EEX83877.1| zinc-binding protein [Brucella abortus bv. 3 str. Tulya] gi|261293568|gb|EEX97064.1| zinc-binding protein [Brucella ceti M644/93/1] gi|261296158|gb|EEX99654.1| zinc-binding protein [Brucella pinnipedialis B2/94] gi|261300370|gb|EEY03867.1| zinc-binding protein [Brucella neotomae 5K33] gi|261304523|gb|EEY08020.1| zinc-binding protein [Brucella pinnipedialis M163/99/10] gi|261739341|gb|EEY27337.1| zinc-binding protein [Brucella sp. F5/99] gi|261745891|gb|EEY33817.1| zinc-binding protein [Brucella suis bv. 3 str. 686] gi|262765198|gb|EEZ11119.1| zinc-binding protein [Brucella melitensis bv. 3 str. Ether] gi|263003542|gb|EEZ15835.1| zinc-binding protein [Brucella melitensis bv. 1 str. Rev.1] gi|263095092|gb|EEZ18761.1| zinc-binding protein [Brucella melitensis bv. 2 str. 63/9] Length = 57 Score = 70.1 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 25/50 (50%), Positives = 31/50 (62%) Query: 11 SICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK 60 CPEC K S E YPFCS +C++IDL+RWL G YVIA + +E Sbjct: 8 RPCPECGKPSTREAYPFCSPRCKNIDLNRWLSGSYVIAGKPLGEEDENDS 57 >gi|146343404|ref|YP_001208452.1| hypothetical protein BRADO6633 [Bradyrhizobium sp. ORS278] gi|146196210|emb|CAL80237.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278] Length = 64 Score = 70.1 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 22/57 (38%), Positives = 31/57 (54%) Query: 2 QTSDFRSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 T+ CP C + + PFCS +CR +DL+RWL G YVI A E ++ + E Sbjct: 8 STTAPAKPIRRCPICNRPAAEASRPFCSPRCRDVDLNRWLSGSYVIPATEGDEDDVE 64 >gi|62289248|ref|YP_221041.1| zinc-binding protein [Brucella abortus bv. 1 str. 9-941] gi|189023504|ref|YP_001934272.1| zinc-binding protein [Brucella abortus S19] gi|237814737|ref|ZP_04593735.1| zinc-binding protein [Brucella abortus str. 2308 A] gi|254696691|ref|ZP_05158519.1| zinc-binding protein [Brucella abortus bv. 2 str. 86/8/59] gi|254731599|ref|ZP_05190177.1| zinc-binding protein [Brucella abortus bv. 4 str. 292] gi|260546538|ref|ZP_05822278.1| zinc-binding protein [Brucella abortus NCTC 8038] gi|62195380|gb|AAX73680.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941] gi|189019076|gb|ACD71798.1| zinc-binding protein [Brucella abortus S19] gi|237789574|gb|EEP63784.1| zinc-binding protein [Brucella abortus str. 2308 A] gi|260096645|gb|EEW80521.1| zinc-binding protein [Brucella abortus NCTC 8038] Length = 71 Score = 70.1 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 25/50 (50%), Positives = 31/50 (62%) Query: 11 SICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK 60 CPEC K S E YPFCS +C++IDL+RWL G YVIA + +E Sbjct: 22 RPCPECGKPSTREAYPFCSPRCKNIDLNRWLSGSYVIAGKPLGEEDENDS 71 >gi|261751603|ref|ZP_05995312.1| zinc-binding protein [Brucella suis bv. 5 str. 513] gi|261741356|gb|EEY29282.1| zinc-binding protein [Brucella suis bv. 5 str. 513] Length = 57 Score = 70.1 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 25/50 (50%), Positives = 31/50 (62%) Query: 11 SICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK 60 CPEC K S E YPFCS +C++IDL+RWL G YVIA + +E Sbjct: 8 RPCPECGKPSTREAYPFCSPRCKNIDLNRWLSGSYVIAGKPLGEKDENDS 57 >gi|84516475|ref|ZP_01003834.1| hypothetical protein SKA53_07686 [Loktanella vestfoldensis SKA53] gi|84509511|gb|EAQ05969.1| hypothetical protein SKA53_07686 [Loktanella vestfoldensis SKA53] Length = 60 Score = 69.7 bits (169), Expect = 1e-10, Method: Composition-based stats. Identities = 16/37 (43%), Positives = 22/37 (59%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAA 49 CP C + + + PFCS +C +DL +WL G Y I A Sbjct: 3 CPICNRPTDKAYRPFCSRRCADVDLGKWLTGSYAIPA 39 >gi|163747240|ref|ZP_02154595.1| hypothetical protein OIHEL45_00767 [Oceanibulbus indolifex HEL-45] gi|161379515|gb|EDQ03929.1| hypothetical protein OIHEL45_00767 [Oceanibulbus indolifex HEL-45] Length = 63 Score = 69.7 bits (169), Expect = 1e-10, Method: Composition-based stats. Identities = 17/50 (34%), Positives = 27/50 (54%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 CP C+ ++ PFCS +C IDL RW +G Y + + + E E + + Sbjct: 3 CPICKAETVKAHRPFCSRRCADIDLGRWFNGSYAVPSRDPEDVEAAIDAV 52 >gi|82699180|ref|YP_413754.1| zinc-binding protein [Brucella melitensis biovar Abortus 2308] gi|260759359|ref|ZP_05871707.1| zinc-binding protein [Brucella abortus bv. 4 str. 292] gi|260761080|ref|ZP_05873423.1| zinc-binding protein [Brucella abortus bv. 2 str. 86/8/59] gi|123546884|sp|Q2YPC3|Y280_BRUA2 RecName: Full=UPF0243 zinc-binding protein BAB1_0280 gi|82615281|emb|CAJ10236.1| Domain of unknown function DUF329 [Brucella melitensis biovar Abortus 2308] gi|260669677|gb|EEX56617.1| zinc-binding protein [Brucella abortus bv. 4 str. 292] gi|260671512|gb|EEX58333.1| zinc-binding protein [Brucella abortus bv. 2 str. 86/8/59] Length = 57 Score = 69.7 bits (169), Expect = 1e-10, Method: Composition-based stats. Identities = 25/50 (50%), Positives = 31/50 (62%) Query: 11 SICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK 60 CPEC K S E YPFCS +C++IDL+RWL G YVIA + +E Sbjct: 8 RPCPECGKPSTREAYPFCSPRCKNIDLNRWLSGSYVIAGKPLGEEDENDS 57 >gi|148252480|ref|YP_001237065.1| hypothetical protein BBta_0901 [Bradyrhizobium sp. BTAi1] gi|146404653|gb|ABQ33159.1| hypothetical protein BBta_0901 [Bradyrhizobium sp. BTAi1] Length = 64 Score = 69.7 bits (169), Expect = 1e-10, Method: Composition-based stats. Identities = 21/48 (43%), Positives = 29/48 (60%) Query: 11 SICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C + + PFCS++CR +DL RWL G YVI A E ++ + E Sbjct: 17 RRCPICNRPAADASRPFCSSRCRDVDLHRWLSGSYVIPATEGDEDDVE 64 >gi|209544280|ref|YP_002276509.1| hypothetical protein Gdia_2136 [Gluconacetobacter diazotrophicus PAl 5] gi|209531957|gb|ACI51894.1| protein of unknown function DUF329 [Gluconacetobacter diazotrophicus PAl 5] Length = 82 Score = 69.7 bits (169), Expect = 1e-10, Method: Composition-based stats. Identities = 17/52 (32%), Positives = 21/52 (40%) Query: 11 SICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 CP C + F PFCS +C IDL RW Y + + E I Sbjct: 15 PPCPICGRPGQTAFRPFCSKRCGDIDLGRWFSETYRVPDPDQGWDHGEDGQI 66 >gi|312113072|ref|YP_004010668.1| hypothetical protein Rvan_0280 [Rhodomicrobium vannielii ATCC 17100] gi|311218201|gb|ADP69569.1| protein of unknown function DUF329 [Rhodomicrobium vannielii ATCC 17100] Length = 65 Score = 69.3 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Query: 3 TSDFRSLKSICPECR-KGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 + C C + + E+ PFCS +C +DL RWL G Y I +E+ +E Sbjct: 5 RDEKAEGAPPCVICGMRPQVPEYRPFCSRRCADVDLHRWLGGVYAIPVKPEEEEDE 60 >gi|114767232|ref|ZP_01446097.1| hypothetical protein 1100011001181_R2601_09315 [Pelagibaca bermudensis HTCC2601] gi|114540642|gb|EAU43713.1| hypothetical protein R2601_09315 [Roseovarius sp. HTCC2601] Length = 62 Score = 69.3 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 17/42 (40%), Positives = 26/42 (61%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEK 54 CP C K + ++ PFCS +C IDL++W+ G Y I + + E Sbjct: 3 CPICGKPTEAKYRPFCSGRCADIDLAKWVSGSYAIPSTDPED 44 >gi|254561771|ref|YP_003068866.1| hypothetical protein METDI3362 [Methylobacterium extorquens DM4] gi|254269049|emb|CAX25010.1| conserved hypothetical protein, UPF0243 zinc-binding protein [Methylobacterium extorquens DM4] Length = 72 Score = 69.3 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 20/44 (45%), Positives = 26/44 (59%) Query: 11 SICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEK 54 + CP C K + E PFCS +C IDL RWL YVI E+++ Sbjct: 15 APCPICGKPARTETKPFCSPRCADIDLGRWLGERYVIPGPEEDE 58 >gi|118593155|ref|ZP_01550541.1| zinc-binding protein [Stappia aggregata IAM 12614] gi|118434240|gb|EAV40895.1| zinc-binding protein [Stappia aggregata IAM 12614] Length = 67 Score = 69.3 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 21/56 (37%), Positives = 28/56 (50%) Query: 2 QTSDFRSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 ++ CP C K S + YPFCS +C IDL+RW Y I VE + +E Sbjct: 3 ESQKPERRMRPCPICSKLSTPDNYPFCSDRCAKIDLNRWFSEGYTIPVVETDDIDE 58 >gi|218530802|ref|YP_002421618.1| hypothetical protein Mchl_2851 [Methylobacterium chloromethanicum CM4] gi|254801563|sp|B7KPV4|Y2851_METC4 RecName: Full=UPF0243 zinc-binding protein Mchl_2851 gi|218523105|gb|ACK83690.1| protein of unknown function DUF329 [Methylobacterium chloromethanicum CM4] Length = 72 Score = 68.9 bits (167), Expect = 2e-10, Method: Composition-based stats. Identities = 20/44 (45%), Positives = 26/44 (59%) Query: 11 SICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEK 54 + CP C K + E PFCS +C IDL RWL YVI E+++ Sbjct: 15 APCPICGKPARTETKPFCSPRCADIDLGRWLGERYVIPGPEEDE 58 >gi|240139371|ref|YP_002963846.1| hypothetical protein MexAM1_META1p2816 [Methylobacterium extorquens AM1] gi|240009343|gb|ACS40569.1| conserved hypothetical protein, UPF0243 zinc-binding protein [Methylobacterium extorquens AM1] Length = 72 Score = 68.9 bits (167), Expect = 2e-10, Method: Composition-based stats. Identities = 21/44 (47%), Positives = 26/44 (59%) Query: 11 SICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEK 54 + CP C K + E PFCS +C IDL RWL YVI E+E+ Sbjct: 15 APCPICGKPARTETKPFCSPRCADIDLGRWLGERYVIPGPEEEE 58 >gi|222087233|ref|YP_002545768.1| hypothetical protein Arad_4034 [Agrobacterium radiobacter K84] gi|221724681|gb|ACM27837.1| conserved hypothetical protein [Agrobacterium radiobacter K84] Length = 71 Score = 68.5 bits (166), Expect = 3e-10, Method: Composition-based stats. Identities = 25/53 (47%), Positives = 31/53 (58%) Query: 5 DFRSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 + C EC + SM E YPFCS +CRS DLSRWL+G Y I ED+ + Sbjct: 14 EPLRKTRPCVECGRPSMREHYPFCSDRCRSADLSRWLNGSYAIPVAEDQTKAD 66 >gi|254462810|ref|ZP_05076226.1| conserved domain protein [Rhodobacterales bacterium HTCC2083] gi|206679399|gb|EDZ43886.1| conserved domain protein [Rhodobacteraceae bacterium HTCC2083] Length = 68 Score = 68.5 bits (166), Expect = 3e-10, Method: Composition-based stats. Identities = 17/44 (38%), Positives = 27/44 (61%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 CP C K + PFCS +C +DL++WL G Y +A+ + + +E Sbjct: 3 CPICEKAVDAAYKPFCSKRCADVDLAKWLSGSYALASNDPDDAE 46 >gi|188581996|ref|YP_001925441.1| hypothetical protein Mpop_2751 [Methylobacterium populi BJ001] gi|179345494|gb|ACB80906.1| protein of unknown function DUF329 [Methylobacterium populi BJ001] Length = 67 Score = 68.5 bits (166), Expect = 3e-10, Method: Composition-based stats. Identities = 22/49 (44%), Positives = 25/49 (51%) Query: 10 KSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K + E PFCS +C IDL RWL YVI EDE+ Sbjct: 9 SPPCPICGKPAQPETRPFCSPRCADIDLGRWLGERYVIPGPEDEEMPRP 57 >gi|163794245|ref|ZP_02188217.1| hypothetical protein BAL199_21299 [alpha proteobacterium BAL199] gi|159180413|gb|EDP64934.1| hypothetical protein BAL199_21299 [alpha proteobacterium BAL199] Length = 72 Score = 68.1 bits (165), Expect = 3e-10, Method: Composition-based stats. Identities = 17/43 (39%), Positives = 30/43 (69%) Query: 7 RSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAA 49 ++ +S CP C+K S+ ++ PFCS +C+++DL +WL G Y + Sbjct: 9 KARRSSCPICKKPSVADYRPFCSPRCKTLDLGQWLSGGYRLPT 51 >gi|328544716|ref|YP_004304825.1| zinc-binding protein [polymorphum gilvum SL003B-26A1] gi|326414458|gb|ADZ71521.1| zinc-binding protein [Polymorphum gilvum SL003B-26A1] Length = 65 Score = 68.1 bits (165), Expect = 4e-10, Method: Composition-based stats. Identities = 24/54 (44%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Query: 2 QTSDFRSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKS 55 D R ++ CP C K S +E YPFCS +C IDL+RWL Y I VE + + Sbjct: 8 SEQDKRRMR-PCPICSKLSTLEHYPFCSDRCAKIDLNRWLSESYTIPVVETDDA 60 >gi|254449891|ref|ZP_05063328.1| conserved domain protein [Octadecabacter antarcticus 238] gi|198264297|gb|EDY88567.1| conserved domain protein [Octadecabacter antarcticus 238] Length = 65 Score = 68.1 bits (165), Expect = 4e-10, Method: Composition-based stats. Identities = 19/50 (38%), Positives = 30/50 (60%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 CP C K + F PFCS +C +DL++WL G Y IA+ + + +E + + Sbjct: 3 CPICDKETNAAFRPFCSKRCGDVDLAKWLGGGYAIASTDPDDMDELIDAL 52 >gi|260425253|ref|ZP_05779233.1| conserved domain protein [Citreicella sp. SE45] gi|260423193|gb|EEX16443.1| conserved domain protein [Citreicella sp. SE45] Length = 62 Score = 67.8 bits (164), Expect = 4e-10, Method: Composition-based stats. Identities = 15/40 (37%), Positives = 25/40 (62%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVED 52 CP C K + ++ PFCS +C +DL++W+ G Y I + + Sbjct: 3 CPICGKPTETKYRPFCSKRCADVDLAKWVSGSYAIPSTDP 42 >gi|298290142|ref|YP_003692081.1| hypothetical protein Snov_0125 [Starkeya novella DSM 506] gi|296926653|gb|ADH87462.1| protein of unknown function DUF329 [Starkeya novella DSM 506] Length = 73 Score = 67.8 bits (164), Expect = 5e-10, Method: Composition-based stats. Identities = 18/39 (46%), Positives = 24/39 (61%) Query: 12 ICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAV 50 CP C K S+ ++ PFCS++C +DL RWL G Y I Sbjct: 15 TCPICGKPSVEKYKPFCSSRCADVDLHRWLTGAYAIPVT 53 >gi|260467497|ref|ZP_05813665.1| protein of unknown function DUF329 [Mesorhizobium opportunistum WSM2075] gi|259028724|gb|EEW30032.1| protein of unknown function DUF329 [Mesorhizobium opportunistum WSM2075] Length = 65 Score = 67.4 bits (163), Expect = 6e-10, Method: Composition-based stats. Identities = 26/41 (63%), Positives = 29/41 (70%) Query: 10 KSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAV 50 K CPEC K S E YPFCST+C+ IDL+RWL G YVI A Sbjct: 13 KRPCPECGKPSARETYPFCSTRCKDIDLNRWLKGAYVIKAR 53 >gi|163852047|ref|YP_001640090.1| hypothetical protein Mext_2627 [Methylobacterium extorquens PA1] gi|254801344|sp|A9W613|Y2627_METEP RecName: Full=UPF0243 zinc-binding protein Mext_2627 gi|163663652|gb|ABY31019.1| protein of unknown function DUF329 [Methylobacterium extorquens PA1] Length = 72 Score = 67.4 bits (163), Expect = 7e-10, Method: Composition-based stats. Identities = 21/44 (47%), Positives = 26/44 (59%) Query: 11 SICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEK 54 + CP C K + E PFCS +C IDL RWL YVI E+E+ Sbjct: 15 APCPICGKPARTETKPFCSPRCADIDLGRWLGERYVIPGPEEEE 58 >gi|114707696|ref|ZP_01440591.1| zinc-binding protein [Fulvimarina pelagi HTCC2506] gi|114536940|gb|EAU40069.1| zinc-binding protein [Fulvimarina pelagi HTCC2506] Length = 65 Score = 67.4 bits (163), Expect = 7e-10, Method: Composition-based stats. Identities = 22/60 (36%), Positives = 32/60 (53%) Query: 1 MQTSDFRSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK 60 + K CPEC + S E +PFCS +C+++DL+RWL G YVI +E + Sbjct: 5 ISKVTPLRRKRKCPECNRESSREHFPFCSERCKAVDLNRWLAGSYVIPDPSVSAGNDEEE 64 >gi|149203436|ref|ZP_01880406.1| hypothetical protein RTM1035_02425 [Roseovarius sp. TM1035] gi|149143269|gb|EDM31308.1| hypothetical protein RTM1035_02425 [Roseovarius sp. TM1035] Length = 60 Score = 67.0 bits (162), Expect = 7e-10, Method: Composition-based stats. Identities = 15/50 (30%), Positives = 28/50 (56%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 CP C++ + + PFCS +C +DL +W G+Y + + + EE + + Sbjct: 3 CPICQRKTDARYRPFCSRRCADVDLGKWFAGDYAVPSSDPADIEEALDAL 52 >gi|77464193|ref|YP_353697.1| hypothetical protein RSP_0623 [Rhodobacter sphaeroides 2.4.1] gi|126463035|ref|YP_001044149.1| hypothetical protein Rsph17029_2275 [Rhodobacter sphaeroides ATCC 17029] gi|221640076|ref|YP_002526338.1| hypothetical protein RSKD131_1977 [Rhodobacter sphaeroides KD131] gi|332559069|ref|ZP_08413391.1| hypothetical protein RSWS8N_08440 [Rhodobacter sphaeroides WS8N] gi|77388611|gb|ABA79796.1| conserved hypothetical protein [Rhodobacter sphaeroides 2.4.1] gi|126104699|gb|ABN77377.1| protein of unknown function DUF329 [Rhodobacter sphaeroides ATCC 17029] gi|221160857|gb|ACM01837.1| Hypothetical Protein RSKD131_1977 [Rhodobacter sphaeroides KD131] gi|332276781|gb|EGJ22096.1| hypothetical protein RSWS8N_08440 [Rhodobacter sphaeroides WS8N] Length = 60 Score = 67.0 bits (162), Expect = 8e-10, Method: Composition-based stats. Identities = 18/49 (36%), Positives = 27/49 (55%) Query: 12 ICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK 60 CP C + + + PFCS +C +DL WL G Y I A+ DE+ + + Sbjct: 2 TCPICGRPAEARYRPFCSRRCADVDLGHWLKGNYRIPALGDEEETPDDR 50 >gi|56709231|ref|YP_164911.1| hypothetical protein SPOA0450 [Ruegeria pomeroyi DSS-3] gi|67462018|sp|Q5LLE7|Y4450_SILPO RecName: Full=UPF0243 zinc-binding protein SPOA0450 gi|56680916|gb|AAV97581.1| conserved hypothetical protein [Ruegeria pomeroyi DSS-3] Length = 60 Score = 66.6 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 17/51 (33%), Positives = 29/51 (56%) Query: 12 ICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 CP C + + PFCS +C +DL++WL+G Y I A +++ E ++ Sbjct: 2 TCPICGSKTAPSYRPFCSKRCADLDLAKWLNGSYAIPASSEDEEEPLDQEA 52 >gi|13475395|ref|NP_106959.1| zinc-binding protein [Mesorhizobium loti MAFF303099] gi|31563284|sp|Q989F2|Y6451_RHILO RecName: Full=UPF0243 zinc-binding protein msl6451 gi|14026147|dbj|BAB52745.1| msl6451 [Mesorhizobium loti MAFF303099] Length = 65 Score = 66.6 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 23/41 (56%), Positives = 28/41 (68%) Query: 10 KSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAV 50 K CPEC K S + +PFCS +C+ IDL+RWL G YVI A Sbjct: 13 KRPCPECGKPSARDTFPFCSARCKDIDLNRWLKGAYVIKAR 53 >gi|126729158|ref|ZP_01744972.1| hypothetical protein SSE37_23199 [Sagittula stellata E-37] gi|126710148|gb|EBA09200.1| hypothetical protein SSE37_23199 [Sagittula stellata E-37] Length = 60 Score = 66.6 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 16/40 (40%), Positives = 24/40 (60%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVED 52 CP C K + + PFCS +C +DL++WL G Y I + + Sbjct: 3 CPICGKPTEPKVRPFCSKRCADVDLAKWLGGGYAIPSDDP 42 >gi|329889114|ref|ZP_08267457.1| hypothetical protein BDIM_07890 [Brevundimonas diminuta ATCC 11568] gi|328844415|gb|EGF93979.1| hypothetical protein BDIM_07890 [Brevundimonas diminuta ATCC 11568] Length = 54 Score = 66.2 bits (160), Expect = 1e-09, Method: Composition-based stats. Identities = 19/47 (40%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Query: 13 CPECRK-GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP CR+ ++ + PFCS +C IDL RW G Y I A + E++ Sbjct: 4 CPICRRAEAVAAYKPFCSKRCADIDLQRWFTGGYAIPAEDAHDDEKD 50 >gi|158424768|ref|YP_001526060.1| hypothetical protein AZC_3144 [Azorhizobium caulinodans ORS 571] gi|172047994|sp|A8IC06|Y3144_AZOC5 RecName: Full=UPF0243 zinc-binding protein AZC_3144 gi|158331657|dbj|BAF89142.1| hypothetical protein [Azorhizobium caulinodans ORS 571] Length = 68 Score = 66.2 bits (160), Expect = 1e-09, Method: Composition-based stats. Identities = 18/39 (46%), Positives = 23/39 (58%) Query: 10 KSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIA 48 CP C K S+ + PFCS +C +DL+RWL G Y I Sbjct: 11 PKPCPICGKPSIERYKPFCSKRCADVDLNRWLTGAYAIP 49 >gi|254505068|ref|ZP_05117219.1| conserved domain protein [Labrenzia alexandrii DFL-11] gi|222441139|gb|EEE47818.1| conserved domain protein [Labrenzia alexandrii DFL-11] Length = 67 Score = 66.2 bits (160), Expect = 1e-09, Method: Composition-based stats. Identities = 21/47 (44%), Positives = 24/47 (51%) Query: 6 FRSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVED 52 + CP C K S E YPFCS +C IDL+RW Y I VE Sbjct: 9 PQRRMRPCPICSKLSTPENYPFCSDRCAKIDLNRWFSEGYSIPVVET 55 >gi|83594098|ref|YP_427850.1| hypothetical protein Rru_A2766 [Rhodospirillum rubrum ATCC 11170] gi|83577012|gb|ABC23563.1| Protein of unknown function DUF329 [Rhodospirillum rubrum ATCC 11170] Length = 78 Score = 66.2 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 19/51 (37%), Positives = 23/51 (45%) Query: 7 RSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 R CP C + PFCS +C IDL RW+ G Y I E +E Sbjct: 27 RVTARACPICGHPVEARYRPFCSKRCADIDLGRWVLGTYRIETNEAPDPDE 77 >gi|288962445|ref|YP_003452740.1| hypothetical protein AZL_d03700 [Azospirillum sp. B510] gi|288914711|dbj|BAI76196.1| hypothetical protein AZL_d03700 [Azospirillum sp. B510] Length = 80 Score = 65.8 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 19/46 (41%), Positives = 28/46 (60%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C + + PFCS +C IDLSRWL G Y I + E++++ + Sbjct: 25 CPICGRPTEPATRPFCSKRCADIDLSRWLGGVYRIESPENQENPAD 70 >gi|114569684|ref|YP_756364.1| hypothetical protein Mmar10_1133 [Maricaulis maris MCS10] gi|114340146|gb|ABI65426.1| protein of unknown function DUF329 [Maricaulis maris MCS10] Length = 55 Score = 65.8 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 17/46 (36%), Positives = 27/46 (58%) Query: 12 ICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP CR+ + +F PFCS +C +DL +W+ G Y I + +E+ Sbjct: 2 KCPICRQPADPDFKPFCSKRCADVDLGKWVSGSYAIPGEPADVAED 47 >gi|119384530|ref|YP_915586.1| hypothetical protein Pden_1793 [Paracoccus denitrificans PD1222] gi|119374297|gb|ABL69890.1| protein of unknown function DUF329 [Paracoccus denitrificans PD1222] Length = 49 Score = 65.4 bits (158), Expect = 2e-09, Method: Composition-based stats. Identities = 17/48 (35%), Positives = 26/48 (54%) Query: 12 ICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEV 59 CP C K + + PFCS +C +DL+RWL G+Y I ++ + Sbjct: 2 KCPICGKPASERYRPFCSRRCADVDLARWLRGDYRIPGEPAPDNDRDA 49 >gi|209964943|ref|YP_002297858.1| hypothetical protein RC1_1644 [Rhodospirillum centenum SW] gi|209958409|gb|ACI99045.1| conserved domain protein [Rhodospirillum centenum SW] Length = 73 Score = 65.4 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 18/54 (33%), Positives = 28/54 (51%) Query: 9 LKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 ++ CP C + + PFCS +C +DLSRWL G Y + V+ ++ D Sbjct: 15 RRAACPVCGRPADPALKPFCSRRCADVDLSRWLGGVYRVPVVDRDEDAFPDTDA 68 >gi|326388841|ref|ZP_08210423.1| hypothetical protein Y88_3585 [Novosphingobium nitrogenifigens DSM 19370] gi|326206441|gb|EGD57276.1| hypothetical protein Y88_3585 [Novosphingobium nitrogenifigens DSM 19370] Length = 60 Score = 65.4 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 19/54 (35%), Positives = 27/54 (50%) Query: 8 SLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 L CP C K + + PFCS++CR DL RWL Y I E++ ++ Sbjct: 6 PLVRRCPICGKPRVEQHAPFCSSRCRDRDLMRWLDEGYAIPGPSTLGGEDDDRE 59 >gi|254418005|ref|ZP_05031729.1| hypothetical protein BBAL3_315 [Brevundimonas sp. BAL3] gi|196184182|gb|EDX79158.1| hypothetical protein BBAL3_315 [Brevundimonas sp. BAL3] Length = 54 Score = 65.1 bits (157), Expect = 3e-09, Method: Composition-based stats. Identities = 22/51 (43%), Positives = 31/51 (60%), Gaps = 1/51 (1%) Query: 11 SICPECRKG-SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK 60 S CP CRK + ++ PFCS +C +DL RW G Y I A DE +E++ + Sbjct: 2 STCPICRKADADPKYKPFCSRRCSEVDLQRWFTGGYAIPAALDEGAEDDGE 52 >gi|110678991|ref|YP_681998.1| hypothetical protein RD1_1688 [Roseobacter denitrificans OCh 114] gi|109455107|gb|ABG31312.1| conserved hypothetical protein [Roseobacter denitrificans OCh 114] Length = 65 Score = 65.1 bits (157), Expect = 3e-09, Method: Composition-based stats. Identities = 16/44 (36%), Positives = 27/44 (61%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 CP C K ++ PFCS +C +DL+RW +G Y +A+ + ++ Sbjct: 3 CPICGKPTVQAVSPFCSKRCADLDLARWFNGSYAVASENPDDAD 46 >gi|114769476|ref|ZP_01447102.1| hypothetical protein OM2255_07080 [alpha proteobacterium HTCC2255] gi|114550393|gb|EAU53274.1| hypothetical protein OM2255_07080 [alpha proteobacterium HTCC2255] Length = 60 Score = 65.1 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 18/45 (40%), Positives = 26/45 (57%) Query: 12 ICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 CP C K ++ PFCS +C +DL +WL Y I AVE ++ + Sbjct: 2 PCPMCNKSQDKKYRPFCSKRCADLDLGKWLTESYSIPAVETDEED 46 >gi|163868983|ref|YP_001610213.1| hypothetical protein Btr_2032 [Bartonella tribocorum CIP 105476] gi|161018660|emb|CAK02218.1| hypothetical protein BT_2032 [Bartonella tribocorum CIP 105476] Length = 51 Score = 64.7 bits (156), Expect = 4e-09, Method: Composition-based stats. Identities = 19/42 (45%), Positives = 26/42 (61%) Query: 17 RKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 + S YPFCS++CR+IDL+RWL G Y++ EEE Sbjct: 10 GQMSQKSAYPFCSSRCRAIDLNRWLSGSYILPPPPQVSDEEE 51 >gi|114799923|ref|YP_760436.1| hypothetical protein HNE_1731 [Hyphomonas neptunium ATCC 15444] gi|123028040|sp|Q0C1F7|Y1731_HYPNA RecName: Full=UPF0243 zinc-binding protein HNE_1731 gi|114740097|gb|ABI78222.1| conserved hypothetical protein [Hyphomonas neptunium ATCC 15444] Length = 73 Score = 64.7 bits (156), Expect = 4e-09, Method: Composition-based stats. Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 1/58 (1%) Query: 5 DFRSLKSICPECRKGSMV-EFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 + +C CRK ++ E+ PFCS +C DL +WL G YVI E++++ Sbjct: 6 NPSQRTPLCARCRKQAVAAEYRPFCSKRCADADLGQWLKGGYVIPGAAAEQADDTAGP 63 >gi|163734092|ref|ZP_02141533.1| hypothetical protein RLO149_04099 [Roseobacter litoralis Och 149] gi|161392628|gb|EDQ16956.1| hypothetical protein RLO149_04099 [Roseobacter litoralis Och 149] Length = 65 Score = 64.7 bits (156), Expect = 4e-09, Method: Composition-based stats. Identities = 17/51 (33%), Positives = 28/51 (54%) Query: 12 ICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 CP C K + PFCS +C +DL+RW +G Y +A+ + ++ + I Sbjct: 2 TCPICGKPPIETARPFCSKRCADLDLARWFNGSYAVASENPDDADALQEAI 52 >gi|304393253|ref|ZP_07375181.1| conserved domain protein [Ahrensia sp. R2A130] gi|303294260|gb|EFL88632.1| conserved domain protein [Ahrensia sp. R2A130] Length = 62 Score = 64.3 bits (155), Expect = 6e-09, Method: Composition-based stats. Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 2/59 (3%) Query: 1 MQTSDFRSLKS--ICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 M L+ CP+C+K S + YPFCS +C +DL WL G Y I+ + + Sbjct: 1 MTKDTVTPLRKQVPCPQCKKQSTRDTYPFCSRRCAQLDLGAWLSGGYAISGDSTDVPPD 59 >gi|46201809|ref|ZP_00208256.1| COG3024: Uncharacterized protein conserved in bacteria [Magnetospirillum magnetotacticum MS-1] Length = 56 Score = 64.3 bits (155), Expect = 6e-09, Method: Composition-based stats. Identities = 21/48 (43%), Positives = 28/48 (58%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK 60 CP C K + + PFCST+C +DL RWL+ Y AVED + E + Sbjct: 9 CPICGKAAEARYKPFCSTRCADVDLHRWLNESYRAPAVEDPEGLPEEE 56 >gi|83945212|ref|ZP_00957561.1| hypothetical protein OA2633_00555 [Oceanicaulis alexandrii HTCC2633] gi|83851382|gb|EAP89238.1| hypothetical protein OA2633_00555 [Oceanicaulis alexandrii HTCC2633] Length = 65 Score = 63.5 bits (153), Expect = 9e-09, Method: Composition-based stats. Identities = 16/43 (37%), Positives = 20/43 (46%) Query: 9 LKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVE 51 K CP C+K + PFCS +C DL RW G Y + Sbjct: 4 SKPGCPICKKPVDPRYRPFCSARCADADLGRWFSGAYAVPGEP 46 >gi|296532747|ref|ZP_06895429.1| zinc-binding protein [Roseomonas cervicalis ATCC 49957] gi|296266940|gb|EFH12883.1| zinc-binding protein [Roseomonas cervicalis ATCC 49957] Length = 69 Score = 63.1 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 18/46 (39%), Positives = 22/46 (47%) Query: 2 QTSDFRSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVI 47 + CP C K + PFCS +CR +DL RWL G Y I Sbjct: 5 SPAKPARRPPACPVCGKPAEAAHRPFCSDRCRQVDLGRWLSGAYAI 50 >gi|83312435|ref|YP_422699.1| hypothetical protein amb3336 [Magnetospirillum magneticum AMB-1] gi|82947276|dbj|BAE52140.1| Uncharacterized protein conserved in bacteria [Magnetospirillum magneticum AMB-1] Length = 56 Score = 62.7 bits (151), Expect = 1e-08, Method: Composition-based stats. Identities = 18/44 (40%), Positives = 25/44 (56%) Query: 11 SICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEK 54 C C K + ++ PFCS +C +DL RWL+ Y AVED + Sbjct: 7 PACAICGKPAQPKYKPFCSARCADVDLHRWLNESYRAPAVEDPE 50 >gi|170749358|ref|YP_001755618.1| hypothetical protein Mrad2831_2951 [Methylobacterium radiotolerans JCM 2831] gi|170655880|gb|ACB24935.1| protein of unknown function DUF329 [Methylobacterium radiotolerans JCM 2831] Length = 61 Score = 62.7 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 18/40 (45%), Positives = 24/40 (60%) Query: 9 LKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIA 48 CP CR+ S+ +F PFCS +C +DL RWL+ Y I Sbjct: 6 RPPPCPICRQPSVPDFRPFCSQRCADVDLGRWLNERYAIP 45 >gi|146276654|ref|YP_001166813.1| hypothetical protein Rsph17025_0602 [Rhodobacter sphaeroides ATCC 17025] gi|145554895|gb|ABP69508.1| protein of unknown function DUF329 [Rhodobacter sphaeroides ATCC 17025] Length = 60 Score = 62.4 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 21/36 (58%) Query: 12 ICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVI 47 CP C + + ++ PFCS +C +DL WL G Y I Sbjct: 2 TCPICGRAAEAKYRPFCSRRCADVDLGHWLKGNYRI 37 >gi|89070659|ref|ZP_01157932.1| hypothetical protein OG2516_17433 [Oceanicola granulosus HTCC2516] gi|89043739|gb|EAR49942.1| hypothetical protein OG2516_17433 [Oceanicola granulosus HTCC2516] Length = 60 Score = 62.4 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 16/50 (32%), Positives = 25/50 (50%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 CP C + + PFCS +C IDL +WL G Y + ++S+ + Sbjct: 3 CPICSGPTDARYRPFCSRRCADIDLGKWLTGAYRVPGPPADESDLDEPSA 52 >gi|83943983|ref|ZP_00956440.1| hypothetical protein EE36_10070 [Sulfitobacter sp. EE-36] gi|83845230|gb|EAP83110.1| hypothetical protein EE36_10070 [Sulfitobacter sp. EE-36] Length = 63 Score = 62.4 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 16/43 (37%), Positives = 26/43 (60%) Query: 12 ICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEK 54 CP C + S ++ PFCS +C +DL++WL+G Y + + E Sbjct: 2 TCPICDRESSPKYRPFCSGRCADVDLAKWLNGSYATPSRDPED 44 >gi|302382823|ref|YP_003818646.1| hypothetical protein Bresu_1712 [Brevundimonas subvibrioides ATCC 15264] gi|302193451|gb|ADL01023.1| protein of unknown function DUF329 [Brevundimonas subvibrioides ATCC 15264] Length = 55 Score = 62.4 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 19/52 (36%), Positives = 32/52 (61%), Gaps = 1/52 (1%) Query: 11 SICPECRK-GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 S+CP CRK ++ + PFCS +C +DL RWL G YV+ ++ + + ++ Sbjct: 2 SVCPICRKNPTVAAYRPFCSRRCADLDLQRWLVGAYVLPDTDEGVPDADPEN 53 >gi|307945969|ref|ZP_07661304.1| conserved domain protein [Roseibium sp. TrichSKD4] gi|307769633|gb|EFO28859.1| conserved domain protein [Roseibium sp. TrichSKD4] Length = 65 Score = 62.0 bits (149), Expect = 2e-08, Method: Composition-based stats. Identities = 21/50 (42%), Positives = 25/50 (50%) Query: 1 MQTSDFRSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAV 50 ++T CP C K S E YPFCS +C +DL RW Y I AV Sbjct: 3 VETGKAERRMRPCPICSKLSSPEDYPFCSERCAKVDLHRWFSEGYSIPAV 52 >gi|108763065|ref|YP_632599.1| hypothetical protein MXAN_4428 [Myxococcus xanthus DK 1622] gi|108466945|gb|ABF92130.1| conserved hypothetical protein [Myxococcus xanthus DK 1622] Length = 97 Score = 62.0 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 4/64 (6%) Query: 1 MQTSDFRSLKSICPECRKGSMV----EFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 + + CP C+K +PFCS +CR++DL RWL EY + + ++ E Sbjct: 22 LSRTPSTMSTLTCPICQKPVPPRGENAAFPFCSKRCRAVDLGRWLGEEYRVPDRQADEQE 81 Query: 57 EEVK 60 +E+ Sbjct: 82 DELP 85 >gi|83954557|ref|ZP_00963268.1| hypothetical protein NAS141_15088 [Sulfitobacter sp. NAS-14.1] gi|83840841|gb|EAP80012.1| hypothetical protein NAS141_15088 [Sulfitobacter sp. NAS-14.1] Length = 63 Score = 61.6 bits (148), Expect = 3e-08, Method: Composition-based stats. Identities = 14/43 (32%), Positives = 26/43 (60%) Query: 12 ICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEK 54 CP C + + ++ PFCS +C +DL++WL+G Y + + + Sbjct: 2 TCPICDRETSPKYRPFCSGRCADVDLAKWLNGSYATPSRDPQD 44 >gi|255262896|ref|ZP_05342238.1| conserved domain protein [Thalassiobium sp. R2A62] gi|255105231|gb|EET47905.1| conserved domain protein [Thalassiobium sp. R2A62] Length = 56 Score = 61.6 bits (148), Expect = 3e-08, Method: Composition-based stats. Identities = 16/49 (32%), Positives = 28/49 (57%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP C K ++ + PFCS +C +DL++W +G Y +A+ + + D Sbjct: 3 CPMCEKETVATYRPFCSKRCADLDLAKWFNGTYAVASNDPDDEVPPQAD 51 >gi|254486386|ref|ZP_05099591.1| conserved domain protein [Roseobacter sp. GAI101] gi|214043255|gb|EEB83893.1| conserved domain protein [Roseobacter sp. GAI101] Length = 63 Score = 61.6 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 16/44 (36%), Positives = 25/44 (56%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 CP C ++ PFCS +C IDL++WL+G Y + + + E Sbjct: 3 CPICSGDVSAKYRPFCSRRCADIDLAKWLNGSYAAPSNDPDDIE 46 >gi|90425885|ref|YP_534255.1| zinc-binding protein [Rhodopseudomonas palustris BisB18] gi|90107899|gb|ABD89936.1| protein of unknown function DUF329 [Rhodopseudomonas palustris BisB18] Length = 61 Score = 61.6 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 18/51 (35%), Positives = 23/51 (45%), Gaps = 3/51 (5%) Query: 1 MQTSDFRSLKSI---CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIA 48 M + CP C K + PFCS +CR +DL+RWL Y I Sbjct: 1 MPAEPPANGAKPEKRCPICGKPATAASRPFCSERCRDVDLNRWLSNSYSIP 51 >gi|87199077|ref|YP_496334.1| hypothetical protein Saro_1055 [Novosphingobium aromaticivorans DSM 12444] gi|87134758|gb|ABD25500.1| protein of unknown function DUF329 [Novosphingobium aromaticivorans DSM 12444] Length = 57 Score = 60.4 bits (145), Expect = 8e-08, Method: Composition-based stats. Identities = 19/48 (39%), Positives = 22/48 (45%) Query: 11 SICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K PFCST+CR DL RWL Y + E E+ Sbjct: 10 KRCPICGKPRSEAHSPFCSTRCRDRDLVRWLEDGYALPGRPAEVDPED 57 >gi|148264347|ref|YP_001231053.1| hypothetical protein Gura_2301 [Geobacter uraniireducens Rf4] gi|146397847|gb|ABQ26480.1| protein of unknown function DUF329 [Geobacter uraniireducens Rf4] Length = 74 Score = 59.3 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 20/56 (35%), Positives = 31/56 (55%), Gaps = 3/56 (5%) Query: 9 LKSICPECRKGSMVE---FYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 K +CP+CRK + E + PFCS +C+ IDL W+ +Y I + +EE + Sbjct: 19 KKRLCPQCRKDVVWEENPYRPFCSERCKLIDLGAWVTEDYRIPGEKKADDDEEESE 74 >gi|300690355|ref|YP_003751350.1| hypothetical protein RPSI07_0677 [Ralstonia solanacearum PSI07] gi|299077415|emb|CBJ50041.1| conserved protein of unknown function, UPF0243 family [Ralstonia solanacearum PSI07] Length = 71 Score = 58.9 bits (141), Expect = 2e-07, Method: Composition-based stats. Identities = 19/54 (35%), Positives = 24/54 (44%), Gaps = 4/54 (7%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP C K + PFCS +CR IDL W +Y I VED+ + Sbjct: 7 KCPTCGKPVPWVPESRYRPFCSERCRQIDLGAWAAEQYTIPVVEDDDLPPDAPG 60 >gi|260752537|ref|YP_003225430.1| hypothetical protein Za10_0294 [Zymomonas mobilis subsp. mobilis NCIMB 11163] gi|258551900|gb|ACV74846.1| conserved hypothetical protein [Zymomonas mobilis subsp. mobilis NCIMB 11163] Length = 61 Score = 58.5 bits (140), Expect = 3e-07, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 25/57 (43%) Query: 2 QTSDFRSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 + + K CP C + EF PFCS CR DL WL Y + + + + + Sbjct: 3 SATRKNAHKGKCPICGAPTKAEFRPFCSRGCRDRDLLNWLGDAYRLPVKDLQAEDGD 59 >gi|149185948|ref|ZP_01864263.1| hypothetical protein ED21_24481 [Erythrobacter sp. SD-21] gi|148830509|gb|EDL48945.1| hypothetical protein ED21_24481 [Erythrobacter sp. SD-21] Length = 59 Score = 58.5 bits (140), Expect = 3e-07, Method: Composition-based stats. Identities = 15/52 (28%), Positives = 23/52 (44%) Query: 9 LKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK 60 + CP C+K + PFCS +CR DL++W Y + E + Sbjct: 1 MSKPCPICKKPRTEKHAPFCSDRCRDRDLAQWFGDGYAVPGRPALPEEIAAE 52 >gi|332185520|ref|ZP_08387268.1| hypothetical protein SUS17_706 [Sphingomonas sp. S17] gi|332014498|gb|EGI56555.1| hypothetical protein SUS17_706 [Sphingomonas sp. S17] Length = 55 Score = 58.1 bits (139), Expect = 4e-07, Method: Composition-based stats. Identities = 18/51 (35%), Positives = 25/51 (49%) Query: 11 SICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 + CP C K S E PFCS C+ DL +WL Y I E ++ + + Sbjct: 2 TTCPICDKPSAPEHAPFCSRGCKDRDLLQWLGEGYRIPVKESDEEGLDSGE 52 >gi|300702976|ref|YP_003744578.1| hypothetical protein RCFBP_10630 [Ralstonia solanacearum CFBP2957] gi|299070639|emb|CBJ41934.1| conserved protein of unknown function, UPF0243 family [Ralstonia solanacearum CFBP2957] Length = 72 Score = 58.1 bits (139), Expect = 4e-07, Method: Composition-based stats. Identities = 18/54 (33%), Positives = 24/54 (44%), Gaps = 4/54 (7%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP C K + PFCS +C+ IDL W +Y I VED+ + Sbjct: 8 KCPTCGKPVPWVPESRYRPFCSERCKQIDLGAWAAEQYTIPVVEDDDLPTDAPG 61 >gi|326405165|ref|YP_004285247.1| hypothetical protein ACMV_30180 [Acidiphilium multivorum AIU301] gi|325052027|dbj|BAJ82365.1| hypothetical protein ACMV_30180 [Acidiphilium multivorum AIU301] Length = 64 Score = 58.1 bits (139), Expect = 4e-07, Method: Composition-based stats. Identities = 18/56 (32%), Positives = 28/56 (50%) Query: 3 TSDFRSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 + R CP C + + PFCS +CR+IDL RW +Y + + E ++ E Sbjct: 9 SRPRRKPAGACPICGRKAQEAHRPFCSARCRAIDLGRWFGEDYRLPSDEAPLTDSE 64 >gi|85373321|ref|YP_457383.1| hypothetical protein ELI_02470 [Erythrobacter litoralis HTCC2594] gi|84786404|gb|ABC62586.1| hypothetical protein ELI_02470 [Erythrobacter litoralis HTCC2594] Length = 53 Score = 58.1 bits (139), Expect = 4e-07, Method: Composition-based stats. Identities = 16/48 (33%), Positives = 24/48 (50%) Query: 9 LKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 +K CP C+K + PFCST+C+ DL+RW Y + + Sbjct: 1 MKKPCPICKKPRSEDHSPFCSTRCKDRDLARWFTDGYSVPGPPAAPED 48 >gi|17547549|ref|NP_520951.1| hypothetical protein RSc2830 [Ralstonia solanacearum GMI1000] gi|31563273|sp|Q8XVK0|Y2830_RALSO RecName: Full=UPF0243 zinc-binding protein RSc2830 gi|17429853|emb|CAD16537.1| hypothetical zinc-binding protein [Ralstonia solanacearum GMI1000] Length = 71 Score = 57.7 bits (138), Expect = 5e-07, Method: Composition-based stats. Identities = 18/54 (33%), Positives = 24/54 (44%), Gaps = 4/54 (7%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP C K + PFCS +C+ IDL W +Y I VED+ + Sbjct: 7 KCPTCGKPVPWTPESRYRPFCSERCKQIDLGAWAAEQYTIPVVEDDDLPPDAPG 60 >gi|114327691|ref|YP_744848.1| ribonuclease G [Granulibacter bethesdensis CGDNIH1] gi|114315865|gb|ABI61925.1| ribonuclease G [Granulibacter bethesdensis CGDNIH1] Length = 76 Score = 57.7 bits (138), Expect = 5e-07, Method: Composition-based stats. Identities = 19/56 (33%), Positives = 25/56 (44%), Gaps = 5/56 (8%) Query: 11 SICPECRKGS-----MVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 S CP C K + PFCS +C +DL RWL +Y I E+ E + Sbjct: 21 SRCPICNKSGSDSTFDHSYMPFCSRRCADVDLGRWLQEDYRIPGPPAEQPESSDDE 76 >gi|83749811|ref|ZP_00946783.1| Hypothetical Protein RRSL_00264 [Ralstonia solanacearum UW551] gi|83723522|gb|EAP70728.1| Hypothetical Protein RRSL_00264 [Ralstonia solanacearum UW551] Length = 71 Score = 57.7 bits (138), Expect = 5e-07, Method: Composition-based stats. Identities = 18/54 (33%), Positives = 24/54 (44%), Gaps = 4/54 (7%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP C K + PFCS +C+ IDL W +Y I VED+ + Sbjct: 7 KCPTCGKPVPWVPESRYRPFCSERCKQIDLGAWAAEQYTIPVVEDDDLPPDAPG 60 >gi|115380602|ref|ZP_01467549.1| conserved domain protein [Stigmatella aurantiaca DW4/3-1] gi|310822027|ref|YP_003954385.1| hypothetical protein STAUR_4780 [Stigmatella aurantiaca DW4/3-1] gi|115362390|gb|EAU61678.1| conserved domain protein [Stigmatella aurantiaca DW4/3-1] gi|309395099|gb|ADO72558.1| conserved uncharacterized protein [Stigmatella aurantiaca DW4/3-1] Length = 67 Score = 57.7 bits (138), Expect = 6e-07, Method: Composition-based stats. Identities = 20/55 (36%), Positives = 31/55 (56%), Gaps = 4/55 (7%) Query: 11 SICPECRKGSMVE----FYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP C+K + YPFCS +CR++DL RWL EY + + ++ E+E+ Sbjct: 4 PACPICQKPTPPRAENPSYPFCSRRCRAVDLGRWLGEEYRVPDRQTDEREDELPP 58 >gi|85707921|ref|ZP_01038987.1| zinc-binding protein [Erythrobacter sp. NAP1] gi|85689455|gb|EAQ29458.1| zinc-binding protein [Erythrobacter sp. NAP1] Length = 61 Score = 57.4 bits (137), Expect = 6e-07, Method: Composition-based stats. Identities = 17/52 (32%), Positives = 25/52 (48%) Query: 10 KSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP C+K EF PFCS +C+ DL++W Y +A + +D Sbjct: 5 SKPCPICKKPRAEEFTPFCSQRCKDRDLAQWFGDGYTVAGEPVDPETIAARD 56 >gi|301165945|emb|CBW25518.1| conserved hypothetical protein [Bacteriovorax marinus SJ] Length = 80 Score = 57.4 bits (137), Expect = 7e-07, Method: Composition-based stats. Identities = 19/59 (32%), Positives = 30/59 (50%), Gaps = 3/59 (5%) Query: 6 FRSLKSICPECRKG---SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 R L+ CP C+K EF PFCS +C+ ID+ WL+ Y + + +E + + Sbjct: 3 KRKLEVKCPHCKKKFNYYEGEFRPFCSERCKMIDMGHWLNEGYTVPVKGNLDAELDFDE 61 >gi|56551907|ref|YP_162746.1| hypothetical protein ZMO1011 [Zymomonas mobilis subsp. mobilis ZM4] gi|67462020|sp|Q5NNS5|Y1011_ZYMMO RecName: Full=UPF0243 zinc-binding protein ZMO1011 gi|56543481|gb|AAV89635.1| hypothetical protein ZMO1011 [Zymomonas mobilis subsp. mobilis ZM4] Length = 61 Score = 57.4 bits (137), Expect = 7e-07, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 25/57 (43%) Query: 2 QTSDFRSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 + + K CP C + EF PFCS CR DL WL Y + + + + + Sbjct: 3 SATRKNAPKGKCPICGAPTKAEFRPFCSRGCRDRDLLNWLGDAYRLPVKDLQAEDGD 59 >gi|283780799|ref|YP_003371554.1| hypothetical protein Psta_3029 [Pirellula staleyi DSM 6068] gi|283439252|gb|ADB17694.1| protein of unknown function DUF329 [Pirellula staleyi DSM 6068] Length = 71 Score = 57.0 bits (136), Expect = 9e-07, Method: Composition-based stats. Identities = 19/48 (39%), Positives = 25/48 (52%), Gaps = 3/48 (6%) Query: 13 CPECRK---GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP C K + + PFCS +CR IDL RWL+ Y + + EE Sbjct: 6 CPICEKRFDQATTQAMPFCSERCRKIDLGRWLNEGYSVPVERIDDDEE 53 >gi|296284361|ref|ZP_06862359.1| hypothetical protein CbatJ_12081 [Citromicrobium bathyomarinum JL354] Length = 58 Score = 56.6 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Query: 10 KSICPECRKGSM-VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 K CP C+ E+ PFCS +CR DL+RW + Y + + E Sbjct: 5 KRPCPICKSSVQTPEYKPFCSARCRDKDLNRWFNDGYALPGRPADPEE 52 >gi|87121469|ref|ZP_01077358.1| hypothetical protein MED121_21595 [Marinomonas sp. MED121] gi|86163312|gb|EAQ64588.1| hypothetical protein MED121_21595 [Marinomonas sp. MED121] Length = 73 Score = 56.2 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 20/48 (41%), Positives = 26/48 (54%), Gaps = 4/48 (8%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 CP C+K S ++ PFCS +C+ IDL W G Y IA E+ E Sbjct: 13 CPNCKKEAVWSSENKYRPFCSERCKLIDLGEWASGTYAIAQAHSEEDE 60 >gi|114777495|ref|ZP_01452492.1| hypothetical protein SPV1_14384 [Mariprofundus ferrooxydans PV-1] gi|114552277|gb|EAU54779.1| hypothetical protein SPV1_14384 [Mariprofundus ferrooxydans PV-1] Length = 64 Score = 55.8 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 23/60 (38%), Positives = 33/60 (55%), Gaps = 2/60 (3%) Query: 4 SDFRSLKSICPECRKGSMVEF--YPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 S+ ++++ CP CRK + + +PFCS++CR IDL RW EY I E E D Sbjct: 2 SEAKTIRFRCPVCRKETTRDSEDFPFCSSRCRIIDLGRWASDEYSIPGEPVSPHELEPGD 61 >gi|187930143|ref|YP_001900630.1| hypothetical protein Rpic_3075 [Ralstonia pickettii 12J] gi|226703694|sp|B2UCW3|Y3075_RALPJ RecName: Full=UPF0243 zinc-binding protein Rpic_3075 gi|187727033|gb|ACD28198.1| protein of unknown function DUF329 [Ralstonia pickettii 12J] Length = 67 Score = 55.8 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 4/51 (7%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K + PFCS +C+ IDL W +Y I VE++ + Sbjct: 7 KCPSCGKPVPWVPESRYRPFCSERCKQIDLGAWAAEQYTIPVVEEDDLPDA 57 >gi|310816490|ref|YP_003964454.1| zinc-binding protein [Ketogulonicigenium vulgare Y25] gi|308755225|gb|ADO43154.1| zinc-binding protein [Ketogulonicigenium vulgare Y25] Length = 58 Score = 54.7 bits (130), Expect = 4e-06, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 23/33 (69%) Query: 21 MVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDE 53 M E+ PFCS +C +DL RWL G Y IA+ +++ Sbjct: 1 MAEYKPFCSARCADVDLGRWLGGNYRIASEDND 33 >gi|309783035|ref|ZP_07677754.1| conserved hypothetical protein [Ralstonia sp. 5_7_47FAA] gi|308918143|gb|EFP63821.1| conserved hypothetical protein [Ralstonia sp. 5_7_47FAA] Length = 67 Score = 54.7 bits (130), Expect = 4e-06, Method: Composition-based stats. Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 4/51 (7%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K + PFCS +C+ IDL W +Y I VE++ + Sbjct: 7 KCPSCGKAVPWVPESRYRPFCSERCKQIDLGAWAAEQYTIPVVEEDDLPDA 57 >gi|83721406|ref|YP_441679.1| hypothetical protein BTH_I1131 [Burkholderia thailandensis E264] gi|83655231|gb|ABC39294.1| Domain of unknown function (DUF329) superfamily [Burkholderia thailandensis E264] Length = 74 Score = 54.3 bits (129), Expect = 5e-06, Method: Composition-based stats. Identities = 18/54 (33%), Positives = 24/54 (44%), Gaps = 4/54 (7%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP C K F PFCS +C+ +DL W +Y I +DE E+ Sbjct: 13 KCPSCGKEVRWTPENRFRPFCSARCKQLDLGAWAAEKYRIGGTDDEAPSEDDAG 66 >gi|320103111|ref|YP_004178702.1| hypothetical protein Isop_1569 [Isosphaera pallida ATCC 43644] gi|319750393|gb|ADV62153.1| protein of unknown function DUF329 [Isosphaera pallida ATCC 43644] Length = 70 Score = 54.3 bits (129), Expect = 5e-06, Method: Composition-based stats. Identities = 21/55 (38%), Positives = 28/55 (50%), Gaps = 6/55 (10%) Query: 13 CPECRKG------SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP C + +PFCS +CR IDL RW+ G+Y I A EEE ++ Sbjct: 5 CPICGRSFEFVSFEATPSFPFCSERCRLIDLGRWIDGDYRIPATACGPDEEEAEE 59 >gi|241664293|ref|YP_002982653.1| hypothetical protein Rpic12D_2710 [Ralstonia pickettii 12D] gi|240866320|gb|ACS63981.1| protein of unknown function DUF329 [Ralstonia pickettii 12D] Length = 67 Score = 54.3 bits (129), Expect = 6e-06, Method: Composition-based stats. Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 4/51 (7%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K + PFCS +C+ IDL W +Y I VE++ + Sbjct: 7 KCPSCGKAVPWVPESRYRPFCSERCKQIDLGAWAAEQYTIPVVEEDDLPDA 57 >gi|187925429|ref|YP_001897071.1| hypothetical protein Bphyt_3457 [Burkholderia phytofirmans PsJN] gi|187716623|gb|ACD17847.1| protein of unknown function DUF329 [Burkholderia phytofirmans PsJN] Length = 65 Score = 54.3 bits (129), Expect = 6e-06, Method: Composition-based stats. Identities = 20/54 (37%), Positives = 24/54 (44%), Gaps = 4/54 (7%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP C K F PFCS +C+ IDL W +Y I E E S +E Sbjct: 6 KCPTCGKDVRWTPENRFRPFCSDRCKQIDLGAWAAEKYKIGGAEQEASSDETPG 59 >gi|326795294|ref|YP_004313114.1| hypothetical protein Marme_2030 [Marinomonas mediterranea MMB-1] gi|326546058|gb|ADZ91278.1| UPF0243 zinc-binding protein yacG [Marinomonas mediterranea MMB-1] Length = 74 Score = 53.9 bits (128), Expect = 7e-06, Method: Composition-based stats. Identities = 19/65 (29%), Positives = 30/65 (46%), Gaps = 4/65 (6%) Query: 3 TSDFRSLKSICPECRKGS----MVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 +S + + CP C S + PFCS +C+ IDL W + Y I E+ E Sbjct: 2 SSSESTPRIACPTCGTKSPWSTKNQNRPFCSDRCKLIDLGEWANESYAIPQQTSEEDEIF 61 Query: 59 VKDIL 63 +D++ Sbjct: 62 SEDLV 66 >gi|237747146|ref|ZP_04577626.1| conserved hypothetical protein [Oxalobacter formigenes HOxBLS] gi|229378497|gb|EEO28588.1| conserved hypothetical protein [Oxalobacter formigenes HOxBLS] Length = 62 Score = 53.9 bits (128), Expect = 7e-06, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 4/53 (7%) Query: 12 ICPECRKGSMVE----FYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK 60 CP C K + + PFCS +C+ IDL W +Y + A DE++ ++ Sbjct: 6 KCPMCGKDVEWKESNLYRPFCSERCKQIDLGAWAEEKYKVPAANDEENGDDDS 58 >gi|93006230|ref|YP_580667.1| hypothetical protein Pcryo_1404 [Psychrobacter cryohalolentis K5] gi|92393908|gb|ABE75183.1| protein of unknown function DUF329 [Psychrobacter cryohalolentis K5] Length = 65 Score = 53.9 bits (128), Expect = 7e-06, Method: Composition-based stats. Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 3/59 (5%) Query: 2 QTSDFRSLKSICPECRKGSM---VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 + CPEC K + ++ PFCS C+ IDL W + +Y + A S+E Sbjct: 6 SNASLSPKTYPCPECGKQTTWQDNKYKPFCSHHCKLIDLGAWANEDYTLPAESTPFSDE 64 >gi|162449943|ref|YP_001612310.1| hypothetical protein sce1672 [Sorangium cellulosum 'So ce 56'] gi|161160525|emb|CAN91830.1| hypothetical protein sce1672 [Sorangium cellulosum 'So ce 56'] Length = 90 Score = 53.9 bits (128), Expect = 7e-06, Method: Composition-based stats. Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 4/52 (7%) Query: 11 SICPECRKGSMVE----FYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 + CP CRK + +PFCS QC+ +DL WL G Y + + + Sbjct: 18 ARCPICRKSAGPRPENPVFPFCSPQCKLVDLGHWLDGGYRVPGPPVSSTGDA 69 >gi|323527417|ref|YP_004229570.1| hypothetical protein BC1001_3096 [Burkholderia sp. CCGE1001] gi|323384419|gb|ADX56510.1| protein of unknown function DUF329 [Burkholderia sp. CCGE1001] Length = 65 Score = 53.9 bits (128), Expect = 8e-06, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 23/54 (42%), Gaps = 4/54 (7%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP C K F PFCS +C+ IDL W +Y I + + +E Sbjct: 6 KCPTCGKDVRWTPENRFRPFCSERCKQIDLGAWATEKYKIGGTDQDAPSDETPG 59 >gi|53803866|ref|YP_114520.1| hypothetical protein MCA2090 [Methylococcus capsulatus str. Bath] gi|67462034|sp|Q606C8|Y2090_METCA RecName: Full=UPF0243 zinc-binding protein MCA2090 gi|53757627|gb|AAU91918.1| conserved hypothetical protein [Methylococcus capsulatus str. Bath] Length = 73 Score = 53.9 bits (128), Expect = 8e-06, Method: Composition-based stats. Identities = 18/48 (37%), Positives = 23/48 (47%), Gaps = 4/48 (8%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 CP C K F PFCS +CR IDL W + +Y I + +E Sbjct: 12 CPRCGKPVPWNETQRFRPFCSERCRLIDLGSWANEDYAIPGEPIDPAE 59 >gi|119773505|ref|YP_926245.1| hypothetical protein Sama_0364 [Shewanella amazonensis SB2B] gi|166232621|sp|A1S2G9|Y364_SHEAM RecName: Full=UPF0243 zinc-binding protein Sama_0364 gi|119766005|gb|ABL98575.1| conserved hypothetical protein [Shewanella amazonensis SB2B] Length = 71 Score = 53.9 bits (128), Expect = 8e-06, Method: Composition-based stats. Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 4/53 (7%) Query: 8 SLKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 +L CP+C+K + F PFCS +C+ IDL W ++ I +D E Sbjct: 2 TLTVKCPQCQKPVTWDASSAFKPFCSERCKLIDLGDWASEKHAIPVKDDISEE 54 >gi|254294125|ref|YP_003060148.1| hypothetical protein Hbal_1763 [Hirschia baltica ATCC 49814] gi|254042656|gb|ACT59451.1| protein of unknown function DUF329 [Hirschia baltica ATCC 49814] Length = 63 Score = 53.9 bits (128), Expect = 8e-06, Method: Composition-based stats. Identities = 17/51 (33%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Query: 9 LKSICPECRKG-SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 + IC C + F PFCS +C +DL W+ G YVI + E Sbjct: 2 SQKICTNCERSFDTKGFEPFCSKRCADVDLHHWMQGSYVIPGSGLDVEENA 52 >gi|322419465|ref|YP_004198688.1| hypothetical protein GM18_1949 [Geobacter sp. M18] gi|320125852|gb|ADW13412.1| protein of unknown function DUF329 [Geobacter sp. M18] Length = 62 Score = 53.5 bits (127), Expect = 9e-06, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 26/59 (44%), Gaps = 3/59 (5%) Query: 6 FRSLKSICPECRKGSMVE---FYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP C++ + + + PFCS +C+ IDL W Y I + E+ +D Sbjct: 2 CAVQTVKCPHCKREAQLAGNPYRPFCSERCKMIDLGTWASEGYRIPGEKAPHHEDNDED 60 >gi|307731059|ref|YP_003908283.1| hypothetical protein BC1003_3043 [Burkholderia sp. CCGE1003] gi|307585594|gb|ADN58992.1| protein of unknown function DUF329 [Burkholderia sp. CCGE1003] Length = 65 Score = 53.5 bits (127), Expect = 9e-06, Method: Composition-based stats. Identities = 18/54 (33%), Positives = 23/54 (42%), Gaps = 4/54 (7%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP C K F PFCS +C+ IDL W +Y I + E +E Sbjct: 6 KCPTCGKDVRWTPESRFRPFCSERCKQIDLGAWAAEKYKIGGTDQEAPSDETPG 59 >gi|167618597|ref|ZP_02387228.1| hypothetical protein BthaB_19975 [Burkholderia thailandensis Bt4] gi|257137848|ref|ZP_05586110.1| hypothetical protein BthaA_01279 [Burkholderia thailandensis E264] Length = 67 Score = 53.5 bits (127), Expect = 9e-06, Method: Composition-based stats. Identities = 18/54 (33%), Positives = 24/54 (44%), Gaps = 4/54 (7%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP C K F PFCS +C+ +DL W +Y I +DE E+ Sbjct: 6 KCPSCGKEVRWTPENRFRPFCSARCKQLDLGAWAAEKYRIGGTDDEAPSEDDAG 59 >gi|237749304|ref|ZP_04579784.1| conserved hypothetical protein [Oxalobacter formigenes OXCC13] gi|229380666|gb|EEO30757.1| conserved hypothetical protein [Oxalobacter formigenes OXCC13] Length = 59 Score = 53.5 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Query: 12 ICPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK 60 CP C K + PFCS +C+ IDL W +Y + +++++ E Sbjct: 6 KCPVCGKDVEWKEANAYRPFCSERCKQIDLGAWADEQYKVPGAAEDENDREEP 58 >gi|262380048|ref|ZP_06073203.1| conserved hypothetical protein [Acinetobacter radioresistens SH164] gi|262298242|gb|EEY86156.1| conserved hypothetical protein [Acinetobacter radioresistens SH164] Length = 63 Score = 53.5 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 3/51 (5%) Query: 12 ICPECRKGSM---VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEV 59 CP C K + EF PFCS +C+ IDL W + EY + + ++ Sbjct: 9 PCPRCGKPATWENNEFRPFCSERCKMIDLGAWANEEYRVPTQDSPSRQDSS 59 >gi|186477408|ref|YP_001858878.1| hypothetical protein Bphy_2660 [Burkholderia phymatum STM815] gi|184193867|gb|ACC71832.1| protein of unknown function DUF329 [Burkholderia phymatum STM815] Length = 64 Score = 53.1 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 25/54 (46%), Gaps = 4/54 (7%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP C + S F PFCS +C+ IDL W +Y I ++E ++ Sbjct: 6 KCPSCGRDVRWTSENRFRPFCSERCKQIDLGAWAAEKYKIGGTDEEPPTDDTPG 59 >gi|167580488|ref|ZP_02373362.1| hypothetical protein BthaT_20201 [Burkholderia thailandensis TXDOH] Length = 67 Score = 53.1 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 18/54 (33%), Positives = 24/54 (44%), Gaps = 4/54 (7%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP C K F PFCS +C+ +DL W +Y I +DE E+ Sbjct: 6 KCPSCGKEVRWTPENRFRPFCSARCKQLDLGAWAAEKYRIGGTDDEAPSEDDAG 59 >gi|83647946|ref|YP_436381.1| hypothetical protein HCH_05282 [Hahella chejuensis KCTC 2396] gi|83635989|gb|ABC31956.1| uncharacterized protein conserved in bacteria [Hahella chejuensis KCTC 2396] Length = 78 Score = 53.1 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 23/64 (35%), Positives = 32/64 (50%), Gaps = 4/64 (6%) Query: 2 QTSDFRSLKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 ++ +L+ CP C K EF PFCS +C+ IDL W EY IA E++ Sbjct: 8 SSATRTALEVDCPTCGKKVPWTQENEFRPFCSKRCQMIDLGAWASEEYRIAEAEEKDKWS 67 Query: 58 EVKD 61 E +D Sbjct: 68 ETED 71 >gi|312795074|ref|YP_004027996.1| non-essential pilus assembly protein [Burkholderia rhizoxinica HKI 454] gi|312166849|emb|CBW73852.1| non-essential pilus assembly protein [Burkholderia rhizoxinica HKI 454] Length = 66 Score = 52.7 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 19/53 (35%), Positives = 26/53 (49%), Gaps = 5/53 (9%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP C K F PFCS +C+ IDL W G+Y I ++ ++E D Sbjct: 7 CPTCGKKVEWKPESRFRPFCSMRCKQIDLGAWATGKYTI-GGDERPADEPHGD 58 >gi|167837989|ref|ZP_02464848.1| hypothetical protein Bpse38_15857 [Burkholderia thailandensis MSMB43] Length = 67 Score = 52.7 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 24/54 (44%), Gaps = 4/54 (7%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP C K F PFCS +C+ +DL W +Y I +DE ++ Sbjct: 6 KCPSCGKEVRWTPENRFRPFCSARCKQLDLGAWAAEKYRIGGTDDEAPSDDDAG 59 >gi|167564184|ref|ZP_02357100.1| hypothetical protein BoklE_16634 [Burkholderia oklahomensis EO147] Length = 67 Score = 52.7 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 23/54 (42%), Gaps = 4/54 (7%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP C K F PFCS +C+ DL W +Y I +DE ++ Sbjct: 6 KCPSCGKEVRWTPENRFRPFCSARCKQFDLGAWAAEKYRIGGTDDEAPSDDDAG 59 >gi|323143366|ref|ZP_08078054.1| hypothetical protein HMPREF9444_00672 [Succinatimonas hippei YIT 12066] gi|322416884|gb|EFY07530.1| hypothetical protein HMPREF9444_00672 [Succinatimonas hippei YIT 12066] Length = 106 Score = 52.7 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 19/56 (33%), Positives = 26/56 (46%), Gaps = 4/56 (7%) Query: 8 SLKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEV 59 +LK CP C K F PFCS +C+ IDL W + E +A + E+ Sbjct: 32 TLKVKCPICGKEIIYSKDNPFRPFCSERCKLIDLGAWANEERTVAGRTVNEDEDAD 87 >gi|197118661|ref|YP_002139088.1| hypothetical protein Gbem_2280 [Geobacter bemidjiensis Bem] gi|226701241|sp|B5EEE7|Y2280_GEOBB RecName: Full=UPF0243 zinc-binding protein Gbem_2280 gi|197088021|gb|ACH39292.1| protein of unknown function DUF329 [Geobacter bemidjiensis Bem] Length = 62 Score = 52.7 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 4/54 (7%) Query: 12 ICPECRKGSMVE---FYPFCSTQCRSIDLSRWLHGEYVIAAVE-DEKSEEEVKD 61 CP+CRK + + + PFCS +C+ IDL W Y I + E +EE D Sbjct: 8 KCPQCRKETTLAGNPYRPFCSQRCKMIDLGTWADEGYRIPGEKAPESGDEEPGD 61 >gi|91776580|ref|YP_546336.1| hypothetical protein Mfla_2228 [Methylobacillus flagellatus KT] gi|91710567|gb|ABE50495.1| protein of unknown function DUF329 [Methylobacillus flagellatus KT] Length = 62 Score = 52.7 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 4/51 (7%) Query: 12 ICPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP+C + S + PFCS +CR IDL +W Y I + + E Sbjct: 10 PCPQCGELSEYSSANPYRPFCSERCRLIDLGQWASESYRIPDNNPKPDDSE 60 >gi|88811826|ref|ZP_01127079.1| Hypothetical UPF0243 zinc-binding protein-related protein [Nitrococcus mobilis Nb-231] gi|88790710|gb|EAR21824.1| Hypothetical UPF0243 zinc-binding protein-related protein [Nitrococcus mobilis Nb-231] Length = 65 Score = 52.7 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 4/47 (8%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKS 55 CP C + + PFCS +C+ IDL WL G + I E + Sbjct: 5 CPTCNRPVEWSQHSPYRPFCSRRCKLIDLGAWLDGSHRIPGSELDGE 51 >gi|77919243|ref|YP_357058.1| hypothetical protein Pcar_1644 [Pelobacter carbinolicus DSM 2380] gi|77545326|gb|ABA88888.1| conserved hypothetical protein [Pelobacter carbinolicus DSM 2380] Length = 87 Score = 52.7 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 3/60 (5%) Query: 3 TSDFRSLKSICPECR--KGSM-VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEV 59 T+D ++ CP C K + PFCS++CR +DL W+ EY + EE+ Sbjct: 16 TNDKKTFTVKCPHCGASKPWEGNAYRPFCSSRCRQMDLGAWVDEEYRVPDASCPSDEEQS 75 >gi|148557012|ref|YP_001264594.1| hypothetical protein Swit_4113 [Sphingomonas wittichii RW1] gi|148502202|gb|ABQ70456.1| hypothetical protein Swit_4113 [Sphingomonas wittichii RW1] Length = 51 Score = 52.3 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 18/49 (36%), Positives = 22/49 (44%) Query: 9 LKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP C K + +F PFCS CR DL +WL Y I + E Sbjct: 3 KPPRCPGCGKAPVEQFEPFCSQGCRDRDLLKWLDEGYRIPGPPADPEGE 51 >gi|152996339|ref|YP_001341174.1| hypothetical protein Mmwyl1_2317 [Marinomonas sp. MWYL1] gi|150837263|gb|ABR71239.1| protein of unknown function DUF329 [Marinomonas sp. MWYL1] Length = 74 Score = 52.3 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 4/55 (7%) Query: 13 CPECRKGS----MVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDIL 63 CP C+K S PFCS +C+ IDL W Y I E+ E +D++ Sbjct: 12 CPTCQKKSPWSKENPDRPFCSPRCKLIDLGAWASESYAIPQQTSEEDEIFSEDLV 66 >gi|220917189|ref|YP_002492493.1| protein of unknown function DUF329 [Anaeromyxobacter dehalogenans 2CP-1] gi|219955043|gb|ACL65427.1| protein of unknown function DUF329 [Anaeromyxobacter dehalogenans 2CP-1] Length = 67 Score = 52.3 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 16/52 (30%), Positives = 23/52 (44%), Gaps = 4/52 (7%) Query: 11 SICPECRKGSMVE----FYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C + + +PFCS +C+ IDL +WL EY I + Sbjct: 4 PKCPICGRPAAPRPGNRAFPFCSDRCKLIDLGKWLGEEYRIPGPRAGDGADA 55 >gi|254439211|ref|ZP_05052705.1| hypothetical protein OA307_4081 [Octadecabacter antarcticus 307] gi|198254657|gb|EDY78971.1| hypothetical protein OA307_4081 [Octadecabacter antarcticus 307] Length = 60 Score = 52.3 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 13/45 (28%), Positives = 23/45 (51%) Query: 18 KGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 + S F PF S +C +DL++W G Y + + + +E V + Sbjct: 3 EPSTQHFRPFRSKRCADVDLAKWPSGGYAFPSTDPDDVDELVGAL 47 >gi|197122407|ref|YP_002134358.1| hypothetical protein AnaeK_2001 [Anaeromyxobacter sp. K] gi|196172256|gb|ACG73229.1| protein of unknown function DUF329 [Anaeromyxobacter sp. K] Length = 67 Score = 52.3 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 16/52 (30%), Positives = 23/52 (44%), Gaps = 4/52 (7%) Query: 11 SICPECRKGSMVE----FYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C + + +PFCS +C+ IDL +WL EY I + Sbjct: 4 PKCPICGRPAAPRPGNRAFPFCSDRCKLIDLGKWLGEEYRIPGPRAGDGADA 55 >gi|296123618|ref|YP_003631396.1| hypothetical protein Plim_3384 [Planctomyces limnophilus DSM 3776] gi|296015958|gb|ADG69197.1| protein of unknown function DUF329 [Planctomyces limnophilus DSM 3776] Length = 75 Score = 52.3 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 4/57 (7%) Query: 9 LKSICPECR----KGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 + CP C+ + S+ ++PFCS +C+ +D SRW G+Y I DE E+++ Sbjct: 3 RPTTCPICQHVAPQASVNTYFPFCSERCKLVDFSRWWDGKYQIVDHLDEDRLLELQE 59 >gi|331001060|ref|ZP_08324691.1| hypothetical protein HMPREF9439_02346 [Parasutterella excrementihominis YIT 11859] gi|329569365|gb|EGG51143.1| hypothetical protein HMPREF9439_02346 [Parasutterella excrementihominis YIT 11859] Length = 83 Score = 52.3 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 19/61 (31%), Positives = 27/61 (44%), Gaps = 4/61 (6%) Query: 1 MQTSDFRSLKSICPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 MQ ++K CP C + + PFC +CR IDL W G+Y I E + Sbjct: 1 MQYVVKMAIKVKCPTCGRECEYSDKNPYRPFCCERCRLIDLGAWAEGKYSIKDKPMEGDD 60 Query: 57 E 57 + Sbjct: 61 D 61 >gi|330815456|ref|YP_004359161.1| hypothetical protein bgla_1g05120 [Burkholderia gladioli BSR3] gi|327367849|gb|AEA59205.1| hypothetical protein bgla_1g05120 [Burkholderia gladioli BSR3] Length = 66 Score = 52.3 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 18/58 (31%), Positives = 26/58 (44%), Gaps = 4/58 (6%) Query: 8 SLKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 +L CP C K F PFCS +C+ +DL W Y I ++E S + + Sbjct: 2 TLAVKCPACGKQVRWVPENTFRPFCSARCKQMDLGAWAAERYRIGGTDEEPSSDAEPE 59 >gi|303258224|ref|ZP_07344231.1| conserved domain protein [Burkholderiales bacterium 1_1_47] gi|302858977|gb|EFL82061.1| conserved domain protein [Burkholderiales bacterium 1_1_47] Length = 83 Score = 52.3 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 19/61 (31%), Positives = 27/61 (44%), Gaps = 4/61 (6%) Query: 1 MQTSDFRSLKSICPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 MQ ++K CP C + + PFC +CR IDL W G+Y I E + Sbjct: 1 MQYVVKMAIKVKCPTCGRECEYSDKNPYRPFCCERCRLIDLGAWAEGKYSIKDKPMEGDD 60 Query: 57 E 57 + Sbjct: 61 D 61 >gi|255321266|ref|ZP_05362432.1| conserved hypothetical protein [Acinetobacter radioresistens SK82] gi|255301820|gb|EET81071.1| conserved hypothetical protein [Acinetobacter radioresistens SK82] Length = 61 Score = 52.3 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 3/51 (5%) Query: 12 ICPECRKGSM---VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEV 59 CP C K + EF PFCS +C+ IDL W + EY + + ++ Sbjct: 7 PCPRCGKPATWENNEFRPFCSERCKMIDLGAWANEEYRVPTQDSPSRQDSS 57 >gi|237654314|ref|YP_002890628.1| hypothetical protein Tmz1t_3658 [Thauera sp. MZ1T] gi|237625561|gb|ACR02251.1| protein of unknown function DUF329 [Thauera sp. MZ1T] Length = 73 Score = 52.3 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 17/60 (28%), Positives = 26/60 (43%), Gaps = 4/60 (6%) Query: 5 DFRSLKSICPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK 60 D R+ CP C K + PFCS +C+ IDL W Y + + + +E+ Sbjct: 2 DTRARTVRCPTCGKDVEWKPESRWRPFCSARCKQIDLGEWASEGYRVPSSPPDAPLDEID 61 >gi|134095956|ref|YP_001101031.1| hypothetical protein HEAR2794 [Herminiimonas arsenicoxydans] gi|133739859|emb|CAL62910.1| conserved hypothetical protein; putative glucocorticoid receptor domain [Herminiimonas arsenicoxydans] Length = 66 Score = 52.3 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 17/51 (33%), Positives = 22/51 (43%), Gaps = 4/51 (7%) Query: 13 CPECRKGS----MVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEV 59 CP C +F PFCS +C+ IDL W +YVI +E Sbjct: 7 CPTCGTKVEWSETSKFRPFCSNRCKQIDLGAWAEEKYVIPVANPLDDFDED 57 >gi|254178790|ref|ZP_04885444.1| conserved hypothetical protein [Burkholderia mallei ATCC 10399] gi|254299351|ref|ZP_04966801.1| conserved hypothetical protein [Burkholderia pseudomallei 406e] gi|254357653|ref|ZP_04973927.1| conserved hypothetical protein [Burkholderia mallei 2002721280] gi|148026717|gb|EDK84802.1| conserved hypothetical protein [Burkholderia mallei 2002721280] gi|157809263|gb|EDO86433.1| conserved hypothetical protein [Burkholderia pseudomallei 406e] gi|160694704|gb|EDP84712.1| conserved hypothetical protein [Burkholderia mallei ATCC 10399] Length = 76 Score = 52.0 bits (123), Expect = 2e-05, Method: Composition-based stats. Identities = 17/52 (32%), Positives = 23/52 (44%), Gaps = 4/52 (7%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEV 59 CP C K F PFCS +C+ +DL W +Y I +D E+ Sbjct: 15 KCPSCGKEVRWTPENRFRPFCSARCKQLDLGAWAAEKYRIGGTDDAAPSEDD 66 >gi|255066089|ref|ZP_05317944.1| conserved domain protein [Neisseria sicca ATCC 29256] gi|255049634|gb|EET45098.1| conserved domain protein [Neisseria sicca ATCC 29256] Length = 68 Score = 52.0 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 4/50 (8%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP C+K ++ PFCS +CR IDL W +Y +AA E++ + Sbjct: 15 KCPTCQKPVIWNEESKYRPFCSQRCRLIDLGEWAQEKYTVAAEENDSLSD 64 >gi|152978289|ref|YP_001343918.1| dephospho-CoA kinase [Actinobacillus succinogenes 130Z] gi|150840012|gb|ABR73983.1| dephospho-CoA kinase [Actinobacillus succinogenes 130Z] Length = 282 Score = 52.0 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 19/55 (34%), Positives = 24/55 (43%), Gaps = 10/55 (18%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIA------AVEDEKSEE 57 CP C+K + PFCS +C+ IDL W E I A E S+E Sbjct: 224 CPTCKKKVIWSPRSPYRPFCSKRCQLIDLGEWADEEKAIPCETADFATNPEFSDE 278 >gi|124265697|ref|YP_001019701.1| hypothetical protein Mpe_A0504 [Methylibium petroleiphilum PM1] gi|124258472|gb|ABM93466.1| conserved hypothetical protein [Methylibium petroleiphilum PM1] Length = 64 Score = 52.0 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 17/62 (27%), Positives = 27/62 (43%), Gaps = 4/62 (6%) Query: 1 MQTSDFRSLKSICPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 M SD CP C + S + PFCS +C++ DL W + Y + A + + Sbjct: 1 MTGSDIPPRTVRCPGCGQFSIYASTNPYRPFCSERCKNGDLGAWANERYRVEASPPVEGD 60 Query: 57 EE 58 + Sbjct: 61 DA 62 >gi|297537716|ref|YP_003673485.1| hypothetical protein M301_0524 [Methylotenera sp. 301] gi|297257063|gb|ADI28908.1| protein of unknown function DUF329 [Methylotenera sp. 301] Length = 70 Score = 52.0 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 23/67 (34%), Positives = 32/67 (47%), Gaps = 7/67 (10%) Query: 1 MQTSDFRSLKSICPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKS- 55 M+T+ R + CP C+K S F PFC +C+ IDL W +Y I E Sbjct: 1 METTKKRLVA--CPNCKKLSEFSPSNAFRPFCGERCKMIDLGLWASEQYAIPVEIKEDDL 58 Query: 56 EEEVKDI 62 E+E D+ Sbjct: 59 EQEFSDV 65 >gi|296134876|ref|YP_003642118.1| protein of unknown function DUF329 [Thiomonas intermedia K12] gi|295794998|gb|ADG29788.1| protein of unknown function DUF329 [Thiomonas intermedia K12] Length = 81 Score = 52.0 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 16/62 (25%), Positives = 27/62 (43%), Gaps = 4/62 (6%) Query: 3 TSDFRSLKSICPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 +S K CP+C ++ + PFCS +C+SID W Y + D + Sbjct: 5 SSPTSRPKVRCPQCGTPTVYSLSNPWRPFCSERCKSIDFGAWASESYRVPTKPDAADIDA 64 Query: 59 VK 60 ++ Sbjct: 65 LE 66 >gi|253700565|ref|YP_003021754.1| hypothetical protein GM21_1943 [Geobacter sp. M21] gi|259646530|sp|C6E808|Y1943_GEOSM RecName: Full=UPF0243 zinc-binding protein GM21_1943 gi|251775415|gb|ACT17996.1| protein of unknown function DUF329 [Geobacter sp. M21] Length = 62 Score = 52.0 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 4/54 (7%) Query: 12 ICPECRKGSMVE---FYPFCSTQCRSIDLSRWLHGEYVIAAVE-DEKSEEEVKD 61 CP+CRK + + + PFCS +C+ IDL W Y I + E EE D Sbjct: 8 KCPQCRKETTLAGNPYRPFCSQRCKMIDLGTWADEGYRIPGEKAPESGGEEPGD 61 >gi|257455883|ref|ZP_05621102.1| conserved hypothetical protein [Enhydrobacter aerosaccus SK60] gi|257446731|gb|EEV21755.1| conserved hypothetical protein [Enhydrobacter aerosaccus SK60] Length = 85 Score = 51.6 bits (122), Expect = 3e-05, Method: Composition-based stats. Identities = 18/65 (27%), Positives = 29/65 (44%), Gaps = 8/65 (12%) Query: 1 MQTSDFRSLKSI-----CPECRKG---SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVED 52 M ++ + CP C K + PFCS +C+ IDL W + +Y + A + Sbjct: 16 MSKTEPTPSNAPVKTYPCPRCGKPTVWADNPTKPFCSARCKLIDLGAWANEDYKVGAEDT 75 Query: 53 EKSEE 57 S+E Sbjct: 76 PFSDE 80 >gi|325518040|gb|EGC97845.1| hypothetical protein B1M_44614 [Burkholderia sp. TJI49] Length = 65 Score = 51.6 bits (122), Expect = 3e-05, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 4/53 (7%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK 60 CP C K +F PFCS +C+ +DL W +Y I +D +E Sbjct: 6 KCPSCGKPVRWTPENQFRPFCSARCKQLDLGAWAAEKYRIGGSDDAPLSDEDG 58 >gi|53720622|ref|YP_109608.1| hypothetical protein BPSL3012a [Burkholderia pseudomallei K96243] gi|76811108|ref|YP_334902.1| hypothetical protein BURPS1710b_3532 [Burkholderia pseudomallei 1710b] gi|121599354|ref|YP_991807.1| hypothetical protein BMASAVP1_A0458 [Burkholderia mallei SAVP1] gi|124384215|ref|YP_001027299.1| hypothetical protein BMA10229_A1316 [Burkholderia mallei NCTC 10229] gi|126439020|ref|YP_001060521.1| hypothetical protein BURPS668_3511 [Burkholderia pseudomallei 668] gi|126449405|ref|YP_001082763.1| hypothetical protein BMA10247_3246 [Burkholderia mallei NCTC 10247] gi|126451790|ref|YP_001067772.1| hypothetical protein BURPS1106A_3536 [Burkholderia pseudomallei 1106a] gi|134280404|ref|ZP_01767115.1| conserved hypothetical protein [Burkholderia pseudomallei 305] gi|166998622|ref|ZP_02264480.1| conserved hypothetical protein [Burkholderia mallei PRL-20] gi|167721325|ref|ZP_02404561.1| hypothetical protein BpseD_20113 [Burkholderia pseudomallei DM98] gi|167740294|ref|ZP_02413068.1| hypothetical protein Bpse14_19680 [Burkholderia pseudomallei 14] gi|167817513|ref|ZP_02449193.1| hypothetical protein Bpse9_20411 [Burkholderia pseudomallei 91] gi|167825914|ref|ZP_02457385.1| hypothetical protein Bpseu9_19737 [Burkholderia pseudomallei 9] gi|167847400|ref|ZP_02472908.1| hypothetical protein BpseB_19147 [Burkholderia pseudomallei B7210] gi|167895988|ref|ZP_02483390.1| hypothetical protein Bpse7_19751 [Burkholderia pseudomallei 7894] gi|167904373|ref|ZP_02491578.1| hypothetical protein BpseN_19126 [Burkholderia pseudomallei NCTC 13177] gi|167912633|ref|ZP_02499724.1| hypothetical protein Bpse112_19244 [Burkholderia pseudomallei 112] gi|167920601|ref|ZP_02507692.1| hypothetical protein BpseBC_18784 [Burkholderia pseudomallei BCC215] gi|217425710|ref|ZP_03457200.1| conserved hypothetical protein [Burkholderia pseudomallei 576] gi|226199607|ref|ZP_03795163.1| conserved hypothetical protein [Burkholderia pseudomallei Pakistan 9] gi|237813905|ref|YP_002898356.1| hypothetical protein GBP346_A3684 [Burkholderia pseudomallei MSHR346] gi|238561276|ref|ZP_04609516.1| conserved hypothetical protein [Burkholderia mallei GB8 horse 4] gi|242315177|ref|ZP_04814193.1| conserved hypothetical protein [Burkholderia pseudomallei 1106b] gi|254180561|ref|ZP_04887159.1| conserved hypothetical protein [Burkholderia pseudomallei 1655] gi|254190999|ref|ZP_04897505.1| conserved hypothetical protein [Burkholderia pseudomallei Pasteur 52237] gi|254199095|ref|ZP_04905510.1| conserved hypothetical protein [Burkholderia pseudomallei S13] gi|254202801|ref|ZP_04909164.1| conserved hypothetical protein [Burkholderia mallei FMH] gi|254208143|ref|ZP_04914493.1| conserved hypothetical protein [Burkholderia mallei JHU] gi|254260560|ref|ZP_04951614.1| conserved hypothetical protein [Burkholderia pseudomallei 1710a] gi|52211036|emb|CAH37024.1| conserved hypothetical protein [Burkholderia pseudomallei K96243] gi|76580561|gb|ABA50036.1| conserved hypothetical protein [Burkholderia pseudomallei 1710b] gi|121228164|gb|ABM50682.1| conserved hypothetical protein [Burkholderia mallei SAVP1] gi|124292235|gb|ABN01504.1| conserved hypothetical protein [Burkholderia mallei NCTC 10229] gi|126218513|gb|ABN82019.1| conserved hypothetical protein [Burkholderia pseudomallei 668] gi|126225432|gb|ABN88972.1| conserved hypothetical protein [Burkholderia pseudomallei 1106a] gi|126242275|gb|ABO05368.1| conserved hypothetical protein [Burkholderia mallei NCTC 10247] gi|134248411|gb|EBA48494.1| conserved hypothetical protein [Burkholderia pseudomallei 305] gi|147747048|gb|EDK54125.1| conserved hypothetical protein [Burkholderia mallei FMH] gi|147752037|gb|EDK59104.1| conserved hypothetical protein [Burkholderia mallei JHU] gi|157938673|gb|EDO94343.1| conserved hypothetical protein [Burkholderia pseudomallei Pasteur 52237] gi|169656925|gb|EDS88322.1| conserved hypothetical protein [Burkholderia pseudomallei S13] gi|184211100|gb|EDU08143.1| conserved hypothetical protein [Burkholderia pseudomallei 1655] gi|217391298|gb|EEC31330.1| conserved hypothetical protein [Burkholderia pseudomallei 576] gi|225928353|gb|EEH24384.1| conserved hypothetical protein [Burkholderia pseudomallei Pakistan 9] gi|237504590|gb|ACQ96908.1| conserved hypothetical protein [Burkholderia pseudomallei MSHR346] gi|238524993|gb|EEP88423.1| conserved hypothetical protein [Burkholderia mallei GB8 horse 4] gi|242138416|gb|EES24818.1| conserved hypothetical protein [Burkholderia pseudomallei 1106b] gi|243065303|gb|EES47489.1| conserved hypothetical protein [Burkholderia mallei PRL-20] gi|254219249|gb|EET08633.1| conserved hypothetical protein [Burkholderia pseudomallei 1710a] Length = 67 Score = 51.6 bits (122), Expect = 3e-05, Method: Composition-based stats. Identities = 17/52 (32%), Positives = 23/52 (44%), Gaps = 4/52 (7%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEV 59 CP C K F PFCS +C+ +DL W +Y I +D E+ Sbjct: 6 KCPSCGKEVRWTPENRFRPFCSARCKQLDLGAWAAEKYRIGGTDDAAPSEDD 57 >gi|121603682|ref|YP_981011.1| hypothetical protein Pnap_0771 [Polaromonas naphthalenivorans CJ2] gi|120592651|gb|ABM36090.1| protein of unknown function DUF329 [Polaromonas naphthalenivorans CJ2] Length = 68 Score = 51.6 bits (122), Expect = 3e-05, Method: Composition-based stats. Identities = 16/60 (26%), Positives = 27/60 (45%), Gaps = 4/60 (6%) Query: 1 MQTSDFRSLKSICPECRKGSMVE----FYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 M+ + +CP C S+ F PFCS +C++IDL W ++ + A + Sbjct: 1 MKKDPLTVKQVVCPGCGGPSVYASSNPFRPFCSERCKNIDLGAWASEDFRLPADTPPDDQ 60 >gi|304312704|ref|YP_003812302.1| Domain of unknown function (DUF329) [gamma proteobacterium HdN1] gi|301798437|emb|CBL46662.1| Domain of unknown function (DUF329) [gamma proteobacterium HdN1] Length = 71 Score = 51.6 bits (122), Expect = 3e-05, Method: Composition-based stats. Identities = 18/63 (28%), Positives = 28/63 (44%), Gaps = 4/63 (6%) Query: 3 TSDFRSLKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 + + CP C+K + + PFCS +C+ IDL W +VI V + + E Sbjct: 7 NATPQGPTVACPTCKKPVEWRAESLWRPFCSERCKLIDLGDWASESHVIPGVLLNEPDLE 66 Query: 59 VKD 61 D Sbjct: 67 DGD 69 >gi|322434669|ref|YP_004216881.1| protein of unknown function DUF329 [Acidobacterium sp. MP5ACTX9] gi|321162396|gb|ADW68101.1| protein of unknown function DUF329 [Acidobacterium sp. MP5ACTX9] Length = 75 Score = 51.6 bits (122), Expect = 3e-05, Method: Composition-based stats. Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 4/56 (7%) Query: 6 FRSLKSICPECRK--GSMVEFYPFCSTQCRSIDLSRWLHGEYVI--AAVEDEKSEE 57 CP CRK + +PFCS +CR +DL +W G YVI + + +E Sbjct: 2 PNPKALFCPTCRKVVLATDPDFPFCSDRCRILDLGKWASGGYVISSPVHDPDLLDE 57 >gi|251771352|gb|EES51933.1| hypothetical protein UBAL3_95450153 [Leptospirillum ferrodiazotrophum] Length = 72 Score = 51.6 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 19/46 (41%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Query: 11 SICPECRKGSMVEFYP-FCSTQCRSIDLSRWLHGEYVIAAVEDEKS 55 C C FCS +CR+IDL+RWL EY I EDE++ Sbjct: 4 RRCAICGAPLESTLRSVFCSERCRTIDLARWLSEEYRIRGGEDEEA 49 >gi|222056004|ref|YP_002538366.1| protein of unknown function DUF329 [Geobacter sp. FRC-32] gi|254801586|sp|B9M2R9|Y2922_GEOSF RecName: Full=UPF0243 zinc-binding protein Geob_2922 gi|221565293|gb|ACM21265.1| protein of unknown function DUF329 [Geobacter sp. FRC-32] Length = 59 Score = 51.6 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 25/57 (43%), Gaps = 3/57 (5%) Query: 6 FRSLKSICPECRKG---SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEV 59 ++ K CP C+K PFCS +C+ IDL W Y I + +E+ Sbjct: 2 KKTAKHFCPHCQKEVSWQDNPHRPFCSERCKMIDLGSWFSENYKIPGEKKPSEDEDD 58 >gi|262193836|ref|YP_003265045.1| hypothetical protein Hoch_0513 [Haliangium ochraceum DSM 14365] gi|262077183|gb|ACY13152.1| protein of unknown function DUF329 [Haliangium ochraceum DSM 14365] Length = 82 Score = 51.2 bits (121), Expect = 4e-05, Method: Composition-based stats. Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 4/48 (8%) Query: 11 SICPECRKGSMV----EFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEK 54 + C C + ++ +PFCS +C+ +DL RWL G+Y I E Sbjct: 18 TPCIVCNEPALPRPDNAAHPFCSPRCQMVDLGRWLDGDYCIPGEPLED 65 >gi|148358426|ref|YP_001249633.1| hypothetical protein LPC_0292 [Legionella pneumophila str. Corby] gi|166228929|sp|A5IA87|Y292_LEGPC RecName: Full=UPF0243 zinc-binding protein LPC_0292 gi|148280199|gb|ABQ54287.1| conserved hypothetical protein; DUF329 [Legionella pneumophila str. Corby] Length = 70 Score = 51.2 bits (121), Expect = 4e-05, Method: Composition-based stats. Identities = 16/51 (31%), Positives = 20/51 (39%), Gaps = 4/51 (7%) Query: 9 LKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKS 55 K CP C K +F PFCS +C+ IDL W I + Sbjct: 5 KKIKCPICGKQNTWRPDNQFRPFCSERCKLIDLGEWASESRKIPGSSIDPE 55 >gi|262370031|ref|ZP_06063358.1| UPF0243 zinc-binding protein yacG [Acinetobacter johnsonii SH046] gi|262315070|gb|EEY96110.1| UPF0243 zinc-binding protein yacG [Acinetobacter johnsonii SH046] Length = 61 Score = 51.2 bits (121), Expect = 4e-05, Method: Composition-based stats. Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 3/52 (5%) Query: 12 ICPECRKGSM---VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK 60 CP C + S F PFCS +C+ IDL W + EY + + ++E + Sbjct: 10 PCPRCGEMSQWEDNAFRPFCSERCKLIDLGAWANDEYRLPTQDAPQAENSEE 61 >gi|126640462|ref|YP_001083445.1| putative Zinc-binding protein [Acinetobacter baumannii ATCC 17978] gi|169634508|ref|YP_001708244.1| hypothetical protein ABSDF3126 [Acinetobacter baumannii SDF] gi|169797362|ref|YP_001715155.1| hypothetical protein ABAYE3391 [Acinetobacter baumannii AYE] gi|184156714|ref|YP_001845053.1| putative zinc-binding protein [Acinetobacter baumannii ACICU] gi|213155822|ref|YP_002317868.1| hypothetical protein AB57_0461 [Acinetobacter baumannii AB0057] gi|215484802|ref|YP_002327037.1| UPF0243 zinc-binding protein yacG [Acinetobacter baumannii AB307-0294] gi|239500883|ref|ZP_04660193.1| UPF0243 zinc-binding protein yacG [Acinetobacter baumannii AB900] gi|260549197|ref|ZP_05823418.1| UPF0243 zinc-binding protein yacG [Acinetobacter sp. RUH2624] gi|260556255|ref|ZP_05828474.1| UPF0243 zinc-binding protein yacG [Acinetobacter baumannii ATCC 19606] gi|301345465|ref|ZP_07226206.1| putative zinc-binding protein [Acinetobacter baumannii AB056] gi|301511095|ref|ZP_07236332.1| putative zinc-binding protein [Acinetobacter baumannii AB058] gi|301596665|ref|ZP_07241673.1| putative zinc-binding protein [Acinetobacter baumannii AB059] gi|332851881|ref|ZP_08433784.1| hypothetical protein HMPREF0021_01356 [Acinetobacter baumannii 6013150] gi|332867939|ref|ZP_08437927.1| hypothetical protein HMPREF0020_01551 [Acinetobacter baumannii 6013113] gi|332873124|ref|ZP_08441081.1| hypothetical protein HMPREF0022_00684 [Acinetobacter baumannii 6014059] gi|126386346|gb|ABO10844.1| putative Zinc-binding protein [Acinetobacter baumannii ATCC 17978] gi|169150289|emb|CAM88186.1| conserved hypothetical protein [Acinetobacter baumannii AYE] gi|169153300|emb|CAP02406.1| conserved hypothetical protein [Acinetobacter baumannii] gi|183208308|gb|ACC55706.1| putative zinc-binding protein [Acinetobacter baumannii ACICU] gi|213054982|gb|ACJ39884.1| conserved hypothetical protein [Acinetobacter baumannii AB0057] gi|213988161|gb|ACJ58460.1| UPF0243 zinc-binding protein yacG [Acinetobacter baumannii AB307-0294] gi|260407925|gb|EEX01397.1| UPF0243 zinc-binding protein yacG [Acinetobacter sp. RUH2624] gi|260410310|gb|EEX03609.1| UPF0243 zinc-binding protein yacG [Acinetobacter baumannii ATCC 19606] gi|322506603|gb|ADX02057.1| Putative Zinc-binding protein [Acinetobacter baumannii 1656-2] gi|323516480|gb|ADX90861.1| putative zinc-binding protein [Acinetobacter baumannii TCDC-AB0715] gi|332729666|gb|EGJ61002.1| hypothetical protein HMPREF0021_01356 [Acinetobacter baumannii 6013150] gi|332733640|gb|EGJ64799.1| hypothetical protein HMPREF0020_01551 [Acinetobacter baumannii 6013113] gi|332738636|gb|EGJ69506.1| hypothetical protein HMPREF0022_00684 [Acinetobacter baumannii 6014059] Length = 64 Score = 51.2 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 3/56 (5%) Query: 8 SLKSICPECRKGSM---VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK 60 CP C + S+ EF PFCS +C+ IDL W + EY + + + ++ + Sbjct: 2 PRTFPCPRCGEPSVWEGNEFRPFCSERCKLIDLGAWANDEYRLPTQDAPQQDKGSQ 57 >gi|257464507|ref|ZP_05628878.1| putative zinc-binding protein [Actinobacillus minor 202] gi|257450167|gb|EEV24210.1| putative zinc-binding protein [Actinobacillus minor 202] Length = 61 Score = 51.2 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 4/52 (7%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK 60 CP C K ++ PFCS +C+ IDL W E IA+VED+ E+++ Sbjct: 8 CPICSKPVSWNPSSKYRPFCSERCQLIDLGEWASEEKRIASVEDDVFSEDLE 59 >gi|221068975|ref|ZP_03545080.1| protein of unknown function DUF329 [Comamonas testosteroni KF-1] gi|220713998|gb|EED69366.1| protein of unknown function DUF329 [Comamonas testosteroni KF-1] Length = 70 Score = 51.2 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 19/59 (32%), Positives = 27/59 (45%), Gaps = 4/59 (6%) Query: 1 MQTSDFRSLKSICPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKS 55 M T CP C S+ +F PFCS +CR+IDL W + E+ + A + Sbjct: 1 MSTDKQSPTMVKCPTCGGPSVFLPSNKFRPFCSERCRNIDLGAWGNEEFRVPAQTPPED 59 >gi|94969170|ref|YP_591218.1| hypothetical protein Acid345_2143 [Candidatus Koribacter versatilis Ellin345] gi|94551220|gb|ABF41144.1| protein of unknown function DUF329 [Candidatus Koribacter versatilis Ellin345] Length = 80 Score = 50.8 bits (120), Expect = 6e-05, Method: Composition-based stats. Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 2/51 (3%) Query: 13 CPECRKGSMVEF--YPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP CRK + + +PFCS +C+ IDL +W YVI+ + E+ D Sbjct: 11 CPTCRKIVLRKDPDFPFCSERCKMIDLGKWASNGYVISTPINNAGEDLQGD 61 >gi|149909372|ref|ZP_01898027.1| Uncharacterized zinc finger protein [Moritella sp. PE36] gi|149807482|gb|EDM67431.1| Uncharacterized zinc finger protein [Moritella sp. PE36] Length = 61 Score = 50.8 bits (120), Expect = 6e-05, Method: Composition-based stats. Identities = 19/52 (36%), Positives = 25/52 (48%), Gaps = 4/52 (7%) Query: 9 LKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 ++ CP C+K + EF PFC +C+ IDL W GE I E E Sbjct: 1 MQVNCPTCQKPVEWVATSEFRPFCCERCKLIDLGEWASGERAIPGEEVSPQE 52 >gi|86158283|ref|YP_465068.1| hypothetical protein Adeh_1859 [Anaeromyxobacter dehalogenans 2CP-C] gi|85774794|gb|ABC81631.1| protein of unknown function DUF329 [Anaeromyxobacter dehalogenans 2CP-C] Length = 67 Score = 50.8 bits (120), Expect = 6e-05, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 25/54 (46%), Gaps = 4/54 (7%) Query: 11 SICPECRKGSMVE----FYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK 60 + CP C + + +PFCS +C+ IDL +WL EY I E + Sbjct: 4 AKCPICGRTAAPRPANRAFPFCSDRCKLIDLGKWLGEEYRIPGPRAGDGSEAPE 57 >gi|113968759|ref|YP_732552.1| hypothetical protein Shewmr4_0415 [Shewanella sp. MR-4] gi|114049097|ref|YP_739647.1| hypothetical protein Shewmr7_3610 [Shewanella sp. MR-7] gi|117918871|ref|YP_868063.1| hypothetical protein Shewana3_0414 [Shewanella sp. ANA-3] gi|123030235|sp|Q0HQL5|Y3610_SHESR RecName: Full=UPF0243 zinc-binding protein Shewmr7_3610 gi|123130810|sp|Q0HN72|Y415_SHESM RecName: Full=UPF0243 zinc-binding protein Shewmr4_0415 gi|166227228|sp|A0KS88|Y414_SHESA RecName: Full=UPF0243 zinc-binding protein Shewana3_0414 gi|113883443|gb|ABI37495.1| protein of unknown function DUF329 [Shewanella sp. MR-4] gi|113890539|gb|ABI44590.1| protein of unknown function DUF329 [Shewanella sp. MR-7] gi|117611203|gb|ABK46657.1| protein of unknown function DUF329 [Shewanella sp. ANA-3] Length = 69 Score = 50.8 bits (120), Expect = 6e-05, Method: Composition-based stats. Identities = 16/53 (30%), Positives = 23/53 (43%), Gaps = 4/53 (7%) Query: 8 SLKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 L CP C+ EF PFCS +C+ IDL W ++ I + + Sbjct: 2 PLTVNCPICKTPVEWVPQSEFKPFCSERCKMIDLGDWASEKHAIPVKSEFDLD 54 >gi|294668191|ref|ZP_06733298.1| conserved domain protein [Neisseria elongata subsp. glycolytica ATCC 29315] gi|291309899|gb|EFE51142.1| conserved domain protein [Neisseria elongata subsp. glycolytica ATCC 29315] Length = 65 Score = 50.8 bits (120), Expect = 6e-05, Method: Composition-based stats. Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 4/58 (6%) Query: 9 LKSICPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 K CP C S + PFCS +C++IDL W +Y + ++ E E++ + Sbjct: 7 RKVKCPRCGIVTEWSSANPYRPFCSKRCKNIDLGAWADEDYRVTMIDQEDFLLELQQV 64 >gi|153004844|ref|YP_001379169.1| hypothetical protein Anae109_1982 [Anaeromyxobacter sp. Fw109-5] gi|152028417|gb|ABS26185.1| protein of unknown function DUF329 [Anaeromyxobacter sp. Fw109-5] Length = 66 Score = 50.8 bits (120), Expect = 6e-05, Method: Composition-based stats. Identities = 18/53 (33%), Positives = 23/53 (43%), Gaps = 4/53 (7%) Query: 9 LKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 + C C K S +PFCS +CR +DL +WL EY I E Sbjct: 1 MPRACSICGKPVPPRSENRSFPFCSPRCRLLDLGKWLGEEYRIPGPRPGDGAE 53 >gi|325273280|ref|ZP_08139558.1| DNA gyrase inhibitor [Pseudomonas sp. TJI-51] gi|324101611|gb|EGB99179.1| DNA gyrase inhibitor [Pseudomonas sp. TJI-51] Length = 66 Score = 50.8 bits (120), Expect = 6e-05, Method: Composition-based stats. Identities = 18/60 (30%), Positives = 26/60 (43%), Gaps = 4/60 (6%) Query: 7 RSLKSICPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 + L CP C F PFCS +C+ IDL W E+ I ++ + E D+ Sbjct: 3 QPLTVDCPTCGAPVEWTEKSAFRPFCSDRCKLIDLGAWAAEEHKIPGAQESEDELYSGDL 62 >gi|299771734|ref|YP_003733760.1| putative zinc-binding protein [Acinetobacter sp. DR1] gi|298701822|gb|ADI92387.1| putative zinc-binding protein [Acinetobacter sp. DR1] Length = 64 Score = 50.8 bits (120), Expect = 6e-05, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 3/57 (5%) Query: 8 SLKSICPECRKGSM---VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP C + S+ EF PFCS +C+ IDL W + EY + + + + ++ Sbjct: 2 PRTFPCPRCGEPSVWEGNEFRPFCSERCKLIDLGAWANDEYRLPTQDAPQQNKGSQN 58 >gi|293610181|ref|ZP_06692482.1| conserved hypothetical protein [Acinetobacter sp. SH024] gi|292827413|gb|EFF85777.1| conserved hypothetical protein [Acinetobacter sp. SH024] gi|325124356|gb|ADY83879.1| putative zinc-binding protein [Acinetobacter calcoaceticus PHEA-2] Length = 64 Score = 50.8 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 3/47 (6%) Query: 8 SLKSICPECRKGSM---VEFYPFCSTQCRSIDLSRWLHGEYVIAAVE 51 CP C + S+ EF PFCS +C+ IDL W + EY + + Sbjct: 2 PRTFPCPRCGEPSVWEGNEFRPFCSERCKLIDLGAWANDEYRLPTQD 48 >gi|288939911|ref|YP_003442151.1| hypothetical protein Alvin_0150 [Allochromatium vinosum DSM 180] gi|288895283|gb|ADC61119.1| protein of unknown function DUF329 [Allochromatium vinosum DSM 180] Length = 67 Score = 50.8 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP C + + PFCS +CR IDL WL + + A + E E+ D Sbjct: 7 CPHCGRPVPWTPDSRWRPFCSERCRLIDLGDWLEERHRLPADDSETPGEDAPD 59 >gi|126176114|ref|YP_001052263.1| hypothetical protein Sbal_3924 [Shewanella baltica OS155] gi|166201482|sp|A3D9I1|Y3924_SHEB5 RecName: Full=UPF0243 zinc-binding protein Sbal_3924 gi|125999319|gb|ABN63394.1| protein of unknown function DUF329 [Shewanella baltica OS155] Length = 69 Score = 50.8 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 23/53 (43%), Gaps = 4/53 (7%) Query: 8 SLKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 L CP C+ F PFCS +C+ IDL W ++VI + E Sbjct: 2 PLTVKCPICKAPVEWVPQSAFKPFCSERCKLIDLGDWASEKHVIPVKAEFDPE 54 >gi|54293222|ref|YP_125637.1| hypothetical protein lpl0270 [Legionella pneumophila str. Lens] gi|67461925|sp|Q5WZW1|Y270_LEGPL RecName: Full=UPF0243 zinc-binding protein lpl0270 gi|53753054|emb|CAH14501.1| hypothetical protein lpl0270 [Legionella pneumophila str. Lens] Length = 70 Score = 50.8 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 16/50 (32%), Positives = 20/50 (40%), Gaps = 4/50 (8%) Query: 10 KSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKS 55 K CP C K +F PFCS +C+ IDL W I + Sbjct: 6 KIKCPICGKQNTWRPDNQFRPFCSERCKLIDLGEWASESRKIPGSSIDPE 55 >gi|71279567|ref|YP_271100.1| hypothetical protein CPS_4452 [Colwellia psychrerythraea 34H] gi|123630938|sp|Q47VS2|Y4452_COLP3 RecName: Full=UPF0243 zinc-binding protein CPS_4452 gi|71145307|gb|AAZ25780.1| conserved hypothetical protein [Colwellia psychrerythraea 34H] Length = 78 Score = 50.8 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 4/44 (9%) Query: 8 SLKSICPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVI 47 +LK CP+C+K + EF PFCS +C+ IDL W + I Sbjct: 2 TLKVPCPQCQKTVVWQASSEFRPFCSKRCQLIDLGEWAEESHKI 45 >gi|299138361|ref|ZP_07031540.1| protein of unknown function DUF329 [Acidobacterium sp. MP5ACTX8] gi|298599607|gb|EFI55766.1| protein of unknown function DUF329 [Acidobacterium sp. MP5ACTX8] Length = 75 Score = 50.4 bits (119), Expect = 8e-05, Method: Composition-based stats. Identities = 19/56 (33%), Positives = 28/56 (50%), Gaps = 4/56 (7%) Query: 6 FRSLKSICPECRK--GSMVEFYPFCSTQCRSIDLSRWLHGEYVI--AAVEDEKSEE 57 + CP CRK PFCS +CR+IDL +W G+Y I ++ + E+ Sbjct: 2 PETKTLRCPICRKDVPLDTPEVPFCSERCRTIDLGKWASGDYKISSPILDPDLLED 57 >gi|240949022|ref|ZP_04753376.1| putative zinc-binding protein [Actinobacillus minor NM305] gi|240296609|gb|EER47227.1| putative zinc-binding protein [Actinobacillus minor NM305] Length = 61 Score = 50.4 bits (119), Expect = 8e-05, Method: Composition-based stats. Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 4/52 (7%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK 60 CP C K ++ PFCS +C+ IDL W E IA+VED+ E+++ Sbjct: 8 CPICSKPVPWNPSSKYRPFCSERCQLIDLGEWASEEKRIASVEDDVFSEDLE 59 >gi|307609037|emb|CBW98467.1| hypothetical protein LPW_03041 [Legionella pneumophila 130b] Length = 70 Score = 50.4 bits (119), Expect = 8e-05, Method: Composition-based stats. Identities = 16/50 (32%), Positives = 20/50 (40%), Gaps = 4/50 (8%) Query: 10 KSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKS 55 K CP C K +F PFCS +C+ IDL W I + Sbjct: 6 KIKCPICGKQNTWRPDNQFRPFCSERCKLIDLGEWASESRKIPGSSIDPE 55 >gi|313497006|gb|ADR58372.1| Zinc-binding protein [Pseudomonas putida BIRD-1] Length = 66 Score = 50.4 bits (119), Expect = 8e-05, Method: Composition-based stats. Identities = 19/60 (31%), Positives = 26/60 (43%), Gaps = 4/60 (6%) Query: 7 RSLKSICPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 + L CP C F PFCS +C+ IDL W E+ I E+ + E D+ Sbjct: 3 QPLTVDCPTCGAPVEWSEKNAFRPFCSDRCKLIDLGAWAAEEHKIPGSEESEDELYSGDL 62 >gi|332978535|gb|EGK15244.1| zinc-binding protein [Psychrobacter sp. 1501(2011)] Length = 69 Score = 50.4 bits (119), Expect = 8e-05, Method: Composition-based stats. Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 3/60 (5%) Query: 1 MQTSDFRSLKSICPECRKGSM---VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 M + CP C+K ++ + PFCS +C+ IDL W + EY +AA + S++ Sbjct: 7 MSKAISTQKTYPCPNCQKPTVWQDNPYKPFCSDRCKLIDLGAWANEEYRVAAEDSPFSDD 66 >gi|262375094|ref|ZP_06068328.1| UPF0243 zinc-binding protein yacG [Acinetobacter lwoffii SH145] gi|262310107|gb|EEY91236.1| UPF0243 zinc-binding protein yacG [Acinetobacter lwoffii SH145] Length = 57 Score = 50.4 bits (119), Expect = 8e-05, Method: Composition-based stats. Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 3/51 (5%) Query: 13 CPECRKGSM---VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK 60 CP C K + EF PFCS +C+ IDL W + EY + + +++ + Sbjct: 7 CPRCGKLTTWEDNEFRPFCSERCKMIDLGAWANEEYSLPTQDAPQADNSEE 57 >gi|217975019|ref|YP_002359770.1| hypothetical protein Sbal223_3872 [Shewanella baltica OS223] gi|254803815|sp|B8E666|Y3872_SHEB2 RecName: Full=UPF0243 zinc-binding protein Sbal223_3872 gi|217500154|gb|ACK48347.1| protein of unknown function DUF329 [Shewanella baltica OS223] Length = 69 Score = 50.4 bits (119), Expect = 8e-05, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 23/53 (43%), Gaps = 4/53 (7%) Query: 8 SLKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 L CP C+ F PFCS +C+ IDL W ++VI + E Sbjct: 2 PLTVNCPICKAPVEWVPQSAFKPFCSERCKLIDLGDWASEKHVIPVKAEFDPE 54 >gi|24372007|ref|NP_716049.1| hypothetical protein SO_0411 [Shewanella oneidensis MR-1] gi|31563255|sp|Q8EJQ1|Y411_SHEON RecName: Full=UPF0243 zinc-binding protein SO_0411 gi|24345868|gb|AAN53494.1|AE015489_7 conserved hypothetical protein [Shewanella oneidensis MR-1] Length = 69 Score = 50.4 bits (119), Expect = 9e-05, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 23/53 (43%), Gaps = 4/53 (7%) Query: 8 SLKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 L CP C+ +F PFCS +C+ IDL W ++ I + + Sbjct: 2 PLTVSCPICKTPVEWGPQSKFKPFCSERCKMIDLGDWASEKHAIPVKSEFDLD 54 >gi|206890298|ref|YP_002249441.1| putative zinc-binding protein [Thermodesulfovibrio yellowstonii DSM 11347] gi|206891111|ref|YP_002249391.1| putative zinc-binding protein [Thermodesulfovibrio yellowstonii DSM 11347] gi|206742236|gb|ACI21293.1| putative zinc-binding protein [Thermodesulfovibrio yellowstonii DSM 11347] gi|206743049|gb|ACI22106.1| putative zinc-binding protein [Thermodesulfovibrio yellowstonii DSM 11347] Length = 72 Score = 50.4 bits (119), Expect = 9e-05, Method: Composition-based stats. Identities = 23/59 (38%), Positives = 29/59 (49%), Gaps = 6/59 (10%) Query: 9 LKSICPECRKGSMVE---FYPFCSTQCRSIDLSRWLHGEYVIAAVEDEK---SEEEVKD 61 +K CP C K E + PFCS C+ IDL W H Y I E ++ +EEE D Sbjct: 1 MKIKCPVCGKAVEYENNPWRPFCSKNCKIIDLWNWFHEHYSIKVEEVDEKINTEEEKDD 59 >gi|146294513|ref|YP_001184937.1| hypothetical protein Sputcn32_3428 [Shewanella putrefaciens CN-32] gi|166232587|sp|A4YB05|Y3428_SHEPC RecName: Full=UPF0243 zinc-binding protein Sputcn32_3428 gi|145566203|gb|ABP77138.1| protein of unknown function DUF329 [Shewanella putrefaciens CN-32] gi|319427878|gb|ADV55952.1| protein of unknown function DUF329 [Shewanella putrefaciens 200] Length = 69 Score = 50.4 bits (119), Expect = 9e-05, Method: Composition-based stats. Identities = 16/53 (30%), Positives = 23/53 (43%), Gaps = 4/53 (7%) Query: 8 SLKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 L CP C+ EF PFCS +C+ IDL W ++ I + + Sbjct: 2 PLTVKCPICKTPVEWAPQSEFKPFCSERCKLIDLGDWASEKHAIPVKSEFDLD 54 >gi|94312044|ref|YP_585254.1| hypothetical protein Rmet_3113 [Cupriavidus metallidurans CH34] gi|93355896|gb|ABF09985.1| conserved hypothetical protein [Cupriavidus metallidurans CH34] Length = 63 Score = 50.4 bits (119), Expect = 9e-05, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 24/54 (44%), Gaps = 4/54 (7%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP C K +F PFCS +C+ IDL W +YV E ++ + Sbjct: 6 KCPTCGKEVAWVPDNKFRPFCSERCKQIDLGAWASEKYVFGGKPGETPSPDLPE 59 >gi|153002450|ref|YP_001368131.1| hypothetical protein Shew185_3947 [Shewanella baltica OS185] gi|160877169|ref|YP_001556485.1| hypothetical protein Sbal195_4065 [Shewanella baltica OS195] gi|304412468|ref|ZP_07394074.1| protein of unknown function DUF329 [Shewanella baltica OS183] gi|307307127|ref|ZP_07586865.1| protein of unknown function DUF329 [Shewanella baltica BA175] gi|166229057|sp|A6WTC9|Y3947_SHEB8 RecName: Full=UPF0243 zinc-binding protein Shew185_3947 gi|189040270|sp|A9L5D1|Y4065_SHEB9 RecName: Full=UPF0243 zinc-binding protein Sbal195_4065 gi|151367068|gb|ABS10068.1| protein of unknown function DUF329 [Shewanella baltica OS185] gi|160862691|gb|ABX51225.1| protein of unknown function DUF329 [Shewanella baltica OS195] gi|304349110|gb|EFM13522.1| protein of unknown function DUF329 [Shewanella baltica OS183] gi|306910366|gb|EFN40797.1| protein of unknown function DUF329 [Shewanella baltica BA175] gi|315269373|gb|ADT96226.1| protein of unknown function DUF329 [Shewanella baltica OS678] Length = 69 Score = 50.0 bits (118), Expect = 9e-05, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 23/53 (43%), Gaps = 4/53 (7%) Query: 8 SLKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 L CP C+ F PFCS +C+ IDL W ++VI + E Sbjct: 2 PLTVNCPICKAPVEWVPQSAFKPFCSERCKLIDLGDWASEKHVIPVKAEFDPE 54 >gi|82702135|ref|YP_411701.1| hypothetical protein Nmul_A1006 [Nitrosospira multiformis ATCC 25196] gi|123544785|sp|Q2YAB2|Y1006_NITMU RecName: Full=UPF0243 zinc-binding protein Nmul_A1006 gi|82410200|gb|ABB74309.1| Protein of unknown function DUF329 [Nitrosospira multiformis ATCC 25196] Length = 65 Score = 50.0 bits (118), Expect = 9e-05, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Query: 13 CPECRKGSMVE----FYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP+C K + F PFCS +C+ IDL +W Y I + ++E Sbjct: 8 CPQCGKSVAWDNSNPFRPFCSERCKLIDLGQWATESYRIPDTGKDSEKQENDP 60 >gi|54296248|ref|YP_122617.1| hypothetical protein lpp0275 [Legionella pneumophila str. Paris] gi|67461927|sp|Q5X8H6|Y275_LEGPA RecName: Full=UPF0243 zinc-binding protein lpp0275 gi|53750033|emb|CAH11423.1| hypothetical protein lpp0275 [Legionella pneumophila str. Paris] Length = 70 Score = 50.0 bits (118), Expect = 9e-05, Method: Composition-based stats. Identities = 16/50 (32%), Positives = 20/50 (40%), Gaps = 4/50 (8%) Query: 10 KSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKS 55 K CP C K +F PFCS +C+ IDL W I + Sbjct: 6 KIKCPICGKQNTWSPDNQFRPFCSERCKLIDLGEWASESRKIPGSSIDPE 55 >gi|157373561|ref|YP_001472161.1| hypothetical protein Ssed_0420 [Shewanella sediminis HAW-EB3] gi|189040283|sp|A8FQB0|Y420_SHESH RecName: Full=UPF0243 zinc-binding protein Ssed_0420 gi|157315935|gb|ABV35033.1| protein of unknown function DUF329 [Shewanella sediminis HAW-EB3] Length = 70 Score = 50.0 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 4/49 (8%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 CP C+K S +F PFCS +C+ IDL W ++ I + E Sbjct: 6 KCPTCQKEVIWNSESKFKPFCSDRCKLIDLGDWASEKHAIPVKSEFDPE 54 >gi|78222944|ref|YP_384691.1| hypothetical protein Gmet_1735 [Geobacter metallireducens GS-15] gi|78194199|gb|ABB31966.1| protein of unknown function DUF329 [Geobacter metallireducens GS-15] Length = 86 Score = 50.0 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 3/63 (4%) Query: 2 QTSDFRSLKSICPECRKGSM---VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 Q S+ CP CRK + F PFCS +C+++DL+ W EY IA+ + +E Sbjct: 23 QMSEKPITIVPCPRCRKETPWQGNPFRPFCSERCKTMDLAAWADEEYRIASEDTPGDDES 82 Query: 59 VKD 61 ++ Sbjct: 83 DEN 85 >gi|294338830|emb|CAZ87164.1| conserved hypothetical protein; putative Glucocorticoid receptor-like (DNA-binding domain) [Thiomonas sp. 3As] Length = 81 Score = 50.0 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 16/62 (25%), Positives = 27/62 (43%), Gaps = 4/62 (6%) Query: 3 TSDFRSLKSICPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 +S K CP+C ++ + PFCS +C+SID W Y + D + Sbjct: 5 SSPTSRPKVRCPQCGTLTVYSLSNPWRPFCSERCKSIDFGAWASESYRVPTKPDAADIDA 64 Query: 59 VK 60 ++ Sbjct: 65 LE 66 >gi|119897020|ref|YP_932233.1| hypothetical protein azo0729 [Azoarcus sp. BH72] gi|119669433|emb|CAL93346.1| conserved hypothetical protein [Azoarcus sp. BH72] Length = 66 Score = 50.0 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 22/56 (39%), Gaps = 4/56 (7%) Query: 5 DFRSLKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 D CP C + PFCS +CR IDL W EY + + ++ Sbjct: 3 DHAPRIVKCPTCGAQVPWVPESRYRPFCSARCRQIDLGAWASEEYKVPTSPPDDTD 58 >gi|298370051|ref|ZP_06981367.1| hypothetical protein HMPREF9016_01385 [Neisseria sp. oral taxon 014 str. F0314] gi|298281511|gb|EFI23000.1| hypothetical protein HMPREF9016_01385 [Neisseria sp. oral taxon 014 str. F0314] Length = 64 Score = 50.0 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 4/49 (8%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP CR+ ++ PFCS +C+ IDL W +Y +AA E+E + Sbjct: 12 CPNCRQPVAWIPENKYRPFCSERCKLIDLGEWADEKYTVAAQEEEPMSD 60 >gi|77461045|ref|YP_350552.1| zinc-binding protein [Pseudomonas fluorescens Pf0-1] gi|123603250|sp|Q3K6P3|Y4824_PSEPF RecName: Full=UPF0243 zinc-binding protein Pfl01_4824 gi|77385048|gb|ABA76561.1| conserved hypothetical protein [Pseudomonas fluorescens Pf0-1] Length = 66 Score = 50.0 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 4/48 (8%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 CP C ++ PFCS +C+ IDL W E+ I D + E Sbjct: 9 CPTCGAPVEFTPENKYRPFCSDRCKLIDLGAWASEEHKIPVAPDAEDE 56 >gi|152983302|ref|YP_001354691.1| hypothetical protein mma_3001 [Janthinobacterium sp. Marseille] gi|151283379|gb|ABR91789.1| Uncharacterized conserved protein [Janthinobacterium sp. Marseille] Length = 64 Score = 50.0 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 17/43 (39%), Positives = 21/43 (48%), Gaps = 4/43 (9%) Query: 13 CPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVE 51 CP C +F PFCS +C+ IDL W +YVI V Sbjct: 7 CPTCGTKVEWTELSKFRPFCSNRCKQIDLGAWAEEKYVIPVVN 49 >gi|94501411|ref|ZP_01307931.1| zinc-binding protein [Oceanobacter sp. RED65] gi|94426524|gb|EAT11512.1| zinc-binding protein [Oceanobacter sp. RED65] Length = 66 Score = 50.0 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 17/45 (37%), Positives = 21/45 (46%), Gaps = 4/45 (8%) Query: 9 LKSICPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAA 49 +K CP C K + PFCS +CR IDL W E+ I Sbjct: 1 MKVKCPTCNKQVEWIQKEKHRPFCSERCRMIDLGAWSAEEHAIPG 45 >gi|262280806|ref|ZP_06058589.1| conserved hypothetical protein [Acinetobacter calcoaceticus RUH2202] gi|262257706|gb|EEY76441.1| conserved hypothetical protein [Acinetobacter calcoaceticus RUH2202] Length = 64 Score = 50.0 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 27/57 (47%), Gaps = 3/57 (5%) Query: 8 SLKSICPECRKGSM---VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP C S+ EF PFCS +C+ IDL W + EY + + + + ++ Sbjct: 2 PRTFPCPRCGGPSVWEGNEFRPFCSERCKLIDLGAWANDEYKLPTQDAPQQNKGSQN 58 >gi|127514371|ref|YP_001095568.1| hypothetical protein Shew_3443 [Shewanella loihica PV-4] gi|126639666|gb|ABO25309.1| protein of unknown function DUF329 [Shewanella loihica PV-4] Length = 74 Score = 50.0 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 24/55 (43%), Gaps = 4/55 (7%) Query: 6 FRSLKSICPECRKGS----MVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 F CP C+K +F PFCS +C+ IDL W ++ I + E Sbjct: 4 FMPTTVKCPTCQKEVLWSKESQFKPFCSERCKLIDLGDWASEKHAIPVKPEFDPE 58 >gi|49082306|gb|AAT50553.1| PA4530 [synthetic construct] Length = 67 Score = 50.0 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 23/53 (43%), Gaps = 4/53 (7%) Query: 7 RSLKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKS 55 + L CP C S ++ PFCS +C+ IDL W E+ I E Sbjct: 3 QPLTVECPTCGAPVEWKSDNKYRPFCSDRCKLIDLGAWAAEEHAIPGDTLEDD 55 >gi|319761629|ref|YP_004125566.1| hypothetical protein Alide_0913 [Alicycliphilus denitrificans BC] gi|330823495|ref|YP_004386798.1| hypothetical protein Alide2_0869 [Alicycliphilus denitrificans K601] gi|317116190|gb|ADU98678.1| protein of unknown function DUF329 [Alicycliphilus denitrificans BC] gi|329308867|gb|AEB83282.1| Uncharacterized zinc-binding family protein [Alicycliphilus denitrificans K601] Length = 68 Score = 49.7 bits (117), Expect = 1e-04, Method: Composition-based stats. Identities = 17/59 (28%), Positives = 24/59 (40%), Gaps = 4/59 (6%) Query: 3 TSDFRSLKSICPECRKGS----MVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 S CP C S F PFCS +C+ IDL W + ++ + A + E Sbjct: 2 NSPANPRTVPCPTCGGPSLYGPANPFRPFCSERCKQIDLGAWANEDFRVPAESPPEDAE 60 >gi|33152249|ref|NP_873602.1| hypothetical protein HD1129 [Haemophilus ducreyi 35000HP] gi|47117471|sp|Q7VM69|Y1129_HAEDU RecName: Full=UPF0243 zinc-binding protein HD_1129 gi|33148471|gb|AAP95991.1| conserved hypothetical protein [Haemophilus ducreyi 35000HP] Length = 62 Score = 49.7 bits (117), Expect = 1e-04, Method: Composition-based stats. Identities = 20/48 (41%), Positives = 27/48 (56%), Gaps = 4/48 (8%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 CP C K + ++ PFCS +C+ IDL W + E IA+VEDE Sbjct: 8 CPTCAKQVIWDPVSKYRPFCSERCQLIDLGEWANEEKRIASVEDEAMH 55 >gi|300309694|ref|YP_003773786.1| hypothetical protein Hsero_0352 [Herbaspirillum seropedicae SmR1] gi|300072479|gb|ADJ61878.1| conserved hypothetical protein [Herbaspirillum seropedicae SmR1] Length = 61 Score = 49.7 bits (117), Expect = 1e-04, Method: Composition-based stats. Identities = 19/54 (35%), Positives = 25/54 (46%), Gaps = 4/54 (7%) Query: 13 CPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 CP C +F PFCS +C+ IDL W +Y I AV +E K + Sbjct: 7 CPTCGAKVEWSEKNKFRPFCSERCKQIDLGAWAEEKYTIPAVNLPLDDEGDKPV 60 >gi|330501797|ref|YP_004378666.1| zinc-binding protein [Pseudomonas mendocina NK-01] gi|328916083|gb|AEB56914.1| zinc-binding protein [Pseudomonas mendocina NK-01] Length = 64 Score = 49.7 bits (117), Expect = 1e-04, Method: Composition-based stats. Identities = 14/47 (29%), Positives = 20/47 (42%), Gaps = 4/47 (8%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKS 55 CP C + + PFC +C+ IDL W E+ I + E Sbjct: 7 CPTCGAPVEWKTENTYRPFCCERCKLIDLGAWAAEEHAIPGNDLEDE 53 >gi|302877534|ref|YP_003846098.1| hypothetical protein Galf_0289 [Gallionella capsiferriformans ES-2] gi|302580323|gb|ADL54334.1| protein of unknown function DUF329 [Gallionella capsiferriformans ES-2] Length = 63 Score = 49.7 bits (117), Expect = 1e-04, Method: Composition-based stats. Identities = 19/48 (39%), Positives = 26/48 (54%), Gaps = 4/48 (8%) Query: 12 ICPECRKGS----MVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKS 55 CP C K S F PFCS +C+ IDL +W E+ +A +DE+ Sbjct: 8 PCPRCGKESPWDTNNRFRPFCSERCKMIDLGKWADEEFRVAVPDDEQD 55 >gi|71909319|ref|YP_286906.1| hypothetical protein Daro_3707 [Dechloromonas aromatica RCB] gi|123626452|sp|Q479P5|Y3707_DECAR RecName: Full=UPF0243 zinc-binding protein Daro_3707 gi|71848940|gb|AAZ48436.1| Protein of unknown function DUF329 [Dechloromonas aromatica RCB] Length = 65 Score = 49.7 bits (117), Expect = 1e-04, Method: Composition-based stats. Identities = 18/57 (31%), Positives = 24/57 (42%), Gaps = 4/57 (7%) Query: 9 LKSICPECRKGS----MVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 K CP+C K + + PFCS +C+ IDL W Y I +D D Sbjct: 4 RKVRCPQCGKDALWAPENPWRPFCSERCKQIDLGCWASDSYRIPVPDDSNEPGTDPD 60 >gi|329851100|ref|ZP_08265857.1| hypothetical protein ABI_39330 [Asticcacaulis biprosthecum C19] gi|328839946|gb|EGF89518.1| hypothetical protein ABI_39330 [Asticcacaulis biprosthecum C19] Length = 77 Score = 49.7 bits (117), Expect = 1e-04, Method: Composition-based stats. Identities = 20/58 (34%), Positives = 26/58 (44%), Gaps = 10/58 (17%) Query: 13 CPECRKG----------SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK 60 C C+K + PFCS +C +DL WL GEYVI D +EV+ Sbjct: 6 CTRCQKPYGEALEGVVNVARTYAPFCSKRCADVDLVHWLKGEYVIGDDGDLSLTDEVE 63 >gi|28868142|ref|NP_790761.1| hypothetical protein PSPTO_0922 [Pseudomonas syringae pv. tomato str. DC3000] gi|213970190|ref|ZP_03398321.1| hypothetical protein PSPTOT1_5500 [Pseudomonas syringae pv. tomato T1] gi|301385922|ref|ZP_07234340.1| zinc-binding protein [Pseudomonas syringae pv. tomato Max13] gi|302063129|ref|ZP_07254670.1| zinc-binding protein [Pseudomonas syringae pv. tomato K40] gi|302134155|ref|ZP_07260145.1| zinc-binding protein [Pseudomonas syringae pv. tomato NCPPB 1108] gi|31563246|sp|Q888U4|Y922_PSESM RecName: Full=UPF0243 zinc-binding protein PSPTO_0922 gi|28851379|gb|AAO54456.1| conserved protein of unknown function [Pseudomonas syringae pv. tomato str. DC3000] gi|213925071|gb|EEB58635.1| hypothetical protein PSPTOT1_5500 [Pseudomonas syringae pv. tomato T1] gi|330872530|gb|EGH06679.1| DNA gyrase inhibitor [Pseudomonas syringae pv. morsprunorum str. M302280PT] gi|330966323|gb|EGH66583.1| DNA gyrase inhibitor [Pseudomonas syringae pv. actinidiae str. M302091] gi|331018823|gb|EGH98879.1| DNA gyrase inhibitor [Pseudomonas syringae pv. lachrymans str. M302278PT] Length = 69 Score = 49.7 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 17/60 (28%), Positives = 25/60 (41%), Gaps = 4/60 (6%) Query: 7 RSLKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 + + CP C + PFCS +C+ IDL W E+ I D + E D+ Sbjct: 3 QPMTVQCPTCDTPVEWSAASPSRPFCSERCKLIDLGAWASEEHAIPVSPDAEDEMFSGDL 62 >gi|15599726|ref|NP_253220.1| zinc-binding protein [Pseudomonas aeruginosa PAO1] gi|107099886|ref|ZP_01363804.1| hypothetical protein PaerPA_01000907 [Pseudomonas aeruginosa PACS2] gi|116052562|ref|YP_792877.1| zinc-binding protein [Pseudomonas aeruginosa UCBPP-PA14] gi|152984849|ref|YP_001350501.1| zinc-binding protein [Pseudomonas aeruginosa PA7] gi|218893625|ref|YP_002442494.1| zinc-binding protein [Pseudomonas aeruginosa LESB58] gi|254238812|ref|ZP_04932135.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719] gi|254244658|ref|ZP_04937980.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192] gi|296391246|ref|ZP_06880721.1| zinc-binding protein [Pseudomonas aeruginosa PAb1] gi|313107174|ref|ZP_07793374.1| hypothetical protein PA39016_000870096 [Pseudomonas aeruginosa 39016] gi|31563288|sp|Q9HVP7|Y4530_PSEAE RecName: Full=UPF0243 zinc-binding protein PA4530 gi|122257429|sp|Q02GQ9|Y5879_PSEAB RecName: Full=UPF0243 zinc-binding protein PA14_58790 gi|167013009|sp|A6VBR6|Y5166_PSEA7 RecName: Full=UPF0243 zinc-binding protein PSPA7_5166 gi|226707632|sp|B7V073|Y4913_PSEA8 RecName: Full=UPF0243 zinc-binding protein PLES_49131 gi|9950773|gb|AAG07918.1|AE004867_4 conserved hypothetical protein [Pseudomonas aeruginosa PAO1] gi|115587783|gb|ABJ13798.1| conserved hypothetical protein [Pseudomonas aeruginosa UCBPP-PA14] gi|126170743|gb|EAZ56254.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719] gi|126198036|gb|EAZ62099.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192] gi|150960007|gb|ABR82032.1| conserved hypothetical protein [Pseudomonas aeruginosa PA7] gi|218773853|emb|CAW29667.1| conserved hypothetical protein [Pseudomonas aeruginosa LESB58] gi|310879876|gb|EFQ38470.1| hypothetical protein PA39016_000870096 [Pseudomonas aeruginosa 39016] Length = 66 Score = 49.7 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 23/53 (43%), Gaps = 4/53 (7%) Query: 7 RSLKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKS 55 + L CP C S ++ PFCS +C+ IDL W E+ I E Sbjct: 3 QPLTVECPTCGAPVEWKSDNKYRPFCSDRCKLIDLGAWAAEEHAIPGDTLEDD 55 >gi|262374078|ref|ZP_06067355.1| conserved hypothetical protein [Acinetobacter junii SH205] gi|262311089|gb|EEY92176.1| conserved hypothetical protein [Acinetobacter junii SH205] Length = 63 Score = 49.3 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 21/62 (33%), Positives = 31/62 (50%), Gaps = 8/62 (12%) Query: 8 SLKSICPECRKGSM---VEFYPFCSTQCRSIDLSRWLHGEYVIAAVE-----DEKSEEEV 59 CP C + S EF PFCS +C+ IDL W + EY + + D++ E+E Sbjct: 2 PRTFPCPRCGQDSTWEGNEFRPFCSERCKLIDLGAWANDEYKLPTQDAPQAGDKRHEDEY 61 Query: 60 KD 61 +D Sbjct: 62 ED 63 >gi|120597342|ref|YP_961916.1| hypothetical protein Sputw3181_0511 [Shewanella sp. W3-18-1] gi|166227305|sp|A1RFB7|Y511_SHESW RecName: Full=UPF0243 zinc-binding protein Sputw3181_0511 gi|120557435|gb|ABM23362.1| protein of unknown function DUF329 [Shewanella sp. W3-18-1] Length = 69 Score = 49.3 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 16/53 (30%), Positives = 24/53 (45%), Gaps = 4/53 (7%) Query: 8 SLKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 L CP C+ EF PFCS +C+ IDL+ W ++ I + + Sbjct: 2 PLTVKCPICKTPVEWAPQSEFKPFCSERCKLIDLADWASEKHAIPVKSEFDLD 54 >gi|170702926|ref|ZP_02893766.1| protein of unknown function DUF329 [Burkholderia ambifaria IOP40-10] gi|170132165|gb|EDT00653.1| protein of unknown function DUF329 [Burkholderia ambifaria IOP40-10] Length = 67 Score = 49.3 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 18/54 (33%), Positives = 24/54 (44%), Gaps = 4/54 (7%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP C +F PFCS +C+ +DL W +Y I DE E +D Sbjct: 6 KCPSCGAEVRWTPENKFRPFCSARCKQLDLGAWAAEKYRIGGSSDEGPSSEEED 59 >gi|330960768|gb|EGH61028.1| DNA gyrase inhibitor [Pseudomonas syringae pv. maculicola str. ES4326] Length = 69 Score = 49.3 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 17/60 (28%), Positives = 25/60 (41%), Gaps = 4/60 (6%) Query: 7 RSLKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 + + CP C + PFCS +C+ IDL W E+ I D + E D+ Sbjct: 3 QPMTVQCPTCDAPVEWSAASPSRPFCSERCKLIDLGAWASEEHAIPVSPDAEDEMFSGDL 62 >gi|299065622|emb|CBJ36794.1| conserved protein of unknown function, UPF0243 family [Ralstonia solanacearum CMR15] Length = 57 Score = 49.3 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 14/42 (33%), Positives = 20/42 (47%) Query: 20 SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 + PFCS +C+ IDL W +Y I VED+ + Sbjct: 5 PESRYRPFCSERCKQIDLGAWAAEQYTIPVVEDDDLPPDAPG 46 >gi|50083674|ref|YP_045184.1| putative Zinc-binding protein [Acinetobacter sp. ADP1] gi|67461953|sp|Q6FEZ6|Y419_ACIAD RecName: Full=UPF0243 zinc-binding protein ACIAD0419 gi|49529650|emb|CAG67362.1| conserved hypothetical protein; putative Zinc-binding protein [Acinetobacter sp. ADP1] Length = 68 Score = 49.3 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 3/47 (6%) Query: 8 SLKSICPECRKGSM---VEFYPFCSTQCRSIDLSRWLHGEYVIAAVE 51 CP C + S+ E PFCS +C+ IDL W EY + + Sbjct: 7 PRTFPCPRCGQPSVWEGNESRPFCSERCKLIDLGAWASEEYKLKTQD 53 >gi|325266706|ref|ZP_08133382.1| zinc-binding protein [Kingella denitrificans ATCC 33394] gi|324981815|gb|EGC17451.1| zinc-binding protein [Kingella denitrificans ATCC 33394] Length = 61 Score = 49.3 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 16/48 (33%), Positives = 21/48 (43%), Gaps = 4/48 (8%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 CP CR S + PFCS +C+ +DL W I A + E Sbjct: 7 CPICRTPVEWCSENRYRPFCSERCKLVDLGEWADESRAIPAAPETPEE 54 >gi|146305806|ref|YP_001186271.1| zinc-binding protein [Pseudomonas mendocina ymp] gi|145574007|gb|ABP83539.1| protein of unknown function DUF329 [Pseudomonas mendocina ymp] Length = 64 Score = 49.3 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 14/47 (29%), Positives = 19/47 (40%), Gaps = 4/47 (8%) Query: 13 CPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKS 55 CP C + PFC +C+ IDL W E+ I + E Sbjct: 7 CPTCGAPVEWKVENTYRPFCCERCKLIDLGAWAAEEHAIPGNDLEDD 53 >gi|238026145|ref|YP_002910376.1| hypothetical protein bglu_1g04750 [Burkholderia glumae BGR1] gi|237875339|gb|ACR27672.1| Hypothetical protein bglu_1g04750 [Burkholderia glumae BGR1] Length = 69 Score = 48.9 bits (115), Expect = 2e-04, Method: Composition-based stats. Identities = 18/52 (34%), Positives = 24/52 (46%), Gaps = 4/52 (7%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEV 59 CP C K F PFCS +C+ +DL W Y I +DE S++ Sbjct: 6 KCPACAKDVPWTPESPFRPFCSARCKQMDLGAWAAERYRIGGTDDEPSDDAA 57 >gi|161525992|ref|YP_001581004.1| hypothetical protein Bmul_2823 [Burkholderia multivorans ATCC 17616] gi|189349291|ref|YP_001944919.1| hypothetical protein BMULJ_00415 [Burkholderia multivorans ATCC 17616] gi|221202529|ref|ZP_03575559.1| conserved hypothetical protein [Burkholderia multivorans CGD2M] gi|221208149|ref|ZP_03581154.1| conserved hypothetical protein [Burkholderia multivorans CGD2] gi|221213263|ref|ZP_03586238.1| conserved hypothetical protein [Burkholderia multivorans CGD1] gi|160343421|gb|ABX16507.1| protein of unknown function DUF329 [Burkholderia multivorans ATCC 17616] gi|189333313|dbj|BAG42383.1| conserved hypothetical protein [Burkholderia multivorans ATCC 17616] gi|221166715|gb|EED99186.1| conserved hypothetical protein [Burkholderia multivorans CGD1] gi|221172052|gb|EEE04494.1| conserved hypothetical protein [Burkholderia multivorans CGD2] gi|221177624|gb|EEE10041.1| conserved hypothetical protein [Burkholderia multivorans CGD2M] Length = 65 Score = 48.9 bits (115), Expect = 2e-04, Method: Composition-based stats. Identities = 16/53 (30%), Positives = 23/53 (43%), Gaps = 4/53 (7%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK 60 CP C +F PFCS +C+ +DL W +Y I +D +E Sbjct: 6 KCPSCGVAVRWTPENQFRPFCSARCKQLDLGAWASEKYRIGGSDDAPLSDEDG 58 >gi|167031692|ref|YP_001666923.1| zinc-binding protein [Pseudomonas putida GB-1] gi|3169572|gb|AAC17879.1| unknown [Pseudomonas putida GB-1] gi|166858180|gb|ABY96587.1| protein of unknown function DUF329 [Pseudomonas putida GB-1] Length = 66 Score = 48.9 bits (115), Expect = 2e-04, Method: Composition-based stats. Identities = 20/60 (33%), Positives = 27/60 (45%), Gaps = 4/60 (6%) Query: 7 RSLKSICPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 + L CP C F PFCS +C+ IDL W E+ IA E+ + E D+ Sbjct: 3 QPLTVDCPTCGAPVEWTEKSAFRPFCSDRCKLIDLGAWAAEEHKIAGSEESEDELYSGDL 62 >gi|66044049|ref|YP_233890.1| zinc-binding protein [Pseudomonas syringae pv. syringae B728a] gi|257483998|ref|ZP_05638039.1| zinc-binding protein [Pseudomonas syringae pv. tabaci ATCC 11528] gi|289626919|ref|ZP_06459873.1| zinc-binding protein [Pseudomonas syringae pv. aesculi str. NCPPB3681] gi|289650989|ref|ZP_06482332.1| zinc-binding protein [Pseudomonas syringae pv. aesculi str. 2250] gi|289674986|ref|ZP_06495876.1| zinc-binding protein [Pseudomonas syringae pv. syringae FF5] gi|298485505|ref|ZP_07003588.1| predicted zinc-binding protein [Pseudomonas savastanoi pv. savastanoi NCPPB 3335] gi|302189194|ref|ZP_07265867.1| zinc-binding protein [Pseudomonas syringae pv. syringae 642] gi|75503453|sp|Q4ZYC0|Y794_PSEU2 RecName: Full=UPF0243 zinc-binding protein Psyr_0794 gi|63254756|gb|AAY35852.1| Protein of unknown function DUF329 [Pseudomonas syringae pv. syringae B728a] gi|298159969|gb|EFI01007.1| predicted zinc-binding protein [Pseudomonas savastanoi pv. savastanoi NCPPB 3335] gi|320326050|gb|EFW82107.1| zinc-binding protein [Pseudomonas syringae pv. glycinea str. B076] gi|320330215|gb|EFW86200.1| zinc-binding protein [Pseudomonas syringae pv. glycinea str. race 4] gi|330867357|gb|EGH02066.1| DNA gyrase inhibitor [Pseudomonas syringae pv. aesculi str. 0893_23] gi|330890707|gb|EGH23368.1| DNA gyrase inhibitor [Pseudomonas syringae pv. mori str. 301020] gi|330900444|gb|EGH31863.1| DNA gyrase inhibitor [Pseudomonas syringae pv. japonica str. M301072PT] gi|330941600|gb|EGH44383.1| DNA gyrase inhibitor [Pseudomonas syringae pv. pisi str. 1704B] gi|330955368|gb|EGH55628.1| DNA gyrase inhibitor [Pseudomonas syringae Cit 7] gi|330955527|gb|EGH55787.1| DNA gyrase inhibitor [Pseudomonas syringae Cit 7] gi|330973675|gb|EGH73741.1| DNA gyrase inhibitor [Pseudomonas syringae pv. aceris str. M302273PT] gi|330977428|gb|EGH77375.1| DNA gyrase inhibitor [Pseudomonas syringae pv. aptata str. DSM 50252] gi|331013017|gb|EGH93073.1| DNA gyrase inhibitor [Pseudomonas syringae pv. tabaci ATCC 11528] Length = 69 Score = 48.9 bits (115), Expect = 2e-04, Method: Composition-based stats. Identities = 17/60 (28%), Positives = 25/60 (41%), Gaps = 4/60 (6%) Query: 7 RSLKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 + + CP C + PFCS +C+ IDL W E+ I D + E D+ Sbjct: 3 QPMTVQCPTCDAPVEWSAASPSRPFCSERCKLIDLGAWASEEHAIPVSPDAEDELFSGDL 62 >gi|157960237|ref|YP_001500271.1| hypothetical protein Spea_0408 [Shewanella pealeana ATCC 700345] gi|189040273|sp|A8GZJ9|Y408_SHEPA RecName: Full=UPF0243 zinc-binding protein Spea_0408 gi|157845237|gb|ABV85736.1| protein of unknown function DUF329 [Shewanella pealeana ATCC 700345] Length = 79 Score = 48.9 bits (115), Expect = 2e-04, Method: Composition-based stats. Identities = 18/53 (33%), Positives = 24/53 (45%), Gaps = 4/53 (7%) Query: 8 SLKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 SL CP C+ + EF PFCS +C+ IDL W + I + E Sbjct: 2 SLTVKCPTCQTPVTWNAEAEFKPFCSERCKLIDLGDWASEKNAIPVKPEFAPE 54 >gi|157273410|gb|ABV27309.1| conserved domain protein [Candidatus Chloracidobacterium thermophilum] Length = 64 Score = 48.9 bits (115), Expect = 2e-04, Method: Composition-based stats. Identities = 16/44 (36%), Positives = 21/44 (47%), Gaps = 3/44 (6%) Query: 13 CPECRKGSMVE---FYPFCSTQCRSIDLSRWLHGEYVIAAVEDE 53 CP C + E PFCS C+ DL WL+ Y + +DE Sbjct: 5 CPICGAITTWEGNPTRPFCSKACQQRDLGNWLNERYSLPIDDDE 48 >gi|26987366|ref|NP_742791.1| zinc-binding protein [Pseudomonas putida KT2440] gi|31563247|sp|Q88Q66|Y630_PSEPK RecName: Full=UPF0243 zinc-binding protein PP_0630 gi|24982020|gb|AAN66255.1|AE016254_2 conserved hypothetical protein [Pseudomonas putida KT2440] Length = 66 Score = 48.9 bits (115), Expect = 2e-04, Method: Composition-based stats. Identities = 20/60 (33%), Positives = 27/60 (45%), Gaps = 4/60 (6%) Query: 7 RSLKSICPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 + L CP C F PFCS +C+ IDL W E+ IA E+ + E D+ Sbjct: 3 QPLTVDCPTCGAPVEWSEKNAFRPFCSDRCKLIDLGAWAAEEHKIAGSEESEDELYSGDL 62 >gi|163751663|ref|ZP_02158883.1| hypothetical protein KT99_07414 [Shewanella benthica KT99] gi|161328489|gb|EDP99644.1| hypothetical protein KT99_07414 [Shewanella benthica KT99] Length = 70 Score = 48.9 bits (115), Expect = 2e-04, Method: Composition-based stats. Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 4/47 (8%) Query: 10 KSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVED 52 + CP C+ S +F PFCS +C+ IDL W ++VI + Sbjct: 4 RVKCPTCQTEVIWNSESKFRPFCSDRCKLIDLGDWASEKHVIPVEPE 50 >gi|219871149|ref|YP_002475524.1| putative zinc-binding protein [Haemophilus parasuis SH0165] gi|219691353|gb|ACL32576.1| putative zinc-binding protein [Haemophilus parasuis SH0165] Length = 64 Score = 48.9 bits (115), Expect = 2e-04, Method: Composition-based stats. Identities = 14/49 (28%), Positives = 25/49 (51%), Gaps = 4/49 (8%) Query: 13 CPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP C K ++ PFCS +C +DL WL+ E + + + +++ Sbjct: 6 CPNCGKEVAWVLGNKYRPFCSERCHLVDLGEWLNEENQVLESDIQSADD 54 >gi|167855807|ref|ZP_02478560.1| dephospho-CoA kinase [Haemophilus parasuis 29755] gi|167853086|gb|EDS24347.1| dephospho-CoA kinase [Haemophilus parasuis 29755] Length = 64 Score = 48.9 bits (115), Expect = 2e-04, Method: Composition-based stats. Identities = 14/49 (28%), Positives = 25/49 (51%), Gaps = 4/49 (8%) Query: 13 CPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP C K ++ PFCS +C +DL WL+ E + + + +++ Sbjct: 6 CPNCGKEVAWVLGNKYRPFCSERCHLVDLGEWLNEENQVLESDIQSADD 54 >gi|294139023|ref|YP_003555001.1| hypothetical protein SVI_0252 [Shewanella violacea DSS12] gi|293325492|dbj|BAJ00223.1| conserved hypothetical protein [Shewanella violacea DSS12] Length = 70 Score = 48.9 bits (115), Expect = 2e-04, Method: Composition-based stats. Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 4/49 (8%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 CP C+ S +F PFCS +C+ IDL W ++ I A + E Sbjct: 6 KCPTCQAEVIWNSESKFRPFCSDRCKLIDLGDWASEKHAIPAKPEFDHE 54 >gi|291615158|ref|YP_003525315.1| hypothetical protein Slit_2703 [Sideroxydans lithotrophicus ES-1] gi|291585270|gb|ADE12928.1| protein of unknown function DUF329 [Sideroxydans lithotrophicus ES-1] Length = 61 Score = 48.9 bits (115), Expect = 2e-04, Method: Composition-based stats. Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 4/51 (7%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K + F PFCS +C+ IDL +W + EY + E + + Sbjct: 8 TCPNCGKEMVWDTSNRFRPFCSERCKLIDLGKWANEEYRVEQREQDPPGSD 58 >gi|116620690|ref|YP_822846.1| hypothetical protein Acid_1570 [Candidatus Solibacter usitatus Ellin6076] gi|116223852|gb|ABJ82561.1| protein of unknown function DUF329 [Candidatus Solibacter usitatus Ellin6076] Length = 63 Score = 48.9 bits (115), Expect = 2e-04, Method: Composition-based stats. Identities = 18/56 (32%), Positives = 26/56 (46%), Gaps = 3/56 (5%) Query: 9 LKSICPECRKGSMV---EFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 + CP C+K + +PFCS +CR IDL W +YV+ D +D Sbjct: 1 MTVKCPICKKVEVAVGDPEFPFCSERCRIIDLGNWATEKYVVPTPADPNLANPDED 56 >gi|332991951|gb|AEF02006.1| zinc-binding protein [Alteromonas sp. SN2] Length = 75 Score = 48.9 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 23/54 (42%), Positives = 28/54 (51%), Gaps = 4/54 (7%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 CP C K S EF PFCS +C+ IDL W E+ IAA E+ + DI Sbjct: 5 CPTCAKSVTWNSESEFRPFCSKKCQLIDLGEWASEEHKIAAKPSEQPSAKEVDI 58 >gi|59801997|ref|YP_208709.1| hypothetical protein NGO1672 [Neisseria gonorrhoeae FA 1090] gi|268595572|ref|ZP_06129739.1| dephospho-CoA kinase [Neisseria gonorrhoeae 35/02] gi|268597607|ref|ZP_06131774.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19] gi|291042971|ref|ZP_06568709.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2] gi|996086|gb|AAC43466.1| ORFY; non-essential for pilus assembly; Method: conceptual translation supplied by author [Neisseria gonorrhoeae] gi|59718892|gb|AAW90297.1| conserved hypothetical protein [Neisseria gonorrhoeae FA 1090] gi|268548961|gb|EEZ44379.1| dephospho-CoA kinase [Neisseria gonorrhoeae 35/02] gi|268551395|gb|EEZ46414.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19] gi|291013110|gb|EFE05079.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2] Length = 105 Score = 48.9 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 20/65 (30%), Positives = 28/65 (43%), Gaps = 4/65 (6%) Query: 1 MQTSDFRSLKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 M S L+ CP C+ F PFCS +C+ IDL W G+Y ++ + E Sbjct: 37 MAESRQTRLQVKCPTCQTAVVWKPENAFRPFCSQRCKLIDLGGWADGKYTVSGQTESLPE 96 Query: 57 EEVKD 61 D Sbjct: 97 ISEPD 101 >gi|239994221|ref|ZP_04714745.1| zinc-binding protein [Alteromonas macleodii ATCC 27126] Length = 75 Score = 48.9 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 4/58 (6%) Query: 9 LKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 ++ CP C K E+ PFCS +C+ IDL W + IA E + + D+ Sbjct: 1 MEVKCPICAKQVVWAPTSEYRPFCSKKCQLIDLGEWAAEDRKIAGKPAEDATPKHIDV 58 >gi|264676893|ref|YP_003276799.1| hypothetical protein CtCNB1_0757 [Comamonas testosteroni CNB-2] gi|262207405|gb|ACY31503.1| hypothetical conserved protein [Comamonas testosteroni CNB-2] Length = 60 Score = 48.9 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 4/48 (8%) Query: 12 ICPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKS 55 CP C S+ +F PFCS +CR+IDL W + E+ + A + Sbjct: 3 TCPTCGGPSVFLPSNKFRPFCSERCRNIDLGAWGNEEFRVPAQTPPED 50 >gi|325110505|ref|YP_004271573.1| hypothetical protein Plabr_3974 [Planctomyces brasiliensis DSM 5305] gi|324970773|gb|ADY61551.1| UPF0243 zinc-binding protein yacG [Planctomyces brasiliensis DSM 5305] Length = 82 Score = 48.9 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 6/53 (11%) Query: 10 KSICPECRKG------SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 CP C + E +PFCS +CRS+DL RW G+Y I E+++ Sbjct: 4 PQTCPVCNLPVGPQTTAPAELFPFCSPRCRSVDLFRWSEGKYAIVENISERAD 56 >gi|15676246|ref|NP_273379.1| hypothetical protein NMB0330 [Neisseria meningitidis MC58] gi|31563290|sp|Q9K155|Y330_NEIMB RecName: Full=UPF0243 zinc-binding protein NMB0330 gi|7225551|gb|AAF40774.1| conserved hypothetical protein [Neisseria meningitidis MC58] gi|325140979|gb|EGC63485.1| zinc-binding protein YacG [Neisseria meningitidis CU385] gi|325199524|gb|ADY94979.1| zinc-binding protein YacG [Neisseria meningitidis H44/76] Length = 69 Score = 48.9 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 20/66 (30%), Positives = 29/66 (43%), Gaps = 4/66 (6%) Query: 1 MQTSDFRSLKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 M S L+ CP C+ F PFCS +C+ IDL W G+Y ++ + E Sbjct: 1 MTESRQTRLQVKCPTCQTAVVWKPENAFRPFCSQRCKLIDLGGWADGKYTVSGQTESLPE 60 Query: 57 EEVKDI 62 D+ Sbjct: 61 ISEPDM 66 >gi|226951889|ref|ZP_03822353.1| zinc-binding protein [Acinetobacter sp. ATCC 27244] gi|294649146|ref|ZP_06726587.1| zinc-binding protein [Acinetobacter haemolyticus ATCC 19194] gi|226837429|gb|EEH69812.1| zinc-binding protein [Acinetobacter sp. ATCC 27244] gi|292824944|gb|EFF83706.1| zinc-binding protein [Acinetobacter haemolyticus ATCC 19194] Length = 63 Score = 48.9 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 3/52 (5%) Query: 8 SLKSICPECRKGSM---VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 CP C + S EF PFCS +C+ IDL W EY + + +++ Sbjct: 2 PRTFPCPRCGENSTWEGNEFRPFCSERCKLIDLGAWASDEYKLPTQDAPQAD 53 >gi|170723701|ref|YP_001751389.1| zinc-binding protein [Pseudomonas putida W619] gi|226706203|sp|B1JF64|Y4540_PSEPW RecName: Full=UPF0243 zinc-binding protein PputW619_4540 gi|169761704|gb|ACA75020.1| protein of unknown function DUF329 [Pseudomonas putida W619] Length = 66 Score = 48.9 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 4/60 (6%) Query: 7 RSLKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 + L CP C + F PFCS +C+ IDL W E+ IA ++ + E D+ Sbjct: 3 QPLTVDCPTCGAPVEWDAKNAFRPFCSDRCKLIDLGAWAAEEHKIAGSQESEDELYSGDL 62 >gi|148545921|ref|YP_001266023.1| zinc-binding protein [Pseudomonas putida F1] gi|167016751|sp|A5VY79|Y671_PSEP1 RecName: Full=UPF0243 zinc-binding protein Pput_0671 gi|148509979|gb|ABQ76839.1| protein of unknown function DUF329 [Pseudomonas putida F1] Length = 66 Score = 48.5 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 20/60 (33%), Positives = 26/60 (43%), Gaps = 4/60 (6%) Query: 7 RSLKSICPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 + L CP C F PFCS +C+ IDL W E+ IA E + E D+ Sbjct: 3 QPLTVDCPTCGAPVEWSEKNAFRPFCSDRCKLIDLGAWAAEEHKIAGSEGSEDELYSGDL 62 >gi|261391855|emb|CAX49314.1| putative UPF0243 zinc-binding protein [Neisseria meningitidis 8013] gi|325145125|gb|EGC67407.1| zinc-binding protein YacG [Neisseria meningitidis M01-240013] Length = 69 Score = 48.5 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 20/66 (30%), Positives = 29/66 (43%), Gaps = 4/66 (6%) Query: 1 MQTSDFRSLKSICPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 M S L+ CP C+ F PFCS +C+ IDL W G+Y ++ + E Sbjct: 1 MTESRQTRLQVKCPTCQTAVVWEPENAFRPFCSQRCKLIDLGGWADGKYTVSGQTESLPE 60 Query: 57 EEVKDI 62 D+ Sbjct: 61 ISEPDM 66 >gi|320108293|ref|YP_004183883.1| hypothetical protein AciPR4_3131 [Terriglobus saanensis SP1PR4] gi|319926814|gb|ADV83889.1| protein of unknown function DUF329 [Terriglobus saanensis SP1PR4] Length = 74 Score = 48.5 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 19/45 (42%), Positives = 25/45 (55%), Gaps = 2/45 (4%) Query: 13 CPECRKGSMVE--FYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKS 55 CP CRK ++ PFCS +CR IDL +W GEY I + + Sbjct: 9 CPICRKDVALDDPNVPFCSDRCRVIDLGKWASGEYKITSPILDPD 53 >gi|167571333|ref|ZP_02364207.1| hypothetical protein BoklC_15942 [Burkholderia oklahomensis C6786] Length = 67 Score = 48.5 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 23/54 (42%), Gaps = 4/54 (7%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP C K F PFCS +C+ DL W +Y I +DE ++ Sbjct: 6 KCPSCCKEVRWTPENRFRPFCSARCKQFDLGAWAAEKYRIGGTDDEAPSDDDAG 59 >gi|325983257|ref|YP_004295659.1| Uncharacterized zinc-binding family protein [Nitrosomonas sp. AL212] gi|325532776|gb|ADZ27497.1| Uncharacterized zinc-binding family protein [Nitrosomonas sp. AL212] Length = 58 Score = 48.5 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 4/53 (7%) Query: 9 LKSICPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 K CP+C + + F PFCS +C++ DLS+W Y I + + E+ Sbjct: 4 RKVNCPQCGEKVIWEAASRFRPFCSERCKTADLSQWAQESYRIPEPANTREEK 56 >gi|167622405|ref|YP_001672699.1| hypothetical protein Shal_0465 [Shewanella halifaxensis HAW-EB4] gi|189040207|sp|B0TQP7|Y465_SHEHH RecName: Full=UPF0243 zinc-binding protein Shal_0465 gi|167352427|gb|ABZ75040.1| protein of unknown function DUF329 [Shewanella halifaxensis HAW-EB4] Length = 79 Score = 48.5 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 19/53 (35%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Query: 8 SLKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 SL CP C+ + EF PFCS +C+ IDL W + VI + E Sbjct: 2 SLTVKCPTCQAPVTWSADSEFKPFCSERCKLIDLGDWASEKNVIPVKSEFDPE 54 >gi|134294660|ref|YP_001118395.1| hypothetical protein Bcep1808_0548 [Burkholderia vietnamiensis G4] gi|134137817|gb|ABO53560.1| protein of unknown function DUF329 [Burkholderia vietnamiensis G4] Length = 66 Score = 48.5 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 20/57 (35%), Positives = 26/57 (45%), Gaps = 6/57 (10%) Query: 12 ICPECRKGS----MVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDE--KSEEEVKDI 62 CP C +F PFCS +C+ +DL W +Y I DE SEE+ D Sbjct: 6 KCPSCGAEVRWTHENKFRPFCSARCKQLDLGAWAAEKYRIGGSSDEGPSSEEDGGDT 62 >gi|114331046|ref|YP_747268.1| hypothetical protein Neut_1047 [Nitrosomonas eutropha C91] gi|114308060|gb|ABI59303.1| protein of unknown function DUF329 [Nitrosomonas eutropha C91] Length = 64 Score = 48.5 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 15/62 (24%), Positives = 28/62 (45%), Gaps = 4/62 (6%) Query: 1 MQTSDFRSLKSICPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 M+ +S CP+C + ++ PFCS +C+ +DL W Y I ++ + + Sbjct: 1 MERRPGKSPTVNCPQCGEVVVWEKSSKYRPFCSERCKLLDLGLWATDSYRIPDEDEPQED 60 Query: 57 EE 58 Sbjct: 61 NP 62 >gi|330811791|ref|YP_004356253.1| hypothetical protein PSEBR_a4830 [Pseudomonas brassicacearum subsp. brassicacearum NFM421] gi|327379899|gb|AEA71249.1| Conserved hypothetical protein [Pseudomonas brassicacearum subsp. brassicacearum NFM421] Length = 68 Score = 48.5 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 18/53 (33%), Positives = 24/53 (45%), Gaps = 4/53 (7%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP C +F PFCS +C+ IDL W E+ I D + E +D Sbjct: 9 CPTCGAPVEWSPESKFRPFCSDRCKLIDLGAWASEEHKIPVSPDAEDELFSED 61 >gi|71065617|ref|YP_264344.1| hypothetical protein Psyc_1058 [Psychrobacter arcticus 273-4] gi|71038602|gb|AAZ18910.1| conserved hypothetical protein [Psychrobacter arcticus 273-4] Length = 65 Score = 48.5 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 3/49 (6%) Query: 12 ICPECRKGS---MVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP C + ++ PFCS +C+ IDL W + +Y + + S+E Sbjct: 16 PCPRCGTQTLWQDNKYKPFCSHRCKLIDLGAWANEDYTLPSESTPFSDE 64 >gi|237807309|ref|YP_002891749.1| hypothetical protein Tola_0534 [Tolumonas auensis DSM 9187] gi|259647079|sp|C4LA34|Y534_TOLAT RecName: Full=UPF0243 zinc-binding protein Tola_0534 gi|237499570|gb|ACQ92163.1| protein of unknown function DUF329 [Tolumonas auensis DSM 9187] Length = 72 Score = 48.5 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 23/60 (38%), Positives = 27/60 (45%), Gaps = 4/60 (6%) Query: 8 SLKSICPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDIL 63 SLK CP C +F PFCS +CR IDL W E IA E S + + L Sbjct: 2 SLKVDCPTCGTPVEWSPLSQFRPFCSDRCRLIDLGEWFSEERSIAGEEHTPSSDTARPQL 61 >gi|218768894|ref|YP_002343406.1| hypothetical protein NMA2158 [Neisseria meningitidis Z2491] gi|304386509|ref|ZP_07368797.1| protein of hypothetical function DUF329 [Neisseria meningitidis ATCC 13091] gi|31563289|sp|Q9JSS3|Y2158_NEIMA RecName: Full=UPF0243 zinc-binding protein NMA2158 gi|121052902|emb|CAM09254.1| conserved hypothetical protein [Neisseria meningitidis Z2491] gi|254670161|emb|CBA05213.1| conserved hypothetical protein [Neisseria meningitidis alpha153] gi|304339338|gb|EFM05410.1| protein of hypothetical function DUF329 [Neisseria meningitidis ATCC 13091] gi|308388538|gb|ADO30858.1| hypothetical protein NMBB_0368 [Neisseria meningitidis alpha710] gi|319411195|emb|CBY91600.1| putative UPF0243 zinc-binding protein [Neisseria meningitidis WUE 2594] gi|325130909|gb|EGC53638.1| zinc-binding protein YacG [Neisseria meningitidis OX99.30304] gi|325132885|gb|EGC55562.1| zinc-binding protein YacG [Neisseria meningitidis M6190] gi|325134911|gb|EGC57543.1| zinc-binding protein YacG [Neisseria meningitidis M13399] gi|325136905|gb|EGC59502.1| zinc-binding protein YacG [Neisseria meningitidis M0579] gi|325138870|gb|EGC61420.1| zinc-binding protein YacG [Neisseria meningitidis ES14902] Length = 69 Score = 48.5 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 20/66 (30%), Positives = 29/66 (43%), Gaps = 4/66 (6%) Query: 1 MQTSDFRSLKSICPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 M S L+ CP C+ F PFCS +C+ IDL W G+Y ++ + E Sbjct: 1 MAESRQTRLQVKCPTCQTAVVWEPENAFRPFCSQRCKLIDLGGWADGKYTVSGQTESLPE 60 Query: 57 EEVKDI 62 D+ Sbjct: 61 ISEPDM 66 >gi|118595235|ref|ZP_01552582.1| Uncharacterized zinc finger protein [Methylophilales bacterium HTCC2181] gi|118441013|gb|EAV47640.1| Uncharacterized zinc finger protein [Methylophilales bacterium HTCC2181] Length = 55 Score = 48.5 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 19/52 (36%), Positives = 23/52 (44%), Gaps = 4/52 (7%) Query: 12 ICPECRKGSMVE----FYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEV 59 CP C+K PFCS +C+ IDL W EY I DE + E Sbjct: 4 TCPTCKKKIEYSLSNLSRPFCSEKCKLIDLGAWASEEYHIPGDNDEINYNED 55 >gi|299529711|ref|ZP_07043148.1| hypothetical protein CTS44_03025 [Comamonas testosteroni S44] gi|298722574|gb|EFI63494.1| hypothetical protein CTS44_03025 [Comamonas testosteroni S44] Length = 60 Score = 48.5 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 4/48 (8%) Query: 12 ICPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKS 55 CP C S+ +F PFCS +CR+IDL W + E+ + A + Sbjct: 3 KCPTCGGPSVFLPSNKFRPFCSERCRNIDLGAWGNEEFRVPAQTPPED 50 >gi|194290799|ref|YP_002006706.1| hypothetical protein RALTA_A2715 [Cupriavidus taiwanensis LMG 19424] gi|193224634|emb|CAQ70645.1| conserved hypothetical protein, DUF329 [Cupriavidus taiwanensis LMG 19424] Length = 62 Score = 48.5 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 18/54 (33%), Positives = 22/54 (40%), Gaps = 4/54 (7%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP C +F PFCS +C+ IDL W +YVI E D Sbjct: 6 KCPTCGTEVAWVPDNKFRPFCSERCKQIDLGAWASEKYVIGGKPGESPAGPPDD 59 >gi|37527507|ref|NP_930851.1| zinc-binding protein [Photorhabdus luminescens subsp. laumondii TTO1] gi|47117427|sp|Q7N157|Y3643_PHOLL RecName: Full=UPF0243 zinc-binding protein plu3643 gi|36786942|emb|CAE16016.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii TTO1] Length = 65 Score = 48.5 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 4/50 (8%) Query: 13 CPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K + + PFCS +C+ IDL +W + E I + + ++ Sbjct: 9 CPTCGKTVVWGEISPYRPFCSKRCQLIDLGQWANEEKRIPSQSENSDSDD 58 >gi|329118202|ref|ZP_08246912.1| zinc-binding protein [Neisseria bacilliformis ATCC BAA-1200] gi|327465623|gb|EGF11898.1| zinc-binding protein [Neisseria bacilliformis ATCC BAA-1200] Length = 61 Score = 48.5 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 4/52 (7%) Query: 12 ICPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEV 59 CP C K + + PFCS +C++ DL W G Y ++A E+ SE Sbjct: 9 KCPRCGKPAEFSPRNPYRPFCSQRCKTADLGAWADGSYRVSAEEEPFSEPPT 60 >gi|104783625|ref|YP_610123.1| zinc-binding protein [Pseudomonas entomophila L48] gi|122401826|sp|Q1I4U6|Y4670_PSEE4 RecName: Full=UPF0243 zinc-binding protein PSEEN4670 gi|95112612|emb|CAK17340.1| conserved hypothetical protein [Pseudomonas entomophila L48] Length = 66 Score = 48.5 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 19/60 (31%), Positives = 27/60 (45%), Gaps = 4/60 (6%) Query: 7 RSLKSICPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 + + CP C F PFCS +C+ IDL W E+ IA E+ + E D+ Sbjct: 3 QPMTVDCPTCGAPVEWGEKSPFRPFCSDRCKLIDLGAWAAEEHKIAGAEESEDELYSGDL 62 >gi|74318383|ref|YP_316123.1| hypothetical protein Tbd_2365 [Thiobacillus denitrificans ATCC 25259] gi|123611323|sp|Q3SGD2|Y2365_THIDA RecName: Full=UPF0243 zinc-binding protein Tbd_2365 gi|74057878|gb|AAZ98318.1| conserved hypothetical protein [Thiobacillus denitrificans ATCC 25259] Length = 69 Score = 48.5 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 5/53 (9%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP C + + PFCS +C+ IDL +W +Y + VE + E E D Sbjct: 12 CPICGATVKWLAENRWKPFCSERCKLIDLGQWATEKYRVP-VEPKPDEGETPD 63 >gi|71736406|ref|YP_273098.1| zinc-binding protein [Pseudomonas syringae pv. phaseolicola 1448A] gi|71556959|gb|AAZ36170.1| Hypothetical UPF0243 zinc-binding protein-related protein [Pseudomonas syringae pv. phaseolicola 1448A] Length = 65 Score = 48.5 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 23/54 (42%), Gaps = 4/54 (7%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 CP C + PFCS +C+ IDL W E+ I D + E D+ Sbjct: 5 CPTCDAPVEWSAASPSRPFCSERCKLIDLGAWASEEHAIPVSPDAEDEMFSGDL 58 >gi|270676229|ref|ZP_06222688.1| conserved domain protein [Haemophilus influenzae HK1212] gi|319775176|ref|YP_004137664.1| hypothetical protein HICON_05110 [Haemophilus influenzae F3047] gi|329122904|ref|ZP_08251475.1| zinc-binding protein [Haemophilus aegyptius ATCC 11116] gi|270316431|gb|EFA28316.1| conserved domain protein [Haemophilus influenzae HK1212] gi|317449767|emb|CBY85974.1| conserved hypothetical protein [Haemophilus influenzae F3047] gi|327471835|gb|EGF17275.1| zinc-binding protein [Haemophilus aegyptius ATCC 11116] Length = 68 Score = 48.1 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 16/51 (31%), Positives = 24/51 (47%), Gaps = 4/51 (7%) Query: 12 ICPECRKGS----MVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C+K F PFCS +C+ IDL W+ E I + + + + Sbjct: 9 PCPICQKSVPWINESTFRPFCSKRCQLIDLGEWVAEEKAIPSDTADFAMDP 59 >gi|225874942|ref|YP_002756401.1| hypothetical protein ACP_3406 [Acidobacterium capsulatum ATCC 51196] gi|225793181|gb|ACO33271.1| conserved hypothetical protein [Acidobacterium capsulatum ATCC 51196] Length = 72 Score = 48.1 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 19/48 (39%), Positives = 23/48 (47%), Gaps = 4/48 (8%) Query: 13 CPECRKGSMV--EFYPFCSTQCRSIDLSRWLHGEYVI--AAVEDEKSE 56 CP C +PFCS +CR IDL +W G Y I V+ E E Sbjct: 10 CPTCSTLVTAKDADFPFCSDRCRKIDLGKWASGAYKISSPVVDPEVLE 57 >gi|149376820|ref|ZP_01894577.1| zinc-binding protein [Marinobacter algicola DG893] gi|149358941|gb|EDM47408.1| zinc-binding protein [Marinobacter algicola DG893] Length = 62 Score = 48.1 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 4/48 (8%) Query: 13 CPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 CP C+K F PFCS +C+ IDL W + EY + A + Sbjct: 5 CPTCKKSVEWNENNPFRPFCSERCKLIDLGAWANEEYRVPAENASPDD 52 >gi|239999759|ref|ZP_04719683.1| hypothetical protein Ngon3_09816 [Neisseria gonorrhoeae 35/02] gi|240014916|ref|ZP_04721829.1| hypothetical protein NgonD_09803 [Neisseria gonorrhoeae DGI18] gi|240017364|ref|ZP_04723904.1| hypothetical protein NgonFA_09421 [Neisseria gonorrhoeae FA6140] gi|240081507|ref|ZP_04726050.1| hypothetical protein NgonF_09398 [Neisseria gonorrhoeae FA19] gi|240113786|ref|ZP_04728276.1| hypothetical protein NgonM_09521 [Neisseria gonorrhoeae MS11] gi|240116520|ref|ZP_04730582.1| hypothetical protein NgonPID1_09861 [Neisseria gonorrhoeae PID18] gi|240118744|ref|ZP_04732806.1| hypothetical protein NgonPID_09872 [Neisseria gonorrhoeae PID1] gi|240121986|ref|ZP_04734948.1| hypothetical protein NgonPI_09528 [Neisseria gonorrhoeae PID24-1] gi|240124283|ref|ZP_04737239.1| hypothetical protein NgonP_10163 [Neisseria gonorrhoeae PID332] gi|240126494|ref|ZP_04739380.1| hypothetical protein NgonSK_09868 [Neisseria gonorrhoeae SK-92-679] gi|240128957|ref|ZP_04741618.1| hypothetical protein NgonS_10107 [Neisseria gonorrhoeae SK-93-1035] gi|260439723|ref|ZP_05793539.1| hypothetical protein NgonDG_01288 [Neisseria gonorrhoeae DGI2] gi|268599858|ref|ZP_06134025.1| LOW QUALITY PROTEIN: DUF329 domain-containing protein [Neisseria gonorrhoeae MS11] gi|268602193|ref|ZP_06136360.1| dephospho-CoA kinase [Neisseria gonorrhoeae PID18] gi|268604458|ref|ZP_06138625.1| zinc-binding protein [Neisseria gonorrhoeae PID1] gi|268682912|ref|ZP_06149774.1| zinc-binding protein [Neisseria gonorrhoeae PID332] gi|268685078|ref|ZP_06151940.1| dephospho-CoA kinase [Neisseria gonorrhoeae SK-92-679] gi|31563239|sp|Q50961|YPIL_NEIGO RecName: Full=UPF0243 zinc-binding protein ORFY gi|67462012|sp|Q5F690|Y1672_NEIG1 RecName: Full=UPF0243 zinc-binding protein NGO1672 gi|268583989|gb|EEZ48665.1| LOW QUALITY PROTEIN: DUF329 domain-containing protein [Neisseria gonorrhoeae MS11] gi|268586324|gb|EEZ51000.1| dephospho-CoA kinase [Neisseria gonorrhoeae PID18] gi|268588589|gb|EEZ53265.1| zinc-binding protein [Neisseria gonorrhoeae PID1] gi|268623196|gb|EEZ55596.1| zinc-binding protein [Neisseria gonorrhoeae PID332] gi|268625362|gb|EEZ57762.1| dephospho-CoA kinase [Neisseria gonorrhoeae SK-92-679] Length = 69 Score = 48.1 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 20/65 (30%), Positives = 28/65 (43%), Gaps = 4/65 (6%) Query: 1 MQTSDFRSLKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 M S L+ CP C+ F PFCS +C+ IDL W G+Y ++ + E Sbjct: 1 MAESRQTRLQVKCPTCQTAVVWKPENAFRPFCSQRCKLIDLGGWADGKYTVSGQTESLPE 60 Query: 57 EEVKD 61 D Sbjct: 61 ISEPD 65 >gi|237729398|ref|ZP_04559879.1| zinc-binding protein [Citrobacter sp. 30_2] gi|283835162|ref|ZP_06354903.1| conserved domain protein [Citrobacter youngae ATCC 29220] gi|226909127|gb|EEH95045.1| zinc-binding protein [Citrobacter sp. 30_2] gi|291069463|gb|EFE07572.1| conserved domain protein [Citrobacter youngae ATCC 29220] Length = 64 Score = 48.1 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 4/50 (8%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K + F PFCS +C+ IDL W E I + D ++ Sbjct: 9 CPTCGKPVVWAEVSPFRPFCSKRCQLIDLGEWAAEEKRIPSSGDLSESDD 58 >gi|34499278|ref|NP_903493.1| hypothetical protein CV_3823 [Chromobacterium violaceum ATCC 12472] gi|47117442|sp|Q7NRF8|Y3823_CHRVO RecName: Full=UPF0243 zinc-binding protein CV_3823 gi|34105129|gb|AAQ61485.1| conserved hypothetical protein [Chromobacterium violaceum ATCC 12472] Length = 63 Score = 48.1 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 18/49 (36%), Positives = 23/49 (46%), Gaps = 4/49 (8%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP C+ + PFCS +CR IDL +W Y + A ED E Sbjct: 10 CPTCKAEVRWEPQSRYRPFCSERCRLIDLGQWASESYRVPAEEDHPPGE 58 >gi|157369017|ref|YP_001477006.1| hypothetical protein Spro_0772 [Serratia proteamaculans 568] gi|157320781|gb|ABV39878.1| protein of unknown function DUF329 [Serratia proteamaculans 568] Length = 67 Score = 48.1 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 20/51 (39%), Positives = 24/51 (47%), Gaps = 4/51 (7%) Query: 12 ICPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C KG + F PFCS +C+ IDL W E I + D EE Sbjct: 6 KCPTCGKGVVWGEVSPFRPFCSKRCQLIDLGEWADEEKRIPSNSDLSESEE 56 >gi|325295188|ref|YP_004281702.1| yacG [Desulfurobacterium thermolithotrophum DSM 11699] gi|325065636|gb|ADY73643.1| UPF0243 zinc-binding protein yacG [Desulfurobacterium thermolithotrophum DSM 11699] Length = 58 Score = 48.1 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 3/52 (5%) Query: 12 ICPECRKGSM---VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK 60 CP C K + + PFCS +C+ DLS+WL+ EY + + E EE Sbjct: 5 KCPNCGKETTWKDNPYRPFCSEKCKLADLSKWLNEEYTLFSEEPVVEEEADS 56 >gi|251793171|ref|YP_003007899.1| zinc-binding protein [Aggregatibacter aphrophilus NJ8700] gi|247534566|gb|ACS97812.1| conserved domain protein [Aggregatibacter aphrophilus NJ8700] Length = 70 Score = 48.1 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 22/55 (40%), Gaps = 4/55 (7%) Query: 7 RSLKSICPECRKGS----MVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 + CP C K + PFCS +C+ IDL W E I + +E Sbjct: 4 ETFSVPCPICHKQVEWSEQSLYRPFCSKRCQLIDLGEWAAEEKAIPCDTADFAEN 58 >gi|121593224|ref|YP_985120.1| hypothetical protein Ajs_0800 [Acidovorax sp. JS42] gi|222109978|ref|YP_002552242.1| hypothetical protein Dtpsy_0763 [Acidovorax ebreus TPSY] gi|120605304|gb|ABM41044.1| protein of unknown function DUF329 [Acidovorax sp. JS42] gi|221729422|gb|ACM32242.1| protein of unknown function DUF329 [Acidovorax ebreus TPSY] Length = 76 Score = 48.1 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 24/56 (42%), Gaps = 4/56 (7%) Query: 6 FRSLKSICPECRKGS----MVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 + + CP C S F PFCS +C+ IDL W ++ + A + E Sbjct: 13 PQGKRVPCPTCGGPSLYSPANRFRPFCSERCKQIDLGAWAAEDFRMPAEAPPEDAE 68 >gi|73542649|ref|YP_297169.1| hypothetical protein Reut_A2965 [Ralstonia eutropha JMP134] gi|72120062|gb|AAZ62325.1| Protein of unknown function DUF329 [Ralstonia eutropha JMP134] Length = 63 Score = 48.1 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 25/54 (46%), Gaps = 4/54 (7%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP C +F PFCS +C+ IDL W +YVI + E ++ + Sbjct: 6 KCPTCGTKVEWIPENKFRPFCSERCKQIDLGAWASEKYVIGSKPGETPSPDLPE 59 >gi|296105774|ref|YP_003617474.1| hypothetical protein lpa_00398 [Legionella pneumophila 2300/99 Alcoy] gi|295647675|gb|ADG23522.1| hypothetical protein lpa_00398 [Legionella pneumophila 2300/99 Alcoy] Length = 70 Score = 48.1 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 16/51 (31%), Positives = 20/51 (39%), Gaps = 4/51 (7%) Query: 9 LKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKS 55 K CP C K +F PFCS +C+ IDL W I + Sbjct: 5 KKIKCPICDKQNTWSPDNQFRPFCSERCKLIDLGEWASESRKIPGSSIDPE 55 >gi|294635020|ref|ZP_06713537.1| conserved domain protein [Edwardsiella tarda ATCC 23685] gi|291091619|gb|EFE24180.1| conserved domain protein [Edwardsiella tarda ATCC 23685] Length = 66 Score = 48.1 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 18/49 (36%), Positives = 23/49 (46%), Gaps = 4/49 (8%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP C K F PFCS +C+ IDL W + E IA+ + E Sbjct: 10 CPTCGKPVIWGEQSPFRPFCSKRCQLIDLGEWANEEKRIASEAEHSDSE 58 >gi|225024583|ref|ZP_03713775.1| hypothetical protein EIKCOROL_01460 [Eikenella corrodens ATCC 23834] gi|224942734|gb|EEG23943.1| hypothetical protein EIKCOROL_01460 [Eikenella corrodens ATCC 23834] Length = 60 Score = 48.1 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 4/48 (8%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 CP C+K + PFCS +C+ IDL W Y I + E+ + Sbjct: 8 CPTCQKPVLWNENSPYRPFCSQRCKMIDLGTWADESYRIPSQEEAPPQ 55 >gi|85712522|ref|ZP_01043570.1| Uncharacterized zinc finger protein [Idiomarina baltica OS145] gi|85693656|gb|EAQ31606.1| Uncharacterized zinc finger protein [Idiomarina baltica OS145] Length = 70 Score = 48.1 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 17/64 (26%), Positives = 23/64 (35%), Gaps = 4/64 (6%) Query: 2 QTSDFRSLKSICPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 Q CP C + PFCS +C+ IDL W + E I + E+ Sbjct: 5 QEEQRMPTHVDCPTCGDTVQWSEKAAYRPFCSERCKLIDLGEWANEEKAIPGEPAQIPEQ 64 Query: 58 EVKD 61 D Sbjct: 65 SAND 68 >gi|330987703|gb|EGH85806.1| DNA gyrase inhibitor [Pseudomonas syringae pv. lachrymans str. M301315] Length = 69 Score = 48.1 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 17/60 (28%), Positives = 25/60 (41%), Gaps = 4/60 (6%) Query: 7 RSLKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 + + CP C + PFCS +C+ IDL W E+ I D + E D+ Sbjct: 3 QPMTVQCPTCDAPVEWSAASPSRPFCSERCKLIDLGAWASEEHSIPVSPDAEDELFSGDL 62 >gi|225077386|ref|ZP_03720585.1| hypothetical protein NEIFLAOT_02447 [Neisseria flavescens NRL30031/H210] gi|241760234|ref|ZP_04758330.1| conserved hypothetical protein [Neisseria flavescens SK114] gi|319639055|ref|ZP_07993812.1| hypothetical protein HMPREF0604_01436 [Neisseria mucosa C102] gi|224951270|gb|EEG32479.1| hypothetical protein NEIFLAOT_02447 [Neisseria flavescens NRL30031/H210] gi|241319345|gb|EER55810.1| conserved hypothetical protein [Neisseria flavescens SK114] gi|317399633|gb|EFV80297.1| hypothetical protein HMPREF0604_01436 [Neisseria mucosa C102] Length = 60 Score = 48.1 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 16/49 (32%), Positives = 26/49 (53%), Gaps = 4/49 (8%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 CP C K + + PFCS +C+ IDL W +Y +++ +D S+ Sbjct: 7 KCPTCHKEVVWNTDSPYRPFCSKRCKLIDLGEWAQEKYTVSSEDDPFSD 55 >gi|261379324|ref|ZP_05983897.1| conserved domain protein [Neisseria subflava NJ9703] gi|284797761|gb|EFC53108.1| conserved domain protein [Neisseria subflava NJ9703] Length = 60 Score = 48.1 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 16/49 (32%), Positives = 26/49 (53%), Gaps = 4/49 (8%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 CP C K + + PFCS +C+ IDL W +Y +++ +D S+ Sbjct: 7 KCPTCHKKVVWNTDSPYRPFCSKRCKLIDLGEWAQEKYTVSSEDDPFSD 55 >gi|332142402|ref|YP_004428140.1| zinc-binding protein [Alteromonas macleodii str. 'Deep ecotype'] gi|327552424|gb|AEA99142.1| zinc-binding protein [Alteromonas macleodii str. 'Deep ecotype'] Length = 75 Score = 47.7 bits (112), Expect = 5e-04, Method: Composition-based stats. Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 4/58 (6%) Query: 9 LKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 ++ CP C K EF PFCS +C+ IDL W + IA E + + D+ Sbjct: 1 MEVKCPICAKQVVWSPESEFRPFCSKKCQLIDLGEWAAEDRKIAGKPAEDATPKHIDV 58 >gi|229588334|ref|YP_002870453.1| zinc-binding protein [Pseudomonas fluorescens SBW25] gi|259647124|sp|C3KE92|Y788_PSEFS RecName: Full=UPF0243 zinc-binding protein PFLU_0788 gi|229360200|emb|CAY47057.1| conserved hypothetical protein [Pseudomonas fluorescens SBW25] Length = 66 Score = 47.7 bits (112), Expect = 5e-04, Method: Composition-based stats. Identities = 18/60 (30%), Positives = 26/60 (43%), Gaps = 4/60 (6%) Query: 7 RSLKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 + L CP C + PFCS +C+ IDL W E+ I D + E +D+ Sbjct: 3 QPLTVDCPTCGAPVEWTAANLNRPFCSDRCKLIDLGAWAAEEHKIPVAPDAEDELFSEDL 62 >gi|260596526|ref|YP_003209097.1| hypothetical protein CTU_07340 [Cronobacter turicensis z3032] gi|260215703|emb|CBA28052.1| UPF0243 zinc-binding protein ESA_03238 [Cronobacter turicensis z3032] Length = 66 Score = 47.7 bits (112), Expect = 5e-04, Method: Composition-based stats. Identities = 18/49 (36%), Positives = 21/49 (42%), Gaps = 4/49 (8%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP C K F PFCS +CR IDL W E I + D + Sbjct: 9 CPTCGKEVIWGEQSPFRPFCSNRCRLIDLGEWAAEEKRIPSSGDRSDTD 57 >gi|52840471|ref|YP_094270.1| hypothetical protein lpg0216 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] gi|67461929|sp|Q5ZYZ5|Y216_LEGPH RecName: Full=UPF0243 zinc-binding protein lpg0216 gi|52627582|gb|AAU26323.1| hypothetical protein lpg0216 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] Length = 70 Score = 47.7 bits (112), Expect = 5e-04, Method: Composition-based stats. Identities = 16/50 (32%), Positives = 19/50 (38%), Gaps = 4/50 (8%) Query: 10 KSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKS 55 K CP C K F PFCS +C+ IDL W I + Sbjct: 6 KIKCPICDKQNTWRPDNLFRPFCSERCKLIDLGEWASESRKIPGSSIDPE 55 >gi|270263970|ref|ZP_06192238.1| hypothetical protein SOD_f01840 [Serratia odorifera 4Rx13] gi|270042163|gb|EFA15259.1| hypothetical protein SOD_f01840 [Serratia odorifera 4Rx13] Length = 63 Score = 47.7 bits (112), Expect = 5e-04, Method: Composition-based stats. Identities = 20/51 (39%), Positives = 24/51 (47%), Gaps = 4/51 (7%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C KG + F PFCS +C+ IDL W E I + D EE Sbjct: 6 KCPTCGKGVVWGEVSPFRPFCSKRCQLIDLGEWADEEKRIPSNSDLSESEE 56 >gi|253995888|ref|YP_003047952.1| hypothetical protein Mmol_0515 [Methylotenera mobilis JLW8] gi|253982567|gb|ACT47425.1| protein of unknown function DUF329 [Methylotenera mobilis JLW8] Length = 63 Score = 47.7 bits (112), Expect = 5e-04, Method: Composition-based stats. Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 5/52 (9%) Query: 13 CPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIA-AVEDEKSEEEV 59 CP C+ + PFCS +C IDL W + +Y I A +D+ +E+ Sbjct: 10 CPTCKNLVEFSPLNSYRPFCSKRCEMIDLGAWANEDYAIPTATKDDDLPDEL 61 >gi|224823849|ref|ZP_03696958.1| protein of unknown function DUF329 [Lutiella nitroferrum 2002] gi|224604304|gb|EEG10478.1| protein of unknown function DUF329 [Lutiella nitroferrum 2002] Length = 64 Score = 47.7 bits (112), Expect = 5e-04, Method: Composition-based stats. Identities = 15/47 (31%), Positives = 21/47 (44%), Gaps = 4/47 (8%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKS 55 CP C + PFCS +C+ IDL +W Y + A E+ Sbjct: 10 CPTCGAAVRWEPQSRYRPFCSERCKLIDLGQWADESYRVPAEEEHPD 56 >gi|148653224|ref|YP_001280317.1| hypothetical protein PsycPRwf_1422 [Psychrobacter sp. PRwf-1] gi|148572308|gb|ABQ94367.1| protein of unknown function DUF329 [Psychrobacter sp. PRwf-1] Length = 68 Score = 47.7 bits (112), Expect = 5e-04, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 30/54 (55%), Gaps = 3/54 (5%) Query: 7 RSLKSICPECRKGSM---VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 R CP+C+K ++ + PFCS +C+ IDL W + +Y + A + S++ Sbjct: 13 RPKSYPCPQCQKLTVWQDNPYKPFCSDRCKLIDLGAWANEDYKLPAQDSPFSQD 66 >gi|288575344|ref|ZP_05976763.2| conserved domain protein [Neisseria mucosa ATCC 25996] gi|288567875|gb|EFC89435.1| conserved domain protein [Neisseria mucosa ATCC 25996] Length = 49 Score = 47.7 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 14/39 (35%), Positives = 22/39 (56%) Query: 21 MVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEV 59 ++ PFCS +CR IDL W +Y + A ED+ + + Sbjct: 6 ESKYRPFCSQRCRLIDLGEWAQEKYTVEAEEDDTLSDSI 44 >gi|121635534|ref|YP_975779.1| hypothetical protein NMC1842 [Neisseria meningitidis FAM18] gi|254805635|ref|YP_003083856.1| hypothetical protein NMO_1711 [Neisseria meningitidis alpha14] gi|166225449|sp|A1KVV4|Y1842_NEIMF RecName: Full=UPF0243 zinc-binding protein NMC1842 gi|120867240|emb|CAM11009.1| conserved hypothetical protein [Neisseria meningitidis FAM18] gi|254669177|emb|CBA07909.1| conserved hypothetical protein [Neisseria meningitidis alpha14] gi|325128916|gb|EGC51770.1| zinc-binding protein YacG [Neisseria meningitidis N1568] gi|325202850|gb|ADY98304.1| zinc-binding protein YacG [Neisseria meningitidis M01-240149] gi|325203443|gb|ADY98896.1| zinc-binding protein YacG [Neisseria meningitidis M01-240355] gi|325205407|gb|ADZ00860.1| zinc-binding protein YacG [Neisseria meningitidis M04-240196] gi|325208843|gb|ADZ04295.1| zinc-binding protein YacG [Neisseria meningitidis NZ-05/33] Length = 69 Score = 47.7 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 20/66 (30%), Positives = 30/66 (45%), Gaps = 4/66 (6%) Query: 1 MQTSDFRSLKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 M S L+ CP C+ F PFCS +C+ IDL W G+Y +++ + E Sbjct: 1 MTESRQTRLQVKCPTCQTAVVWKPENAFRPFCSQRCKLIDLGGWADGKYTVSSQTESLPE 60 Query: 57 EEVKDI 62 D+ Sbjct: 61 ISEPDM 66 >gi|192360822|ref|YP_001983193.1| hypothetical protein CJA_2734 [Cellvibrio japonicus Ueda107] gi|190686987|gb|ACE84665.1| Domain of unknown function (DUF329) family [Cellvibrio japonicus Ueda107] Length = 73 Score = 47.7 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 17/50 (34%), Positives = 22/50 (44%), Gaps = 4/50 (8%) Query: 12 ICPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP C+K F PFCS +CR IDL W + IA + + Sbjct: 20 KCPSCQKIVFWNDDYPFRPFCSDRCRLIDLGEWASENHRIAGEPAKPFSD 69 >gi|237802032|ref|ZP_04590493.1| DNA gyrase inhibitor [Pseudomonas syringae pv. oryzae str. 1_6] gi|331024888|gb|EGI04944.1| DNA gyrase inhibitor [Pseudomonas syringae pv. oryzae str. 1_6] Length = 69 Score = 47.7 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 17/60 (28%), Positives = 25/60 (41%), Gaps = 4/60 (6%) Query: 7 RSLKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 + + CP C + PFCS +C+ IDL W E+ I D + E D+ Sbjct: 3 QPMTVQCPTCDTSVEWSAASPSRPFCSERCKLIDLGAWASEEHAIPVSPDAEDEMFSGDL 62 >gi|170724670|ref|YP_001758696.1| hypothetical protein Swoo_0300 [Shewanella woodyi ATCC 51908] gi|226703669|sp|B1KNA4|Y300_SHEWM RecName: Full=UPF0243 zinc-binding protein Swoo_0300 gi|169810017|gb|ACA84601.1| protein of unknown function DUF329 [Shewanella woodyi ATCC 51908] Length = 70 Score = 47.7 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 4/54 (7%) Query: 8 SLKSICPECRKGS----MVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP C+K +F PFC +C+ IDL W ++ I + +++ Sbjct: 2 PTSVKCPTCQKDVIWNNESKFKPFCCERCKLIDLGDWASEKHAIPVKPEFDADD 55 >gi|293391560|ref|ZP_06635894.1| dephospho-CoA kinase [Aggregatibacter actinomycetemcomitans D7S-1] gi|290952094|gb|EFE02213.1| dephospho-CoA kinase [Aggregatibacter actinomycetemcomitans D7S-1] Length = 70 Score = 47.7 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 15/50 (30%), Positives = 21/50 (42%), Gaps = 4/50 (8%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP C K + PFCS +C+ IDL W E I + + + Sbjct: 9 PCPICHKAVVWSEQSPYRPFCSKRCQLIDLGEWAAEEKAIPCETADFAAD 58 >gi|168264012|ref|ZP_02685985.1| conserved domain protein [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] gi|205347516|gb|EDZ34147.1| conserved domain protein [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] Length = 63 Score = 47.7 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 4/50 (8%) Query: 13 CPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K + F PFCS +C+ IDL W E IA+ ++ ++ Sbjct: 9 CPTCGKPVVWGEISPFRPFCSKRCQLIDLGEWAAEEKRIASSGEQSDSDD 58 >gi|315498406|ref|YP_004087210.1| hypothetical protein Astex_1390 [Asticcacaulis excentricus CB 48] gi|315416418|gb|ADU13059.1| protein of unknown function DUF329 [Asticcacaulis excentricus CB 48] Length = 82 Score = 47.7 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 22/41 (53%) Query: 20 SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK 60 + ++ PFCS +C DL WL GEYVI+ +E + Sbjct: 23 AAKDYSPFCSKRCADADLMHWLKGEYVISGTGALAAEAPEE 63 >gi|298505330|gb|ADI84053.1| protein of unknown function DUF329 [Geobacter sulfurreducens KN400] Length = 59 Score = 47.7 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 3/52 (5%) Query: 12 ICPECRKGSMVE---FYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK 60 CP CR ++ E PFCS +C+++DL+ W EY IA E +E Sbjct: 6 TCPRCRAETVWEGNPHRPFCSARCKTVDLAAWADEEYRIAGPEAPSDNDEND 57 >gi|295677748|ref|YP_003606272.1| protein of unknown function DUF329 [Burkholderia sp. CCGE1002] gi|295437591|gb|ADG16761.1| protein of unknown function DUF329 [Burkholderia sp. CCGE1002] Length = 67 Score = 47.3 bits (111), Expect = 6e-04, Method: Composition-based stats. Identities = 16/43 (37%), Positives = 19/43 (44%), Gaps = 4/43 (9%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAV 50 CP C K F PFCS +C+ IDL W +Y I Sbjct: 6 KCPTCGKDVRWTPESRFRPFCSERCKQIDLGAWAAEKYRIGGN 48 >gi|315634804|ref|ZP_07890086.1| zinc-binding protein [Aggregatibacter segnis ATCC 33393] gi|315476356|gb|EFU67106.1| zinc-binding protein [Aggregatibacter segnis ATCC 33393] Length = 71 Score = 47.3 bits (111), Expect = 6e-04, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 18/41 (43%), Gaps = 4/41 (9%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIA 48 CP C K + PFCS +C+ IDL W E I Sbjct: 9 PCPICHKQVEWSEQSPYRPFCSKRCQLIDLGEWAAEEKAIP 49 >gi|107021651|ref|YP_619978.1| hypothetical protein Bcen_0091 [Burkholderia cenocepacia AU 1054] gi|116688597|ref|YP_834220.1| hypothetical protein Bcen2424_0573 [Burkholderia cenocepacia HI2424] gi|170731896|ref|YP_001763843.1| hypothetical protein Bcenmc03_0543 [Burkholderia cenocepacia MC0-3] gi|105891840|gb|ABF75005.1| protein of unknown function DUF329 [Burkholderia cenocepacia AU 1054] gi|116646686|gb|ABK07327.1| protein of unknown function DUF329 [Burkholderia cenocepacia HI2424] gi|169815138|gb|ACA89721.1| protein of unknown function DUF329 [Burkholderia cenocepacia MC0-3] Length = 66 Score = 47.3 bits (111), Expect = 6e-04, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 22/55 (40%), Gaps = 4/55 (7%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 CP C +F PFCS +C+ +DL W +Y I DE E Sbjct: 6 KCPSCGAEVRWTPENKFRPFCSARCKQLDLGAWAAEKYRIGGASDEGPSSEEDGT 60 >gi|54310294|ref|YP_131314.1| zinc-binding protein [Photobacterium profundum SS9] gi|67462044|sp|Q6LMG5|Y3206_PHOPR RecName: Full=UPF0243 zinc-binding protein PBPRA3206 gi|46914735|emb|CAG21512.1| conserved hypothetical protein [Photobacterium profundum SS9] Length = 76 Score = 47.3 bits (111), Expect = 7e-04, Method: Composition-based stats. Identities = 16/64 (25%), Positives = 24/64 (37%), Gaps = 4/64 (6%) Query: 2 QTSDFRSLKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 + + CP C+K + PFC+ +C+ IDL W E I D + Sbjct: 9 SNTPTTPIIVKCPTCKKEVEWGEQSPYRPFCTKRCQLIDLGEWAEEEKSIPGAPDLSDSD 68 Query: 58 EVKD 61 D Sbjct: 69 GWSD 72 >gi|319944676|ref|ZP_08018943.1| hypothetical protein HMPREF0551_1791 [Lautropia mirabilis ATCC 51599] gi|319742115|gb|EFV94535.1| hypothetical protein HMPREF0551_1791 [Lautropia mirabilis ATCC 51599] Length = 73 Score = 47.3 bits (111), Expect = 7e-04, Method: Composition-based stats. Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 4/57 (7%) Query: 5 DFRSLKSICPECRKGS----MVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 R + CP C+ S + PFCS +CR IDL W + EYV+ E ++ Sbjct: 9 PSRRITVNCPTCQGPSLFAPENRWRPFCSERCRMIDLGAWANDEYVVPGQPVEADDD 65 >gi|89901678|ref|YP_524149.1| hypothetical protein Rfer_2907 [Rhodoferax ferrireducens T118] gi|89346415|gb|ABD70618.1| protein of unknown function DUF329 [Rhodoferax ferrireducens T118] Length = 72 Score = 47.3 bits (111), Expect = 7e-04, Method: Composition-based stats. Identities = 16/66 (24%), Positives = 29/66 (43%), Gaps = 4/66 (6%) Query: 2 QTSDFRSLKSICPECRKGSMVE----FYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 +T R +CP C S+ F PFCS +C+++D W + + A + + Sbjct: 6 ETPPVRPKIVVCPSCGGESVYAASNPFRPFCSERCKNVDFGAWASESFRVPASGLPEDQA 65 Query: 58 EVKDIL 63 + + L Sbjct: 66 DGAEPL 71 >gi|78065134|ref|YP_367903.1| hypothetical protein Bcep18194_A3658 [Burkholderia sp. 383] gi|77965879|gb|ABB07259.1| protein of unknown function DUF329 [Burkholderia sp. 383] Length = 66 Score = 47.3 bits (111), Expect = 7e-04, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 22/55 (40%), Gaps = 4/55 (7%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 CP C +F PFCS +C+ +DL W +Y I DE E Sbjct: 6 KCPSCGAAVRWTPENQFRPFCSARCKQLDLGAWAAEKYRIGGSSDEGPSSEEDGT 60 >gi|39996320|ref|NP_952271.1| hypothetical protein GSU1218 [Geobacter sulfurreducens PCA] gi|67462062|sp|Q74DU7|Y1218_GEOSL RecName: Full=UPF0243 zinc-binding protein GSU1218 gi|39983200|gb|AAR34594.1| conserved hypothetical protein [Geobacter sulfurreducens PCA] Length = 61 Score = 47.3 bits (111), Expect = 7e-04, Method: Composition-based stats. Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 3/52 (5%) Query: 12 ICPECRKGSMVE---FYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK 60 CP CR ++ E PFCS +C+++DL+ W EY IA E +E Sbjct: 8 TCPRCRAETVWEGNPHRPFCSARCKTVDLAAWADEEYRIAGPEAPSDNDEND 59 >gi|271502031|ref|YP_003335057.1| hypothetical protein Dd586_3521 [Dickeya dadantii Ech586] gi|270345586|gb|ACZ78351.1| protein of unknown function DUF329 [Dickeya dadantii Ech586] Length = 61 Score = 47.3 bits (111), Expect = 7e-04, Method: Composition-based stats. Identities = 17/50 (34%), Positives = 22/50 (44%), Gaps = 4/50 (8%) Query: 12 ICPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP C K + PFCS +C+ IDL W E I + ED + Sbjct: 5 KCPVCTKPVEWSENSPYRPFCSKRCQLIDLGEWADEEKRIPSEEDISDSD 54 >gi|319941779|ref|ZP_08016101.1| zinc-binding protein [Sutterella wadsworthensis 3_1_45B] gi|319804712|gb|EFW01579.1| zinc-binding protein [Sutterella wadsworthensis 3_1_45B] Length = 84 Score = 47.3 bits (111), Expect = 7e-04, Method: Composition-based stats. Identities = 20/61 (32%), Positives = 26/61 (42%), Gaps = 7/61 (11%) Query: 9 LKSICPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVI---AAVEDEKSEEEVKD 61 +K CP C S + PFCS +C+ IDL W + Y I D S EE+ Sbjct: 1 MKVPCPVCHTLTEYSSANPWRPFCSERCKMIDLGEWANDGYRIEGEPGSADRMSPEELDA 60 Query: 62 I 62 Sbjct: 61 A 61 >gi|270157561|ref|ZP_06186218.1| UPF0243 zinc-binding protein [Legionella longbeachae D-4968] gi|269989586|gb|EEZ95840.1| UPF0243 zinc-binding protein [Legionella longbeachae D-4968] Length = 76 Score = 47.3 bits (111), Expect = 7e-04, Method: Composition-based stats. Identities = 15/48 (31%), Positives = 20/48 (41%), Gaps = 4/48 (8%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 CP C K +F PFCS +C+ IDL W + I + Sbjct: 13 CPTCLKKNTWHPTNQFKPFCSDRCKLIDLGEWANETRKIPGSATDSMH 60 >gi|167586036|ref|ZP_02378424.1| hypothetical protein BuboB_11902 [Burkholderia ubonensis Bu] Length = 66 Score = 47.3 bits (111), Expect = 7e-04, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 22/55 (40%), Gaps = 4/55 (7%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 CP C F PFCS +C+ +DL W +Y I +D EE Sbjct: 6 KCPSCGAEVRWTPENRFRPFCSARCKQLDLGAWAAEKYRIGGSDDSPLSEEEDGT 60 >gi|110833471|ref|YP_692330.1| hypothetical protein ABO_0610 [Alcanivorax borkumensis SK2] gi|110646582|emb|CAL16058.1| conserved hypothetical protein [Alcanivorax borkumensis SK2] Length = 66 Score = 47.3 bits (111), Expect = 8e-04, Method: Composition-based stats. Identities = 15/50 (30%), Positives = 24/50 (48%), Gaps = 3/50 (6%) Query: 12 ICPECRKGS---MVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP+C+ + + PFCS +C+ IDL W + I +D + E Sbjct: 15 PCPQCKSLTRWDNNAWRPFCSERCKLIDLGDWATERHAIPGADDAPGDFE 64 >gi|226939595|ref|YP_002794668.1| hypothetical protein LHK_00666 [Laribacter hongkongensis HLHK9] gi|226714521|gb|ACO73659.1| DUF329 domain containing protein [Laribacter hongkongensis HLHK9] Length = 61 Score = 47.3 bits (111), Expect = 8e-04, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 23/54 (42%), Gaps = 4/54 (7%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 CP C + PFCS +C+ IDL +W Y I A + + ++ Sbjct: 7 CPTCGAAVEWGPQSPWRPFCSQRCKLIDLGQWADEGYRIPAEDGQNPPDDPDGA 60 >gi|253988605|ref|YP_003039961.1| zinc-binding protein [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949] gi|253780055|emb|CAQ83216.1| upf0243 zinc-binding protein yacg [Photorhabdus asymbiotica] Length = 65 Score = 47.3 bits (111), Expect = 8e-04, Method: Composition-based stats. Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 4/50 (8%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K + + PFCS +C+ IDL W + E I + + +E Sbjct: 9 CPICSKSVIWGEISPYRPFCSKRCQLIDLGEWANEEKRIPSQSENSDSDE 58 >gi|70732600|ref|YP_262363.1| zinc-binding protein [Pseudomonas fluorescens Pf-5] gi|123652836|sp|Q4K5X0|Y5291_PSEF5 RecName: Full=UPF0243 zinc-binding protein PFL_5291 gi|68346899|gb|AAY94505.1| conserved hypothetical protein [Pseudomonas fluorescens Pf-5] Length = 67 Score = 47.0 bits (110), Expect = 8e-04, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 23/54 (42%), Gaps = 4/54 (7%) Query: 7 RSLKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 + L CP C + PFCS +C+ IDL W E+ I D + E Sbjct: 3 QPLTVECPTCGAPVEWTAANINRPFCSDRCKLIDLGAWAAEEHKIPVSPDAEDE 56 >gi|152968685|ref|YP_001333794.1| zinc-binding protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] gi|238893080|ref|YP_002917814.1| zinc-binding protein [Klebsiella pneumoniae NTUH-K2044] gi|262044856|ref|ZP_06017899.1| conserved hypothetical protein [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884] gi|330011997|ref|ZP_08307214.1| hypothetical protein HMPREF9538_04918 [Klebsiella sp. MS 92-3] gi|166926153|sp|A6T4P3|Y103_KLEP7 RecName: Full=UPF0243 zinc-binding protein KPN78578_01030 gi|150953534|gb|ABR75564.1| zinc-binding protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] gi|238545396|dbj|BAH61747.1| zinc-binding protein [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044] gi|259037825|gb|EEW39053.1| conserved hypothetical protein [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884] gi|328533986|gb|EGF60638.1| hypothetical protein HMPREF9538_04918 [Klebsiella sp. MS 92-3] Length = 64 Score = 47.0 bits (110), Expect = 8e-04, Method: Composition-based stats. Identities = 18/50 (36%), Positives = 23/50 (46%), Gaps = 4/50 (8%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K G F PFCS +C+ IDL W E I + D ++ Sbjct: 9 CPTCGKTVVWGEQSPFRPFCSKRCQLIDLGEWAAEEKRIPSAGDLSDSDD 58 >gi|312958902|ref|ZP_07773421.1| zinc-binding protein [Pseudomonas fluorescens WH6] gi|311286672|gb|EFQ65234.1| zinc-binding protein [Pseudomonas fluorescens WH6] Length = 66 Score = 47.0 bits (110), Expect = 8e-04, Method: Composition-based stats. Identities = 17/60 (28%), Positives = 25/60 (41%), Gaps = 4/60 (6%) Query: 7 RSLKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 + CP C + PFCS +C+ IDL W E+ I D + E +D+ Sbjct: 3 QPSTVDCPTCGAPVEWKATNLNRPFCSDRCKLIDLGAWAAEEHKIPVAPDAEDELFSEDL 62 >gi|206578507|ref|YP_002240428.1| zinc-binding protein YacG [Klebsiella pneumoniae 342] gi|288937128|ref|YP_003441187.1| hypothetical protein Kvar_4278 [Klebsiella variicola At-22] gi|290512551|ref|ZP_06551917.1| zinc-binding protein [Klebsiella sp. 1_1_55] gi|226706233|sp|B5Y1T7|Y4637_KLEP3 RecName: Full=UPF0243 zinc-binding protein KPK_4637 gi|206567565|gb|ACI09341.1| zinc-binding protein YacG [Klebsiella pneumoniae 342] gi|288891837|gb|ADC60155.1| protein of unknown function DUF329 [Klebsiella variicola At-22] gi|289774892|gb|EFD82894.1| zinc-binding protein [Klebsiella sp. 1_1_55] Length = 64 Score = 47.0 bits (110), Expect = 8e-04, Method: Composition-based stats. Identities = 17/50 (34%), Positives = 22/50 (44%), Gaps = 4/50 (8%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K F PFCS +C+ IDL W E I + D ++ Sbjct: 9 CPTCGKNVVWGEQSPFRPFCSKRCQLIDLGEWAAEEKRIPSAGDLSDSDD 58 >gi|149176808|ref|ZP_01855419.1| hypothetical protein PM8797T_15176 [Planctomyces maris DSM 8797] gi|148844449|gb|EDL58801.1| hypothetical protein PM8797T_15176 [Planctomyces maris DSM 8797] Length = 73 Score = 47.0 bits (110), Expect = 8e-04, Method: Composition-based stats. Identities = 18/51 (35%), Positives = 22/51 (43%), Gaps = 6/51 (11%) Query: 3 TSDFRSLKSICPECRK------GSMVEFYPFCSTQCRSIDLSRWLHGEYVI 47 + D CP CRK +PFCS +CR +D RW G Y I Sbjct: 2 SEDPMIQPQTCPICRKVVTFQASDDQSPFPFCSQKCRDVDFFRWSDGRYAI 52 >gi|292493812|ref|YP_003529251.1| hypothetical protein Nhal_3852 [Nitrosococcus halophilus Nc4] gi|291582407|gb|ADE16864.1| protein of unknown function DUF329 [Nitrosococcus halophilus Nc4] Length = 62 Score = 47.0 bits (110), Expect = 8e-04, Method: Composition-based stats. Identities = 18/54 (33%), Positives = 25/54 (46%), Gaps = 4/54 (7%) Query: 4 SDFRSLKSICPECRKGS----MVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDE 53 S+ R CP C + + + PFCS +CR IDLS W + I E + Sbjct: 2 SENRKRHIHCPTCGRETLWSQENPWRPFCSERCRLIDLSAWATETHRIPGEETK 55 >gi|145628182|ref|ZP_01783983.1| zinc-binding protein [Haemophilus influenzae 22.1-21] gi|144979957|gb|EDJ89616.1| zinc-binding protein [Haemophilus influenzae 22.1-21] Length = 68 Score = 47.0 bits (110), Expect = 9e-04, Method: Composition-based stats. Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 4/51 (7%) Query: 12 ICPECRKGS----MVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C+K F PFCS +C+ IDL W E I + + + + Sbjct: 9 PCPICQKSVPWINESTFRPFCSKRCQLIDLGEWAAEEKAIPSDTADFAMDP 59 >gi|157147476|ref|YP_001454795.1| zinc-binding protein [Citrobacter koseri ATCC BAA-895] gi|166229100|sp|A8ALJ6|Y3275_CITK8 RecName: Full=UPF0243 zinc-binding protein CKO_03275 gi|157084681|gb|ABV14359.1| hypothetical protein CKO_03275 [Citrobacter koseri ATCC BAA-895] Length = 64 Score = 47.0 bits (110), Expect = 9e-04, Method: Composition-based stats. Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 4/50 (8%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K G + F PFCS +C+ IDL W E I + D ++ Sbjct: 9 CPTCGKTVVWGEVSPFRPFCSKRCQLIDLGEWAAEEKRIPSSGDLSESDD 58 >gi|24158901|pdb|1LV3|A Chain A, Solution Nmr Structure Of Zinc Finger Protein Yacg From Escherichia Coli. Northeast Structural Genomics Consortium Target Et92 Length = 68 Score = 47.0 bits (110), Expect = 9e-04, Method: Composition-based stats. Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 4/50 (8%) Query: 13 CPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K + F PFCS +C+ IDL W E I + D ++ Sbjct: 12 CPTCGKTVVWGEISPFRPFCSKRCQLIDLGEWAAEEKRIPSSGDLSESDD 61 >gi|317493269|ref|ZP_07951691.1| zinc-binding protein [Enterobacteriaceae bacterium 9_2_54FAA] gi|316918662|gb|EFV39999.1| zinc-binding protein [Enterobacteriaceae bacterium 9_2_54FAA] Length = 65 Score = 47.0 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 15/50 (30%), Positives = 21/50 (42%), Gaps = 4/50 (8%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K + PFC +C+ IDL W E I + D ++ Sbjct: 10 CPICGKSVVWGEQSPYRPFCCKRCQLIDLGEWADEEKRIPSNPDLSESDD 59 >gi|85058437|ref|YP_454139.1| zinc-binding protein [Sodalis glossinidius str. 'morsitans'] gi|123520075|sp|Q2NVU1|Y459_SODGM RecName: Full=UPF0243 zinc-binding protein SG0459 gi|84778957|dbj|BAE73734.1| conserved hypothetical protein [Sodalis glossinidius str. 'morsitans'] Length = 66 Score = 47.0 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 18/54 (33%), Positives = 22/54 (40%), Gaps = 4/54 (7%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP C K F PFCS +C+ IDL W E I + +E D Sbjct: 9 TCPTCGKAVEWSPTSPFRPFCSKRCQLIDLGEWAEEEKRIPSDVQITDSDEWSD 62 >gi|323975735|gb|EGB70831.1| zinc-binding protein [Escherichia coli TW10509] Length = 64 Score = 47.0 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 4/50 (8%) Query: 13 CPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K + F PFCS +C+ IDL W E I + D ++ Sbjct: 9 CPTCGKTVVWGEISPFRPFCSKRCQLIDLGEWAAEEKRIPSSGDLSESDD 58 >gi|254672311|emb|CBA05432.1| conserved hypothetical protein [Neisseria meningitidis alpha275] gi|325143044|gb|EGC65395.1| zinc-binding protein YacG [Neisseria meningitidis 961-5945] gi|325198980|gb|ADY94436.1| zinc-binding protein YacG [Neisseria meningitidis G2136] Length = 69 Score = 47.0 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 4/51 (7%) Query: 1 MQTSDFRSLKSICPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVI 47 M S L+ CP C+ F PFCS +C+ IDL W G+Y + Sbjct: 1 MTESRQTRLQVKCPTCQTTVVWKPENAFRPFCSQRCKLIDLGGWADGKYTV 51 >gi|213857981|ref|ZP_03384952.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Typhi str. M223] Length = 61 Score = 47.0 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 4/50 (8%) Query: 13 CPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K + F PFCS +C+ IDL W E I + D ++ Sbjct: 9 CPTCGKTVVWGEISPFRPFCSKRCQLIDLGEWAAEEKRIPSSGDLSESDD 58 >gi|293392848|ref|ZP_06637166.1| conserved hypothetical protein [Serratia odorifera DSM 4582] gi|291424707|gb|EFE97918.1| conserved hypothetical protein [Serratia odorifera DSM 4582] Length = 65 Score = 47.0 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 4/51 (7%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C KG + + PFCS +C+ IDL W E I + D +E Sbjct: 6 KCPTCGKGVVWGEVSPYRPFCSKRCQLIDLGEWADEEKRIPSNGDLNESDE 56 >gi|322514589|ref|ZP_08067622.1| zinc-binding protein [Actinobacillus ureae ATCC 25976] gi|322119528|gb|EFX91615.1| zinc-binding protein [Actinobacillus ureae ATCC 25976] Length = 62 Score = 47.0 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 4/53 (7%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP C + ++ PFCS +C+ IDL W + E IAAVE++ +++ Sbjct: 8 CPTCHQEVIWKPESKYRPFCSERCQLIDLGEWANEEKRIAAVENDVMTSDLEG 60 >gi|307132573|ref|YP_003884589.1| zinc-binding protein [Dickeya dadantii 3937] gi|306530102|gb|ADN00033.1| zinc-binding protein [Dickeya dadantii 3937] Length = 65 Score = 46.6 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 17/50 (34%), Positives = 22/50 (44%), Gaps = 4/50 (8%) Query: 13 CPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K + PFCS +C+ IDL W E I + ED + Sbjct: 10 CPTCAKPVEWSENSPYRPFCSKRCQLIDLGEWADEEKRIPSEEDVSDSDA 59 >gi|332281211|ref|ZP_08393624.1| zinc-binding protein [Shigella sp. D9] gi|332103563|gb|EGJ06909.1| zinc-binding protein [Shigella sp. D9] Length = 67 Score = 46.6 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 4/50 (8%) Query: 13 CPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K + F PFCS +C+ IDL W E I + D ++ Sbjct: 11 CPTCGKTVVWGEISPFRPFCSKRCQLIDLGEWAAEEKRIPSSGDLSESDD 60 >gi|113460605|ref|YP_718670.1| hypothetical protein HS_0460 [Haemophilus somnus 129PT] gi|170718927|ref|YP_001784096.1| hypothetical protein HSM_0758 [Haemophilus somnus 2336] gi|112822648|gb|ABI24737.1| conserved hypothetical protein [Haemophilus somnus 129PT] gi|168827056|gb|ACA32427.1| protein of unknown function DUF329 [Haemophilus somnus 2336] Length = 64 Score = 46.6 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 17/43 (39%), Positives = 21/43 (48%), Gaps = 4/43 (9%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVE 51 CP C+K F PFCS +C+ IDL W E +I E Sbjct: 10 CPNCKKEVLWSEENRFRPFCSKRCQLIDLGEWATEEKIIPGSE 52 >gi|91786748|ref|YP_547700.1| hypothetical protein Bpro_0846 [Polaromonas sp. JS666] gi|91695973|gb|ABE42802.1| protein of unknown function DUF329 [Polaromonas sp. JS666] Length = 68 Score = 46.6 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 17/61 (27%), Positives = 25/61 (40%), Gaps = 4/61 (6%) Query: 1 MQTSDFRSLKSICPECRKGSMVE----FYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 M + CP C S+ F PFCS +C+++DL W E+ + A E Sbjct: 1 MNEDSRPVKRVACPGCGGESIYAPSNPFRPFCSERCKNLDLGAWASEEFRMPADTPPDDE 60 Query: 57 E 57 Sbjct: 61 N 61 >gi|161870740|ref|YP_001599913.1| hypothetical protein NMCC_1813 [Neisseria meningitidis 053442] gi|189039029|sp|A9M2Z1|Y1813_NEIM0 RecName: Full=UPF0243 zinc-binding protein NMCC_1813 gi|161596293|gb|ABX73953.1| Hypothetical zinc-binding protein [Neisseria meningitidis 053442] Length = 69 Score = 46.6 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 22/65 (33%), Positives = 28/65 (43%), Gaps = 4/65 (6%) Query: 1 MQTSDFRSLKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 M S L+ CP C+ F PFCS +C+ IDL W EY + A E+ E Sbjct: 1 MAESRQTRLQVKCPTCQTAVVWKPENAFRPFCSQRCKLIDLGGWADEEYTVTAQEEGLLE 60 Query: 57 EEVKD 61 D Sbjct: 61 ISEPD 65 >gi|326570838|gb|EGE20862.1| hypothetical protein E9S_03857 [Moraxella catarrhalis BC7] Length = 61 Score = 46.6 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 21/54 (38%), Positives = 25/54 (46%), Gaps = 4/54 (7%) Query: 12 ICPECRKG---SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVE-DEKSEEEVKD 61 CP C+ S PFCS +C+ IDL W EY+IA E EV D Sbjct: 7 PCPLCQAVTTWSDNPNRPFCSKRCKLIDLGAWASDEYLIAGDELPSSEHHEVTD 60 >gi|148828071|ref|YP_001292824.1| zinc-binding protein [Haemophilus influenzae PittGG] gi|166228871|sp|A5UI35|Y8005_HAEIG RecName: Full=UPF0243 zinc-binding protein CGSHiGG_08005 gi|148719313|gb|ABR00441.1| zinc-binding protein [Haemophilus influenzae PittGG] Length = 68 Score = 46.6 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 4/51 (7%) Query: 12 ICPECRKGS----MVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C+K F PFCS +C+ IDL W E I + + + + Sbjct: 9 PCPICQKSVPWINESTFRPFCSKRCQLIDLGEWAAEEKAIPSDTADFAMDP 59 >gi|68249478|ref|YP_248590.1| zinc-binding protein [Haemophilus influenzae 86-028NP] gi|81336095|sp|Q4QM17|Y1056_HAEI8 RecName: Full=UPF0243 zinc-binding protein NTHI1056 gi|68057677|gb|AAX87930.1| conserved hypothetical zinc-binding protein [Haemophilus influenzae 86-028NP] Length = 68 Score = 46.6 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 4/51 (7%) Query: 12 ICPECRKGS----MVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C+K F PFCS +C+ IDL W E I + + + + Sbjct: 9 PCPICQKSVPWINESTFRPFCSKRCQLIDLGEWAAEEKAIPSDTADFAMDP 59 >gi|13878951|sp|P44921|Y891_HAEIN RecName: Full=UPF0243 zinc-binding protein HI_0891 Length = 64 Score = 46.6 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 4/51 (7%) Query: 12 ICPECRKGS----MVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C+K F PFCS +C+ IDL W E I + + + + Sbjct: 5 PCPICQKSVPWINESTFRPFCSKRCQLIDLGEWAAEEKAIPSDTADFAMDP 55 >gi|115350530|ref|YP_772369.1| hypothetical protein Bamb_0476 [Burkholderia ambifaria AMMD] gi|171316222|ref|ZP_02905445.1| protein of unknown function DUF329 [Burkholderia ambifaria MEX-5] gi|115280518|gb|ABI86035.1| protein of unknown function DUF329 [Burkholderia ambifaria AMMD] gi|171098636|gb|EDT43433.1| protein of unknown function DUF329 [Burkholderia ambifaria MEX-5] Length = 66 Score = 46.6 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 22/55 (40%), Gaps = 4/55 (7%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 CP C +F PFCS +C+ +DL W +Y I DE E Sbjct: 6 KCPSCGAEVRWTPENKFRPFCSARCKQLDLGAWAAEKYRIGGSSDEGPSSEEDGT 60 >gi|251788261|ref|YP_003002982.1| hypothetical protein Dd1591_0621 [Dickeya zeae Ech1591] gi|247536882|gb|ACT05503.1| protein of unknown function DUF329 [Dickeya zeae Ech1591] Length = 73 Score = 46.6 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 17/50 (34%), Positives = 22/50 (44%), Gaps = 4/50 (8%) Query: 12 ICPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP C K + PFCS +C+ IDL W E I + ED + Sbjct: 17 KCPTCAKPVEWSEKSPYRPFCSKRCQLIDLGEWADEEKRIPSKEDISDSD 66 >gi|238022897|ref|ZP_04603323.1| hypothetical protein GCWU000324_02818 [Kingella oralis ATCC 51147] gi|237865705|gb|EEP66843.1| hypothetical protein GCWU000324_02818 [Kingella oralis ATCC 51147] Length = 60 Score = 46.6 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 4/49 (8%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 CP C+ ++ PFCS +C+ IDL W ++ I A+ + E Sbjct: 5 KCPTCQTPVAWQPENQYRPFCSQRCKLIDLGAWADEQHAIPALPETPEE 53 >gi|320179662|gb|EFW54611.1| zinc-binding protein [Shigella boydii ATCC 9905] gi|332095391|gb|EGJ00414.1| hypothetical protein SB521682_0101 [Shigella boydii 5216-82] Length = 65 Score = 46.6 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 4/50 (8%) Query: 13 CPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K + F PFCS +C+ IDL W E I + D ++ Sbjct: 9 CPTCGKTVVWGEISPFRPFCSKRCQLIDLGEWAAEEKRIPSNGDLSESDD 58 >gi|260581719|ref|ZP_05849516.1| zinc-binding protein [Haemophilus influenzae NT127] gi|260095312|gb|EEW79203.1| zinc-binding protein [Haemophilus influenzae NT127] Length = 68 Score = 46.6 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 4/51 (7%) Query: 12 ICPECRKGS----MVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C+K F PFCS +C+ IDL W E I + + + + Sbjct: 9 PCPICQKSVPWINESTFRPFCSKRCQLIDLGEWAAEEKAIPSDTADFAMDP 59 >gi|311280920|ref|YP_003943151.1| hypothetical protein Entcl_3626 [Enterobacter cloacae SCF1] gi|308750115|gb|ADO49867.1| protein of unknown function DUF329 [Enterobacter cloacae SCF1] Length = 64 Score = 46.6 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 18/49 (36%), Positives = 22/49 (44%), Gaps = 4/49 (8%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP C K G F PFCS +C+ IDL W E I + D + Sbjct: 9 CPTCGKTVIWGEQSPFRPFCSKRCQLIDLGEWAAEEKRIPSSGDLSDSD 57 >gi|261868726|ref|YP_003256648.1| zinc-binding protein [Aggregatibacter actinomycetemcomitans D11S-1] gi|261414058|gb|ACX83429.1| dephospho-CoA kinase [Aggregatibacter actinomycetemcomitans D11S-1] Length = 70 Score = 46.6 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 15/50 (30%), Positives = 21/50 (42%), Gaps = 4/50 (8%) Query: 12 ICPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP C K + PFCS +C+ IDL W E I + + + Sbjct: 9 PCPICYKTVVWSEQSPYRPFCSKRCQLIDLGEWAAEEKAIPCETADFAAD 58 >gi|32033517|ref|ZP_00133844.1| COG3024: Uncharacterized protein conserved in bacteria [Actinobacillus pleuropneumoniae serovar 1 str. 4074] gi|126208351|ref|YP_001053576.1| putative zinc-binding protein [Actinobacillus pleuropneumoniae L20] gi|165976296|ref|YP_001651889.1| zinc-binding protein [Actinobacillus pleuropneumoniae serovar 3 str. JL03] gi|190150203|ref|YP_001968728.1| zinc-binding protein [Actinobacillus pleuropneumoniae serovar 7 str. AP76] gi|303251265|ref|ZP_07337443.1| zinc-binding protein [Actinobacillus pleuropneumoniae serovar 6 str. Femo] gi|303252873|ref|ZP_07339032.1| zinc-binding protein [Actinobacillus pleuropneumoniae serovar 2 str. 4226] gi|307245739|ref|ZP_07527825.1| hypothetical protein appser1_9420 [Actinobacillus pleuropneumoniae serovar 1 str. 4074] gi|307247863|ref|ZP_07529899.1| hypothetical protein appser2_8520 [Actinobacillus pleuropneumoniae serovar 2 str. S1536] gi|307250115|ref|ZP_07532077.1| hypothetical protein appser4_9030 [Actinobacillus pleuropneumoniae serovar 4 str. M62] gi|307254710|ref|ZP_07536538.1| hypothetical protein appser9_9500 [Actinobacillus pleuropneumoniae serovar 9 str. CVJ13261] gi|307256928|ref|ZP_07538706.1| hypothetical protein appser10_9320 [Actinobacillus pleuropneumoniae serovar 10 str. D13039] gi|307259152|ref|ZP_07540882.1| hypothetical protein appser11_9500 [Actinobacillus pleuropneumoniae serovar 11 str. 56153] gi|307261360|ref|ZP_07543035.1| hypothetical protein appser12_9260 [Actinobacillus pleuropneumoniae serovar 12 str. 1096] gi|307263541|ref|ZP_07545156.1| hypothetical protein appser13_9570 [Actinobacillus pleuropneumoniae serovar 13 str. N273] gi|166228769|sp|A3N0N5|Y875_ACTP2 RecName: Full=UPF0243 zinc-binding protein APL_0875 gi|226696009|sp|B0BPG0|Y887_ACTPJ RecName: Full=UPF0243 zinc-binding protein APJL_0887 gi|226696034|sp|B3H1L4|Y934_ACTP7 RecName: Full=UPF0243 zinc-binding protein APP7_0934 gi|126097143|gb|ABN73971.1| putative zinc-binding protein [Actinobacillus pleuropneumoniae serovar 5b str. L20] gi|165876397|gb|ABY69445.1| zinc-binding protein [Actinobacillus pleuropneumoniae serovar 3 str. JL03] gi|189915334|gb|ACE61586.1| putative zinc-binding protein [Actinobacillus pleuropneumoniae serovar 7 str. AP76] gi|302648303|gb|EFL78500.1| zinc-binding protein [Actinobacillus pleuropneumoniae serovar 2 str. 4226] gi|302649807|gb|EFL79985.1| zinc-binding protein [Actinobacillus pleuropneumoniae serovar 6 str. Femo] gi|306853441|gb|EFM85660.1| hypothetical protein appser1_9420 [Actinobacillus pleuropneumoniae serovar 1 str. 4074] gi|306855665|gb|EFM87832.1| hypothetical protein appser2_8520 [Actinobacillus pleuropneumoniae serovar 2 str. S1536] gi|306857846|gb|EFM89940.1| hypothetical protein appser4_9030 [Actinobacillus pleuropneumoniae serovar 4 str. M62] gi|306862383|gb|EFM94349.1| hypothetical protein appser9_9500 [Actinobacillus pleuropneumoniae serovar 9 str. CVJ13261] gi|306864662|gb|EFM96567.1| hypothetical protein appser10_9320 [Actinobacillus pleuropneumoniae serovar 10 str. D13039] gi|306866819|gb|EFM98677.1| hypothetical protein appser11_9500 [Actinobacillus pleuropneumoniae serovar 11 str. 56153] gi|306869091|gb|EFN00893.1| hypothetical protein appser12_9260 [Actinobacillus pleuropneumoniae serovar 12 str. 1096] gi|306871184|gb|EFN02913.1| hypothetical protein appser13_9570 [Actinobacillus pleuropneumoniae serovar 13 str. N273] Length = 62 Score = 46.6 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 4/53 (7%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP C + ++ PFCS +C+ IDL W + E IAAVE++ +++ Sbjct: 8 CPTCNQDVIWKPESKYRPFCSERCQLIDLGEWANEEKRIAAVENDVMTSDLEG 60 >gi|90408597|ref|ZP_01216752.1| zinc-binding protein [Psychromonas sp. CNPT3] gi|90310289|gb|EAS38419.1| zinc-binding protein [Psychromonas sp. CNPT3] Length = 59 Score = 46.6 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 15/49 (30%), Positives = 23/49 (46%), Gaps = 4/49 (8%) Query: 9 LKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDE 53 ++ CP C+K +F PFC +C+ IDL W + + I E Sbjct: 1 MQVKCPTCKKDVLWVEASKFRPFCCKRCQLIDLGEWANEAHAIKGESTE 49 >gi|156935380|ref|YP_001439296.1| hypothetical protein ESA_03238 [Cronobacter sakazakii ATCC BAA-894] gi|166229091|sp|A7MQ61|Y3238_ENTS8 RecName: Full=UPF0243 zinc-binding protein ESA_03238 gi|156533634|gb|ABU78460.1| hypothetical protein ESA_03238 [Cronobacter sakazakii ATCC BAA-894] Length = 67 Score = 46.6 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 17/49 (34%), Positives = 21/49 (42%), Gaps = 4/49 (8%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP C K F PFCS +C+ IDL W E I + D + Sbjct: 10 CPTCGKEVIWGEKSPFRPFCSKRCQLIDLGEWAAEEKRIPSSGDRSDTD 58 >gi|120555599|ref|YP_959950.1| hypothetical protein Maqu_2688 [Marinobacter aquaeolei VT8] gi|120325448|gb|ABM19763.1| protein of unknown function DUF329 [Marinobacter aquaeolei VT8] Length = 62 Score = 46.2 bits (108), Expect = 0.001, Method: Composition-based stats. Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 4/48 (8%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 CP C+K + PFCS +C+ IDL W + EY + A + Sbjct: 5 CPTCKKSVEWSETNPWRPFCSERCKLIDLGAWANEEYRVPAENASPDD 52 >gi|325577718|ref|ZP_08147993.1| zinc-binding protein [Haemophilus parainfluenzae ATCC 33392] gi|301154757|emb|CBW14220.1| conserved protein [Haemophilus parainfluenzae T3T1] gi|325160463|gb|EGC72589.1| zinc-binding protein [Haemophilus parainfluenzae ATCC 33392] Length = 68 Score = 46.2 bits (108), Expect = 0.001, Method: Composition-based stats. Identities = 16/51 (31%), Positives = 24/51 (47%), Gaps = 4/51 (7%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C+K +F PFCS +C+ IDL W E I + + + + Sbjct: 9 PCPTCQKPVPWTQESQFRPFCSKRCQLIDLGEWAAEEKAIPSDTADFAMDP 59 >gi|170768598|ref|ZP_02903051.1| zinc-binding protein YacG [Escherichia albertii TW07627] gi|170122702|gb|EDS91633.1| zinc-binding protein YacG [Escherichia albertii TW07627] Length = 65 Score = 46.2 bits (108), Expect = 0.001, Method: Composition-based stats. Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 4/50 (8%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K G + F PFCS +C+ IDL W E I + D ++ Sbjct: 9 CPTCGKTVVWGEVSPFRPFCSKRCQLIDLGEWAAEEKRIPSSGDLSESDD 58 >gi|145632265|ref|ZP_01788000.1| zinc-binding protein [Haemophilus influenzae 3655] gi|145634055|ref|ZP_01789766.1| zinc-binding protein [Haemophilus influenzae PittAA] gi|148826463|ref|YP_001291216.1| zinc-binding protein [Haemophilus influenzae PittEE] gi|229845943|ref|ZP_04466055.1| zinc-binding protein [Haemophilus influenzae 7P49H1] gi|319897621|ref|YP_004135818.1| hypothetical protein HIBPF14210 [Haemophilus influenzae F3031] gi|166228856|sp|A5UDI2|Y7570_HAEIE RecName: Full=UPF0243 zinc-binding protein CGSHiEE_07570 gi|144987172|gb|EDJ93702.1| zinc-binding protein [Haemophilus influenzae 3655] gi|145268499|gb|EDK08492.1| zinc-binding protein [Haemophilus influenzae PittAA] gi|148716623|gb|ABQ98833.1| zinc-binding protein [Haemophilus influenzae PittEE] gi|229810947|gb|EEP46664.1| zinc-binding protein [Haemophilus influenzae 7P49H1] gi|309973611|gb|ADO96812.1| zinc-binding protein YacG [Haemophilus influenzae R2846] gi|317433127|emb|CBY81501.1| conserved hypothetical protein [Haemophilus influenzae F3031] Length = 68 Score = 46.2 bits (108), Expect = 0.001, Method: Composition-based stats. Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 4/51 (7%) Query: 12 ICPECRKGS----MVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C+K F PFCS +C+ IDL W E I + + + + Sbjct: 9 PCPICQKSVPWTNESTFRPFCSKRCQLIDLGEWAAEEKAIPSDTADFAMDP 59 >gi|238786733|ref|ZP_04630534.1| hypothetical protein yfred0001_16980 [Yersinia frederiksenii ATCC 33641] gi|238725101|gb|EEQ16740.1| hypothetical protein yfred0001_16980 [Yersinia frederiksenii ATCC 33641] Length = 68 Score = 46.2 bits (108), Expect = 0.001, Method: Composition-based stats. Identities = 17/61 (27%), Positives = 27/61 (44%), Gaps = 4/61 (6%) Query: 5 DFRSLKSICPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK 60 + +K CP C K G + PFC +C+ IDL W E I + ++ +E Sbjct: 2 ETEEIKVNCPTCGKVVVWGEQSPYRPFCCKRCQLIDLGEWADEEKRIPSHGEQSDSDEWG 61 Query: 61 D 61 + Sbjct: 62 E 62 >gi|319795471|ref|YP_004157111.1| hypothetical protein Varpa_4839 [Variovorax paradoxus EPS] gi|315597934|gb|ADU39000.1| protein of unknown function DUF329 [Variovorax paradoxus EPS] Length = 70 Score = 46.2 bits (108), Expect = 0.001, Method: Composition-based stats. Identities = 15/50 (30%), Positives = 23/50 (46%), Gaps = 4/50 (8%) Query: 4 SDFRSLKSICPECRKGSMVE----FYPFCSTQCRSIDLSRWLHGEYVIAA 49 +D CP C S+ + PFCS +C+ +DL W E+ + A Sbjct: 6 NDKGERVVRCPSCGGDSVYAPSNIYRPFCSARCKGVDLGAWASEEFRMPA 55 >gi|259907447|ref|YP_002647803.1| Zinc-binding protein YacG [Erwinia pyrifoliae Ep1/96] gi|224963069|emb|CAX54552.1| Zinc-binding protein YacG [Erwinia pyrifoliae Ep1/96] gi|283477280|emb|CAY73196.1| UPF0243 zinc-binding protein yacG [Erwinia pyrifoliae DSM 12163] gi|310765056|gb|ADP10006.1| Zinc-binding protein YacG [Erwinia sp. Ejp617] Length = 61 Score = 46.2 bits (108), Expect = 0.001, Method: Composition-based stats. Identities = 16/50 (32%), Positives = 23/50 (46%), Gaps = 4/50 (8%) Query: 13 CPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K + + PFCS +C+ IDL W E I + D ++ Sbjct: 9 CPTCGKQVIWDKLSTWRPFCSKRCQLIDLGEWAAEEKRIPSSGDFNDSDD 58 >gi|15799785|ref|NP_285797.1| zinc-binding protein [Escherichia coli O157:H7 EDL933] gi|15829359|ref|NP_308132.1| zinc-binding protein [Escherichia coli O157:H7 str. Sakai] gi|16128094|ref|NP_414643.1| DNA gyrase inhibitor [Escherichia coli str. K-12 substr. MG1655] gi|24111546|ref|NP_706056.1| zinc-binding protein [Shigella flexneri 2a str. 301] gi|30061668|ref|NP_835839.1| zinc-binding protein [Shigella flexneri 2a str. 2457T] gi|74310720|ref|YP_309139.1| zinc-binding protein [Shigella sonnei Ss046] gi|82542705|ref|YP_406652.1| zinc-binding protein [Shigella boydii Sb227] gi|82775508|ref|YP_401855.1| zinc-binding protein [Shigella dysenteriae Sd197] gi|89106983|ref|AP_000763.1| hypothetical protein [Escherichia coli str. K-12 substr. W3110] gi|91209164|ref|YP_539150.1| zinc-binding protein [Escherichia coli UTI89] gi|110640313|ref|YP_668041.1| zinc-binding protein [Escherichia coli 536] gi|110804164|ref|YP_687684.1| zinc-binding protein [Shigella flexneri 5 str. 8401] gi|157155357|ref|YP_001461271.1| zinc-binding protein [Escherichia coli E24377A] gi|157159571|ref|YP_001456889.1| zinc-binding protein [Escherichia coli HS] gi|168752858|ref|ZP_02777880.1| zinc-binding protein YacG [Escherichia coli O157:H7 str. EC4113] gi|168755710|ref|ZP_02780717.1| zinc-binding protein YacG [Escherichia coli O157:H7 str. EC4401] gi|168770432|ref|ZP_02795439.1| zinc-binding protein YacG [Escherichia coli O157:H7 str. EC4486] gi|168776809|ref|ZP_02801816.1| zinc-binding protein YacG [Escherichia coli O157:H7 str. EC4196] gi|168781987|ref|ZP_02806994.1| zinc-binding protein YacG [Escherichia coli O157:H7 str. EC4076] gi|168789629|ref|ZP_02814636.1| zinc-binding protein YacG [Escherichia coli O157:H7 str. EC869] gi|170021544|ref|YP_001726498.1| zinc-binding protein [Escherichia coli ATCC 8739] gi|170079739|ref|YP_001729059.1| zinc-binding protein [Escherichia coli str. K-12 substr. DH10B] gi|170683016|ref|YP_001742222.1| zinc-binding protein [Escherichia coli SMS-3-5] gi|187730244|ref|YP_001878911.1| zinc-binding protein [Shigella boydii CDC 3083-94] gi|188493366|ref|ZP_03000636.1| zinc-binding protein [Escherichia coli 53638] gi|191169647|ref|ZP_03031351.1| zinc-binding protein YacG [Escherichia coli B7A] gi|191174255|ref|ZP_03035765.1| zinc-binding protein YacG [Escherichia coli F11] gi|193063249|ref|ZP_03044340.1| zinc-binding protein YacG [Escherichia coli E22] gi|193071231|ref|ZP_03052152.1| zinc-binding protein YacG [Escherichia coli E110019] gi|194430299|ref|ZP_03062793.1| zinc-binding protein YacG [Escherichia coli B171] gi|195938218|ref|ZP_03083600.1| zinc-binding protein [Escherichia coli O157:H7 str. EC4024] gi|208806134|ref|ZP_03248471.1| zinc-binding protein YacG [Escherichia coli O157:H7 str. EC4206] gi|208813702|ref|ZP_03255031.1| zinc-binding protein YacG [Escherichia coli O157:H7 str. EC4045] gi|208819732|ref|ZP_03260052.1| zinc-binding protein YacG [Escherichia coli O157:H7 str. EC4042] gi|209400277|ref|YP_002268708.1| zinc-binding protein YacG [Escherichia coli O157:H7 str. EC4115] gi|209917293|ref|YP_002291377.1| zinc-binding protein [Escherichia coli SE11] gi|215485266|ref|YP_002327697.1| zinc-binding protein [Escherichia coli O127:H6 str. E2348/69] gi|217326198|ref|ZP_03442282.1| zinc-binding protein YacG [Escherichia coli O157:H7 str. TW14588] gi|218557040|ref|YP_002389953.1| zinc-binding protein [Escherichia coli S88] gi|237704249|ref|ZP_04534730.1| zinc-binding protein yacG [Escherichia sp. 3_2_53FAA] gi|238899501|ref|YP_002925297.1| hypothetical protein BWG_0095 [Escherichia coli BW2952] gi|253774870|ref|YP_003037701.1| zinc-binding protein [Escherichia coli 'BL21-Gold(DE3)pLysS AG'] gi|254037516|ref|ZP_04871593.1| zinc-binding protein [Escherichia sp. 1_1_43] gi|254160222|ref|YP_003043330.1| zinc-binding protein [Escherichia coli B str. REL606] gi|254791237|ref|YP_003076074.1| zinc-binding protein [Escherichia coli O157:H7 str. TW14359] gi|256020062|ref|ZP_05433927.1| zinc-binding protein [Shigella sp. D9] gi|256025414|ref|ZP_05439279.1| zinc-binding protein [Escherichia sp. 4_1_40B] gi|260842336|ref|YP_003220114.1| hypothetical protein ECO103_0102 [Escherichia coli O103:H2 str. 12009] gi|260853314|ref|YP_003227205.1| hypothetical protein ECO26_0104 [Escherichia coli O26:H11 str. 11368] gi|260866253|ref|YP_003232655.1| hypothetical protein ECO111_0103 [Escherichia coli O111:H- str. 11128] gi|261226857|ref|ZP_05941138.1| zinc-binding protein [Escherichia coli O157:H7 str. FRIK2000] gi|261255261|ref|ZP_05947794.1| hypothetical protein EscherichiacoliO157EcO_05469 [Escherichia coli O157:H7 str. FRIK966] gi|291280926|ref|YP_003497744.1| hypothetical protein G2583_0105 [Escherichia coli O55:H7 str. CB9615] gi|293403172|ref|ZP_06647269.1| zinc-binding protein [Escherichia coli FVEC1412] gi|293408192|ref|ZP_06652032.1| conserved hypothetical protein [Escherichia coli B354] gi|293417976|ref|ZP_06660598.1| zinc-binding protein [Escherichia coli B185] gi|293476761|ref|ZP_06665169.1| hypothetical protein ECCG_03084 [Escherichia coli B088] gi|297517770|ref|ZP_06936156.1| zinc-binding protein [Escherichia coli OP50] gi|298378704|ref|ZP_06988588.1| zinc-binding protein [Escherichia coli FVEC1302] gi|300816138|ref|ZP_07096361.1| conserved hypothetical protein [Escherichia coli MS 107-1] gi|300821895|ref|ZP_07102039.1| conserved hypothetical protein [Escherichia coli MS 119-7] gi|300900869|ref|ZP_07119006.1| conserved hypothetical protein [Escherichia coli MS 198-1] gi|300905510|ref|ZP_07123274.1| hypothetical protein HMPREF9536_03528 [Escherichia coli MS 84-1] gi|300919656|ref|ZP_07136147.1| conserved hypothetical protein [Escherichia coli MS 115-1] gi|300923117|ref|ZP_07139177.1| hypothetical protein HMPREF9548_01326 [Escherichia coli MS 182-1] gi|300931773|ref|ZP_07147073.1| conserved hypothetical protein [Escherichia coli MS 187-1] gi|300938495|ref|ZP_07153235.1| conserved hypothetical protein [Escherichia coli MS 21-1] gi|300949880|ref|ZP_07163844.1| conserved hypothetical protein [Escherichia coli MS 116-1] gi|300955966|ref|ZP_07168299.1| hypothetical protein HMPREF9547_01822 [Escherichia coli MS 175-1] gi|300984522|ref|ZP_07177014.1| hypothetical protein HMPREF9553_02720 [Escherichia coli MS 200-1] gi|301026091|ref|ZP_07189566.1| conserved hypothetical protein [Escherichia coli MS 69-1] gi|301028583|ref|ZP_07191813.1| conserved hypothetical protein [Escherichia coli MS 196-1] gi|301303798|ref|ZP_07209918.1| hypothetical protein HMPREF9347_02400 [Escherichia coli MS 124-1] gi|301330118|ref|ZP_07222787.1| conserved hypothetical protein [Escherichia coli MS 78-1] gi|301646414|ref|ZP_07246296.1| conserved hypothetical protein [Escherichia coli MS 146-1] gi|306815302|ref|ZP_07449451.1| zinc-binding protein [Escherichia coli NC101] gi|307136701|ref|ZP_07496057.1| zinc-binding protein [Escherichia coli H736] gi|307311449|ref|ZP_07591091.1| protein of unknown function DUF329 [Escherichia coli W] gi|309796090|ref|ZP_07690502.1| conserved hypothetical protein [Escherichia coli MS 145-7] gi|312966229|ref|ZP_07780455.1| conserved hypothetical protein [Escherichia coli 2362-75] gi|312970195|ref|ZP_07784377.1| conserved hypothetical protein [Escherichia coli 1827-70] gi|331640553|ref|ZP_08341701.1| putative cytoplasmic protein [Escherichia coli H736] gi|331645211|ref|ZP_08346322.1| putative cytoplasmic protein [Escherichia coli M605] gi|331650998|ref|ZP_08352026.1| putative cytoplasmic protein [Escherichia coli M718] gi|331661146|ref|ZP_08362078.1| putative cytoplasmic protein [Escherichia coli TA206] gi|331661474|ref|ZP_08362398.1| putative cytoplasmic protein [Escherichia coli TA143] gi|331666337|ref|ZP_08367218.1| putative cytoplasmic protein [Escherichia coli TA271] gi|331671617|ref|ZP_08372415.1| putative cytoplasmic protein [Escherichia coli TA280] gi|331680674|ref|ZP_08381333.1| putative cytoplasmic protein [Escherichia coli H591] gi|331681485|ref|ZP_08382122.1| putative cytoplasmic protein [Escherichia coli H299] gi|67476023|sp|P0A8H8|YACG_ECOLI RecName: Full=UPF0243 zinc-binding protein yacG gi|67476024|sp|P0A8H9|YACG_ECO57 RecName: Full=UPF0243 zinc-binding protein yacG gi|67476025|sp|P0A8I0|YACG_SHIFL RecName: Full=UPF0243 zinc-binding protein yacG gi|122425013|sp|Q1RG95|YACG_ECOUT RecName: Full=UPF0243 zinc-binding protein yacG gi|123049507|sp|Q0TLN9|YACG_ECOL5 RecName: Full=UPF0243 zinc-binding protein yacG gi|123147288|sp|Q0T897|YACG_SHIF8 RecName: Full=UPF0243 zinc-binding protein yacG gi|123560580|sp|Q326D4|YACG_SHIBS RecName: Full=UPF0243 zinc-binding protein yacG gi|123563512|sp|Q32JZ1|YACG_SHIDS RecName: Full=UPF0243 zinc-binding protein yacG gi|123618072|sp|Q3Z5Q8|YACG_SHISS RecName: Full=UPF0243 zinc-binding protein yacG gi|166919041|sp|A7ZHJ2|YACG_ECO24 RecName: Full=UPF0243 zinc-binding protein yacG gi|166919042|sp|A7ZW52|YACG_ECOHS RecName: Full=UPF0243 zinc-binding protein yacG gi|189040672|sp|B1IR78|YACG_ECOLC RecName: Full=UPF0243 zinc-binding protein yacG gi|226708835|sp|B7MAM3|YACG_ECO45 RecName: Full=UPF0243 zinc-binding protein yacG gi|226708836|sp|B5YZD6|YACG_ECO5E RecName: Full=UPF0243 zinc-binding protein yacG gi|226708837|sp|B1XC77|YACG_ECODH RecName: Full=UPF0243 zinc-binding protein yacG gi|226708838|sp|B6HZ78|YACG_ECOSE RecName: Full=UPF0243 zinc-binding protein yacG gi|226708839|sp|B1LG37|YACG_ECOSM RecName: Full=UPF0243 zinc-binding protein yacG gi|226708849|sp|B2U2A6|YACG_SHIB3 RecName: Full=UPF0243 zinc-binding protein yacG gi|254807327|sp|B7UIF0|YACG_ECO27 RecName: Full=UPF0243 zinc-binding protein yacG gi|259710194|sp|C4ZRJ5|YACG_ECOBW RecName: Full=UPF0243 zinc-binding protein yacG gi|12512807|gb|AAG54405.1|AE005186_11 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933] gi|1786290|gb|AAC73212.1| DNA gyrase inhibitor [Escherichia coli str. K-12 substr. MG1655] gi|13359561|dbj|BAB33528.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai] gi|24050305|gb|AAN41763.1| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301] gi|30039910|gb|AAP15644.1| hypothetical protein S0100 [Shigella flexneri 2a str. 2457T] gi|73854197|gb|AAZ86904.1| conserved hypothetical protein [Shigella sonnei Ss046] gi|81239656|gb|ABB60366.1| conserved hypothetical protein [Shigella dysenteriae Sd197] gi|81244116|gb|ABB64824.1| conserved hypothetical protein [Shigella boydii Sb227] gi|85674326|dbj|BAB96668.2| conserved hypothetical protein [Escherichia coli str. K12 substr. W3110] gi|91070738|gb|ABE05619.1| conserved hypothetical protein [Escherichia coli UTI89] gi|110341905|gb|ABG68142.1| hypothetical protein YacG [Escherichia coli 536] gi|110613712|gb|ABF02379.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401] gi|157065251|gb|ABV04506.1| zinc-binding protein YacG [Escherichia coli HS] gi|157077387|gb|ABV17095.1| zinc-binding protein YacG [Escherichia coli E24377A] gi|169756472|gb|ACA79171.1| protein of unknown function DUF329 [Escherichia coli ATCC 8739] gi|169887574|gb|ACB01281.1| zinc-binding protein [Escherichia coli str. K-12 substr. DH10B] gi|170520734|gb|ACB18912.1| zinc-binding protein YacG [Escherichia coli SMS-3-5] gi|187427236|gb|ACD06510.1| zinc-binding protein YacG [Shigella boydii CDC 3083-94] gi|187767853|gb|EDU31697.1| zinc-binding protein YacG [Escherichia coli O157:H7 str. EC4196] gi|188013500|gb|EDU51622.1| zinc-binding protein YacG [Escherichia coli O157:H7 str. EC4113] gi|188488565|gb|EDU63668.1| zinc-binding protein [Escherichia coli 53638] gi|189000417|gb|EDU69403.1| zinc-binding protein YacG [Escherichia coli O157:H7 str. EC4076] gi|189356980|gb|EDU75399.1| zinc-binding protein YacG [Escherichia coli O157:H7 str. EC4401] gi|189360723|gb|EDU79142.1| zinc-binding protein YacG [Escherichia coli O157:H7 str. EC4486] gi|189370809|gb|EDU89225.1| zinc-binding protein YacG [Escherichia coli O157:H7 str. EC869] gi|190900314|gb|EDV60159.1| zinc-binding protein YacG [Escherichia coli B7A] gi|190905488|gb|EDV65117.1| zinc-binding protein YacG [Escherichia coli F11] gi|192931157|gb|EDV83760.1| zinc-binding protein YacG [Escherichia coli E22] gi|192955441|gb|EDV85923.1| zinc-binding protein YacG [Escherichia coli E110019] gi|194411654|gb|EDX27982.1| zinc-binding protein YacG [Escherichia coli B171] gi|208725935|gb|EDZ75536.1| zinc-binding protein YacG [Escherichia coli O157:H7 str. EC4206] gi|208734979|gb|EDZ83666.1| zinc-binding protein YacG [Escherichia coli O157:H7 str. EC4045] gi|208739855|gb|EDZ87537.1| zinc-binding protein YacG [Escherichia coli O157:H7 str. EC4042] gi|209161677|gb|ACI39110.1| zinc-binding protein YacG [Escherichia coli O157:H7 str. EC4115] gi|209746434|gb|ACI71524.1| hypothetical protein ECs0105 [Escherichia coli] gi|209746436|gb|ACI71525.1| hypothetical protein ECs0105 [Escherichia coli] gi|209746438|gb|ACI71526.1| hypothetical protein ECs0105 [Escherichia coli] gi|209746440|gb|ACI71527.1| hypothetical protein ECs0105 [Escherichia coli] gi|209746442|gb|ACI71528.1| hypothetical protein ECs0105 [Escherichia coli] gi|209910552|dbj|BAG75626.1| conserved hypothetical protein [Escherichia coli SE11] gi|215263338|emb|CAS07653.1| predicted protein [Escherichia coli O127:H6 str. E2348/69] gi|217322419|gb|EEC30843.1| zinc-binding protein YacG [Escherichia coli O157:H7 str. TW14588] gi|218363809|emb|CAR01469.1| conserved hypothetical protein [Escherichia coli S88] gi|222031931|emb|CAP74669.1| UPF0243 zinc-binding protein yacG [Escherichia coli LF82] gi|226840622|gb|EEH72624.1| zinc-binding protein [Escherichia sp. 1_1_43] gi|226902161|gb|EEH88420.1| zinc-binding protein yacG [Escherichia sp. 3_2_53FAA] gi|238860266|gb|ACR62264.1| conserved protein [Escherichia coli BW2952] gi|242375936|emb|CAQ30617.1| DNA gyrase inhibitor YacG [Escherichia coli BL21(DE3)] gi|253325914|gb|ACT30516.1| protein of unknown function DUF329 [Escherichia coli 'BL21-Gold(DE3)pLysS AG'] gi|253972123|gb|ACT37794.1| zinc-binding protein [Escherichia coli B str. REL606] gi|253976332|gb|ACT42002.1| zinc-binding protein [Escherichia coli BL21(DE3)] gi|254590637|gb|ACT69998.1| zinc-binding protein [Escherichia coli O157:H7 str. TW14359] gi|257751963|dbj|BAI23465.1| conserved predicted protein [Escherichia coli O26:H11 str. 11368] gi|257757483|dbj|BAI28980.1| conserved predicted protein [Escherichia coli O103:H2 str. 12009] gi|257762609|dbj|BAI34104.1| conserved predicted protein [Escherichia coli O111:H- str. 11128] gi|260450693|gb|ACX41115.1| protein of unknown function DUF329 [Escherichia coli DH1] gi|281177320|dbj|BAI53650.1| conserved hypothetical protein [Escherichia coli SE15] gi|281599463|gb|ADA72447.1| zinc-binding protein yacG [Shigella flexneri 2002017] gi|290760799|gb|ADD54760.1| Uncharacterized protein conserved in bacteria [Escherichia coli O55:H7 str. CB9615] gi|291321214|gb|EFE60656.1| hypothetical protein ECCG_03084 [Escherichia coli B088] gi|291430087|gb|EFF03101.1| zinc-binding protein [Escherichia coli FVEC1412] gi|291430694|gb|EFF03692.1| zinc-binding protein [Escherichia coli B185] gi|291472443|gb|EFF14925.1| conserved hypothetical protein [Escherichia coli B354] gi|294491402|gb|ADE90158.1| zinc-binding protein YacG [Escherichia coli IHE3034] gi|298281038|gb|EFI22539.1| zinc-binding protein [Escherichia coli FVEC1302] gi|299878394|gb|EFI86605.1| conserved hypothetical protein [Escherichia coli MS 196-1] gi|300306691|gb|EFJ61211.1| hypothetical protein HMPREF9553_02720 [Escherichia coli MS 200-1] gi|300317186|gb|EFJ66970.1| hypothetical protein HMPREF9547_01822 [Escherichia coli MS 175-1] gi|300355633|gb|EFJ71503.1| conserved hypothetical protein [Escherichia coli MS 198-1] gi|300395662|gb|EFJ79200.1| conserved hypothetical protein [Escherichia coli MS 69-1] gi|300402660|gb|EFJ86198.1| hypothetical protein HMPREF9536_03528 [Escherichia coli MS 84-1] gi|300413296|gb|EFJ96606.1| conserved hypothetical protein [Escherichia coli MS 115-1] gi|300420572|gb|EFK03883.1| hypothetical protein HMPREF9548_01326 [Escherichia coli MS 182-1] gi|300450744|gb|EFK14364.1| conserved hypothetical protein [Escherichia coli MS 116-1] gi|300456564|gb|EFK20057.1| conserved hypothetical protein [Escherichia coli MS 21-1] gi|300460433|gb|EFK23926.1| conserved hypothetical protein [Escherichia coli MS 187-1] gi|300525495|gb|EFK46564.1| conserved hypothetical protein [Escherichia coli MS 119-7] gi|300531345|gb|EFK52407.1| conserved hypothetical protein [Escherichia coli MS 107-1] gi|300840925|gb|EFK68685.1| hypothetical protein HMPREF9347_02400 [Escherichia coli MS 124-1] gi|300843865|gb|EFK71625.1| conserved hypothetical protein [Escherichia coli MS 78-1] gi|301075384|gb|EFK90190.1| conserved hypothetical protein [Escherichia coli MS 146-1] gi|305850964|gb|EFM51419.1| zinc-binding protein [Escherichia coli NC101] gi|306908428|gb|EFN38926.1| protein of unknown function DUF329 [Escherichia coli W] gi|307629673|gb|ADN73977.1| zinc-binding protein [Escherichia coli UM146] gi|308120332|gb|EFO57594.1| conserved hypothetical protein [Escherichia coli MS 145-7] gi|310337693|gb|EFQ02804.1| conserved hypothetical protein [Escherichia coli 1827-70] gi|312289472|gb|EFR17366.1| conserved hypothetical protein [Escherichia coli 2362-75] gi|312944706|gb|ADR25533.1| zinc-binding protein [Escherichia coli O83:H1 str. NRG 857C] gi|313646517|gb|EFS10978.1| hypothetical protein SF2457T_5038 [Shigella flexneri 2a str. 2457T] gi|315059323|gb|ADT73650.1| DNA gyrase inhibitor [Escherichia coli W] gi|315134794|dbj|BAJ41953.1| hypothetical protein ECDH1ME8569_0097 [Escherichia coli DH1] gi|315254900|gb|EFU34868.1| conserved domain protein [Escherichia coli MS 85-1] gi|315285154|gb|EFU44599.1| conserved hypothetical protein [Escherichia coli MS 110-3] gi|315299999|gb|EFU59237.1| conserved hypothetical protein [Escherichia coli MS 16-3] gi|315616121|gb|EFU96740.1| conserved hypothetical protein [Escherichia coli 3431] gi|320172809|gb|EFW48041.1| zinc-binding protein [Shigella dysenteriae CDC 74-1112] gi|320183613|gb|EFW58456.1| hypothetical protein SGF_04186 [Shigella flexneri CDC 796-83] gi|320190377|gb|EFW65027.1| zinc-binding protein [Escherichia coli O157:H7 str. EC1212] gi|320200381|gb|EFW74967.1| hypothetical protein ECoL_01943 [Escherichia coli EC4100B] gi|320642139|gb|EFX11490.1| DNA gyrase inhibitor [Escherichia coli O157:H7 str. G5101] gi|320647502|gb|EFX16297.1| DNA gyrase inhibitor [Escherichia coli O157:H- str. 493-89] gi|320652836|gb|EFX21074.1| DNA gyrase inhibitor [Escherichia coli O157:H- str. H 2687] gi|320658225|gb|EFX25954.1| DNA gyrase inhibitor [Escherichia coli O55:H7 str. 3256-97 TW 07815] gi|320663534|gb|EFX30818.1| DNA gyrase inhibitor [Escherichia coli O55:H7 str. USDA 5905] gi|320668846|gb|EFX35641.1| DNA gyrase inhibitor [Escherichia coli O157:H7 str. LSU-61] gi|323157831|gb|EFZ43934.1| hypothetical protein ECEPECA14_0287 [Escherichia coli EPECa14] gi|323160102|gb|EFZ46063.1| hypothetical protein ECE128010_3624 [Escherichia coli E128010] gi|323165983|gb|EFZ51763.1| hypothetical protein SS53G_3696 [Shigella sonnei 53G] gi|323176408|gb|EFZ62000.1| hypothetical protein ECOK1180_5102 [Escherichia coli 1180] gi|323181797|gb|EFZ67210.1| hypothetical protein ECOK1357_4914 [Escherichia coli 1357] gi|323190218|gb|EFZ75494.1| hypothetical protein ECRN5871_1373 [Escherichia coli RN587/1] gi|323380119|gb|ADX52387.1| protein of unknown function DUF329 [Escherichia coli KO11] gi|323935152|gb|EGB31519.1| zinc-binding protein [Escherichia coli E1520] gi|323939860|gb|EGB36060.1| zinc-binding protein [Escherichia coli E482] gi|323945729|gb|EGB41777.1| zinc-binding protein [Escherichia coli H120] gi|323950904|gb|EGB46781.1| zinc-binding protein [Escherichia coli H252] gi|323955298|gb|EGB51071.1| zinc-binding protein [Escherichia coli H263] gi|323960046|gb|EGB55692.1| zinc-binding protein [Escherichia coli H489] gi|323964803|gb|EGB60270.1| zinc-binding protein [Escherichia coli M863] gi|323970772|gb|EGB66026.1| zinc-binding protein [Escherichia coli TA007] gi|324008335|gb|EGB77554.1| hypothetical protein HMPREF9532_01971 [Escherichia coli MS 57-2] gi|324012263|gb|EGB81482.1| hypothetical protein HMPREF9533_03716 [Escherichia coli MS 60-1] gi|324017739|gb|EGB86958.1| hypothetical protein HMPREF9542_03598 [Escherichia coli MS 117-3] gi|324118450|gb|EGC12344.1| zinc-binding protein [Escherichia coli E1167] gi|326345180|gb|EGD68923.1| hypothetical protein ECF_01066 [Escherichia coli O157:H7 str. 1125] gi|326346966|gb|EGD70700.1| zinc-binding protein [Escherichia coli O157:H7 str. 1044] gi|327255079|gb|EGE66682.1| hypothetical protein ECSTEC7V_0107 [Escherichia coli STEC_7v] gi|330909947|gb|EGH38457.1| zinc-binding protein [Escherichia coli AA86] gi|331040299|gb|EGI12506.1| putative cytoplasmic protein [Escherichia coli H736] gi|331045968|gb|EGI18087.1| putative cytoplasmic protein [Escherichia coli M605] gi|331051452|gb|EGI23501.1| putative cytoplasmic protein [Escherichia coli M718] gi|331052188|gb|EGI24227.1| putative cytoplasmic protein [Escherichia coli TA206] gi|331061389|gb|EGI33352.1| putative cytoplasmic protein [Escherichia coli TA143] gi|331066548|gb|EGI38425.1| putative cytoplasmic protein [Escherichia coli TA271] gi|331071462|gb|EGI42819.1| putative cytoplasmic protein [Escherichia coli TA280] gi|331072137|gb|EGI43473.1| putative cytoplasmic protein [Escherichia coli H591] gi|331081706|gb|EGI52867.1| putative cytoplasmic protein [Escherichia coli H299] gi|332098964|gb|EGJ03915.1| hypothetical protein SB359474_0059 [Shigella boydii 3594-74] gi|332341432|gb|AEE54766.1| zinc-binding protein YacG [Escherichia coli UMNK88] gi|332762102|gb|EGJ92371.1| hypothetical protein SF434370_0248 [Shigella flexneri 4343-70] gi|332762281|gb|EGJ92548.1| hypothetical protein SF274771_0094 [Shigella flexneri 2747-71] gi|332768890|gb|EGJ99069.1| hypothetical protein SF293071_0188 [Shigella flexneri 2930-71] gi|333009433|gb|EGK28889.1| hypothetical protein SFK218_0341 [Shigella flexneri K-218] gi|333010596|gb|EGK30029.1| hypothetical protein SFVA6_0392 [Shigella flexneri VA-6] gi|333022427|gb|EGK41665.1| hypothetical protein SFK304_0211 [Shigella flexneri K-304] Length = 65 Score = 46.2 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 4/50 (8%) Query: 13 CPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K + F PFCS +C+ IDL W E I + D ++ Sbjct: 9 CPTCGKTVVWGEISPFRPFCSKRCQLIDLGEWAAEEKRIPSSGDLSESDD 58 >gi|172059562|ref|YP_001807214.1| hypothetical protein BamMC406_0501 [Burkholderia ambifaria MC40-6] gi|171992079|gb|ACB62998.1| protein of unknown function DUF329 [Burkholderia ambifaria MC40-6] Length = 66 Score = 46.2 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 22/55 (40%), Gaps = 4/55 (7%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 CP C +F PFCS +C+ +DL W +Y I DE E Sbjct: 6 KCPSCGAEVRWAPENKFRPFCSARCKQLDLGAWAAEKYRIGGSADEGPSSEEDGT 60 >gi|209519108|ref|ZP_03267914.1| protein of unknown function DUF329 [Burkholderia sp. H160] gi|209500480|gb|EEA00530.1| protein of unknown function DUF329 [Burkholderia sp. H160] Length = 67 Score = 46.2 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 16/43 (37%), Positives = 19/43 (44%), Gaps = 4/43 (9%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAV 50 CP C K F PFCS +C+ IDL W +Y I Sbjct: 6 KCPTCGKDVRWTPESRFRPFCSERCKQIDLGAWAAEKYKIGGN 48 >gi|92114300|ref|YP_574228.1| hypothetical protein Csal_2178 [Chromohalobacter salexigens DSM 3043] gi|91797390|gb|ABE59529.1| protein of unknown function DUF329 [Chromohalobacter salexigens DSM 3043] Length = 76 Score = 46.2 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 25/55 (45%), Gaps = 4/55 (7%) Query: 7 RSLKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 R L+ CP+CR + + PFCS +CR +DL W + IA + Sbjct: 8 RPLEVACPQCRTKVAWTTENPYRPFCSKRCRLLDLGAWADESHRIAGEPAMDEAD 62 >gi|307545302|ref|YP_003897781.1| hypothetical protein HELO_2712 [Halomonas elongata DSM 2581] gi|307217326|emb|CBV42596.1| K09862 hypothetical protein [Halomonas elongata DSM 2581] Length = 77 Score = 46.2 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 25/55 (45%), Gaps = 4/55 (7%) Query: 7 RSLKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 R L+ CP+CRK + PFCS +CR +DL W + IA + Sbjct: 8 RPLEVACPQCRKKVLWSEDNPYRPFCSKRCRLLDLGAWADESHRIAGEPSMDEAD 62 >gi|218547557|ref|YP_002381348.1| zinc-binding protein [Escherichia fergusonii ATCC 35469] gi|226708840|sp|B7LWG6|YACG_ESCF3 RecName: Full=UPF0243 zinc-binding protein yacG gi|218355098|emb|CAQ87705.1| conserved hypothetical protein [Escherichia fergusonii ATCC 35469] gi|324112487|gb|EGC06464.1| zinc-binding protein [Escherichia fergusonii B253] Length = 64 Score = 46.2 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 4/50 (8%) Query: 13 CPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K + F PFCS +C+ IDL W E I + D ++ Sbjct: 9 CPTCGKTVVWGEISPFRPFCSKRCQLIDLGEWAAEEKRIPSSGDLSESDD 58 >gi|332289886|ref|YP_004420738.1| zinc-binding protein [Gallibacterium anatis UMN179] gi|330432782|gb|AEC17841.1| zinc-binding protein [Gallibacterium anatis UMN179] Length = 72 Score = 46.2 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 17/50 (34%), Positives = 21/50 (42%), Gaps = 4/50 (8%) Query: 12 ICPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP C K + PFCS +C+ IDL W E I E + E Sbjct: 15 PCPICHKEVEWSEKSPYRPFCSKRCQLIDLGEWAAEEKKIPTEESPFTTE 64 >gi|261401638|ref|ZP_05987763.1| conserved domain protein [Neisseria lactamica ATCC 23970] gi|296313616|ref|ZP_06863557.1| conserved domain protein [Neisseria polysaccharea ATCC 43768] gi|269208277|gb|EEZ74732.1| conserved domain protein [Neisseria lactamica ATCC 23970] gi|296839854|gb|EFH23792.1| conserved domain protein [Neisseria polysaccharea ATCC 43768] Length = 69 Score = 46.2 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 20/65 (30%), Positives = 28/65 (43%), Gaps = 4/65 (6%) Query: 1 MQTSDFRSLKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 M S L+ CP C+ F PFCS +C+ IDL W G+Y ++ + E Sbjct: 1 MAESRQTRLQVKCPTCQTAVVWKPENAFRPFCSQRCKLIDLGGWADGKYTVSDQTESLPE 60 Query: 57 EEVKD 61 D Sbjct: 61 ISEPD 65 >gi|114564940|ref|YP_752454.1| hypothetical protein Sfri_3788 [Shewanella frigidimarina NCIMB 400] gi|114336233|gb|ABI73615.1| protein of unknown function DUF329 [Shewanella frigidimarina NCIMB 400] Length = 72 Score = 45.8 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 14/41 (34%), Positives = 19/41 (46%), Gaps = 4/41 (9%) Query: 13 CPECRKGSMVE----FYPFCSTQCRSIDLSRWLHGEYVIAA 49 CP C + F PFCS +C+ IDL W ++ I Sbjct: 10 CPICSTKVEWKDESLFKPFCSERCKLIDLGDWASEKHAIPV 50 >gi|90411984|ref|ZP_01219991.1| zinc-binding protein [Photobacterium profundum 3TCK] gi|90326962|gb|EAS43341.1| zinc-binding protein [Photobacterium profundum 3TCK] Length = 71 Score = 45.8 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 15/60 (25%), Positives = 22/60 (36%), Gaps = 4/60 (6%) Query: 2 QTSDFRSLKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 + CP C+K + PFC+ +C+ IDL W E I D + Sbjct: 4 SNTPTTPTIVKCPTCKKEVEWGEQSPYRPFCTKRCQLIDLGEWAEEEKSIPGAPDLSDSD 63 >gi|91794742|ref|YP_564393.1| hypothetical protein Sden_3394 [Shewanella denitrificans OS217] gi|123165730|sp|Q12IQ6|Y3394_SHEDO RecName: Full=UPF0243 zinc-binding protein Sden_3394 gi|91716744|gb|ABE56670.1| protein of unknown function DUF329 [Shewanella denitrificans OS217] Length = 74 Score = 45.8 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 15/44 (34%), Positives = 21/44 (47%), Gaps = 4/44 (9%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVED 52 CP C+ +F PFCS +C+ IDL W ++VI Sbjct: 7 CPICQSSVPWTDDAKFKPFCSERCKLIDLGDWASEKHVIPVKSP 50 >gi|37680968|ref|NP_935577.1| zinc-binding protein [Vibrio vulnificus YJ016] gi|37199718|dbj|BAC95548.1| conserved hypothetical protein [Vibrio vulnificus YJ016] Length = 71 Score = 45.8 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 14/50 (28%), Positives = 18/50 (36%), Gaps = 4/50 (8%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP+C PFCS +C+ ID W E I D + Sbjct: 15 KCPQCGTDVEWGEQSPHRPFCSKKCQMIDFGEWADEENAIPGAPDMSDSD 64 >gi|16273639|ref|NP_439052.1| zinc-binding protein [Haemophilus influenzae Rd KW20] gi|145629970|ref|ZP_01785752.1| zinc-binding protein [Haemophilus influenzae R3021] gi|145636979|ref|ZP_01792643.1| zinc-binding protein [Haemophilus influenzae PittHH] gi|145638289|ref|ZP_01793899.1| zinc-binding protein [Haemophilus influenzae PittII] gi|145641925|ref|ZP_01797499.1| zinc-binding protein [Haemophilus influenzae R3021] gi|229844770|ref|ZP_04464909.1| zinc-binding protein [Haemophilus influenzae 6P18H1] gi|260579982|ref|ZP_05847812.1| zinc-binding protein [Haemophilus influenzae RdAW] gi|1074553|pir||B64161 yacG protein homolog HI0891 - Haemophilus influenzae (strain Rd KW20) gi|144984251|gb|EDJ91674.1| zinc-binding protein [Haemophilus influenzae R3021] gi|145269837|gb|EDK09776.1| zinc-binding protein [Haemophilus influenzae PittHH] gi|145272618|gb|EDK12525.1| zinc-binding protein [Haemophilus influenzae PittII] gi|145273404|gb|EDK13276.1| zinc-binding protein [Haemophilus influenzae 22.4-21] gi|229812484|gb|EEP48174.1| zinc-binding protein [Haemophilus influenzae 6P18H1] gi|260093266|gb|EEW77199.1| zinc-binding protein [Haemophilus influenzae RdAW] gi|309751441|gb|ADO81425.1| zinc-binding protein YacG [Haemophilus influenzae R2866] Length = 68 Score = 45.8 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 4/51 (7%) Query: 12 ICPECRKGS----MVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C+K F PFCS +C+ IDL W E I + + + + Sbjct: 9 PCPICQKSVPWINESTFRPFCSKRCQLIDLGEWAAEEKAIPSDTADFAMDP 59 >gi|254361087|ref|ZP_04977232.1| hypothetical protein MHA_0667 [Mannheimia haemolytica PHL213] gi|261493586|ref|ZP_05990106.1| dephospho-CoA kinase [Mannheimia haemolytica serotype A2 str. BOVINE] gi|261495424|ref|ZP_05991872.1| dephospho-CoA kinase [Mannheimia haemolytica serotype A2 str. OVINE] gi|153092573|gb|EDN73628.1| hypothetical protein MHA_0667 [Mannheimia haemolytica PHL213] gi|261308929|gb|EEY10184.1| dephospho-CoA kinase [Mannheimia haemolytica serotype A2 str. OVINE] gi|261310768|gb|EEY11951.1| dephospho-CoA kinase [Mannheimia haemolytica serotype A2 str. BOVINE] Length = 61 Score = 45.8 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 4/52 (7%) Query: 13 CPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK 60 CP C K + ++ PFCS +C+ IDL W ++ IA+ E E E+++ Sbjct: 8 CPTCEKEVVWSKESKYRPFCSERCQIIDLGDWAAEKHSIASEEAELFSEDLE 59 >gi|160900925|ref|YP_001566507.1| hypothetical protein Daci_5493 [Delftia acidovorans SPH-1] gi|160366509|gb|ABX38122.1| protein of unknown function DUF329 [Delftia acidovorans SPH-1] Length = 87 Score = 45.8 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 16/47 (34%), Positives = 21/47 (44%), Gaps = 4/47 (8%) Query: 13 CPECRKGS----MVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKS 55 CP C S F PFCS +C IDL W + E+ + A + Sbjct: 31 CPTCSGPSLFAPANRFRPFCSERCYQIDLGAWANEEFRVPAPMPPED 77 >gi|326560755|gb|EGE11122.1| hypothetical protein E9K_08989 [Moraxella catarrhalis 103P14B1] gi|326576021|gb|EGE25944.1| hypothetical protein E9W_03635 [Moraxella catarrhalis CO72] Length = 61 Score = 45.8 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 21/54 (38%), Positives = 25/54 (46%), Gaps = 4/54 (7%) Query: 12 ICPECRKG---SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVE-DEKSEEEVKD 61 CP C+ S PFCS +C+ IDL W EY+IA E EV D Sbjct: 7 PCPLCQAVTTWSENPNRPFCSKRCKLIDLGAWASDEYLIAGDELPSPEHHEVTD 60 >gi|301169610|emb|CBW29211.1| conserved protein [Haemophilus influenzae 10810] Length = 68 Score = 45.8 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 16/46 (34%), Positives = 21/46 (45%), Gaps = 4/46 (8%) Query: 12 ICPECRKGS----MVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDE 53 CP C+K F PFCS +C+ IDL W E I + + Sbjct: 9 PCPICQKSVPWINESTFRPFCSKRCQLIDLGEWAAEEKAIPSDTAD 54 >gi|269101769|ref|ZP_06154466.1| zinc-binding protein [Photobacterium damselae subsp. damselae CIP 102761] gi|268161667|gb|EEZ40163.1| zinc-binding protein [Photobacterium damselae subsp. damselae CIP 102761] Length = 69 Score = 45.8 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 16/50 (32%), Positives = 21/50 (42%), Gaps = 4/50 (8%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP C++ F PFCS +C+ IDL W E I D + Sbjct: 13 KCPTCKEDVVWGEQSPFRPFCSKRCQLIDLGEWADEEKAIPGAPDMSDSD 62 >gi|88801099|ref|ZP_01116646.1| hypothetical protein MED297_03497 [Reinekea sp. MED297] gi|88776178|gb|EAR07406.1| hypothetical protein MED297_03497 [Reinekea sp. MED297] Length = 66 Score = 45.8 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 4/51 (7%) Query: 9 LKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKS 55 +K CP C+K +F PFCS +C+ IDL W + I + Sbjct: 1 MKYACPTCQKQITYSKDNKFRPFCSERCKLIDLGEWASENHRIDGKPAAEE 51 >gi|296113413|ref|YP_003627351.1| hypothetical protein MCR_1194 [Moraxella catarrhalis RH4] gi|295921107|gb|ADG61458.1| conserved hypothetical protein [Moraxella catarrhalis RH4] gi|326559257|gb|EGE09688.1| hypothetical protein E9M_09494 [Moraxella catarrhalis 46P47B1] gi|326559896|gb|EGE10296.1| hypothetical protein E9G_07670 [Moraxella catarrhalis 7169] gi|326566594|gb|EGE16737.1| hypothetical protein E9O_01902 [Moraxella catarrhalis 12P80B1] gi|326569619|gb|EGE19671.1| hypothetical protein E9Q_01688 [Moraxella catarrhalis BC1] gi|326570098|gb|EGE20143.1| hypothetical protein E9U_04345 [Moraxella catarrhalis BC8] gi|326574385|gb|EGE24327.1| hypothetical protein E9Y_05437 [Moraxella catarrhalis 101P30B1] Length = 61 Score = 45.8 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 21/54 (38%), Positives = 25/54 (46%), Gaps = 4/54 (7%) Query: 12 ICPECRKG---SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVE-DEKSEEEVKD 61 CP C+ S PFCS +C+ IDL W EY+IA E EV D Sbjct: 7 PCPLCQAVTTWSDNPNRPFCSKRCKLIDLGAWASDEYLIAGDELPSPEHHEVTD 60 >gi|95929554|ref|ZP_01312296.1| protein of unknown function DUF329 [Desulfuromonas acetoxidans DSM 684] gi|95134251|gb|EAT15908.1| protein of unknown function DUF329 [Desulfuromonas acetoxidans DSM 684] Length = 58 Score = 45.8 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 3/52 (5%) Query: 12 ICPECRKGS---MVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK 60 CP+C+K + + PFCS +CR +DL W+ +Y IA +++E Sbjct: 4 PCPQCKKKTPWEDNPWRPFCSERCRLVDLGCWVDEDYRIAGDPAPVTDDESD 55 >gi|333011488|gb|EGK30902.1| hypothetical protein SFK272_0446 [Shigella flexneri K-272] gi|333021732|gb|EGK40981.1| hypothetical protein SFK227_0103 [Shigella flexneri K-227] Length = 65 Score = 45.8 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 17/50 (34%), Positives = 22/50 (44%), Gaps = 4/50 (8%) Query: 13 CPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K + F PFCS +C+ IDL W E I D ++ Sbjct: 9 CPTCGKTVVWGEISPFRPFCSKRCQLIDLGEWAAEEKRIPNSGDLSESDD 58 >gi|326576433|gb|EGE26342.1| hypothetical protein EA1_05737 [Moraxella catarrhalis O35E] Length = 61 Score = 45.8 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 19/48 (39%), Positives = 23/48 (47%), Gaps = 3/48 (6%) Query: 12 ICPECRKG---SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 CP C+ S PFCS +C+ IDL W EY+IA E E Sbjct: 7 PCPLCQAVTTWSDNPNRPFCSKRCKLIDLGAWASDEYLIAGDELPSPE 54 >gi|168705437|ref|ZP_02737714.1| hypothetical protein GobsU_38247 [Gemmata obscuriglobus UQM 2246] Length = 50 Score = 45.8 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 15/37 (40%), Positives = 21/37 (56%) Query: 25 YPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 YPFC+ +CR IDL RWL G+Y + + +D Sbjct: 11 YPFCTARCRKIDLGRWLDGKYRVPDPTSADAPVSSQD 47 >gi|291616282|ref|YP_003519024.1| YacG [Pantoea ananatis LMG 20103] gi|291151312|gb|ADD75896.1| YacG [Pantoea ananatis LMG 20103] gi|327392735|dbj|BAK10157.1| UPF0243 zinc-binding protein YacG [Pantoea ananatis AJ13355] Length = 70 Score = 45.8 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 4/49 (8%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP+C K + + PFCS +C+ IDL W E I + +D + Sbjct: 15 CPQCGKTVIWDELSPWRPFCSKRCQLIDLGEWAAEEKRIPSSDDLNDSD 63 >gi|260220285|emb|CBA27670.1| UPF0243 zinc-binding protein Pfl01_4824 [Curvibacter putative symbiont of Hydra magnipapillata] Length = 65 Score = 45.8 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 12/47 (25%), Positives = 21/47 (44%), Gaps = 4/47 (8%) Query: 13 CPECRKGSMVE----FYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKS 55 CP C S+ + PFCS +C+++DL W + + + Sbjct: 10 CPGCGGDSVFAPSNLYRPFCSDRCKNLDLGAWASEAFRVPTEAPPED 56 >gi|329912561|ref|ZP_08275776.1| zinc-binding protein [Oxalobacteraceae bacterium IMCC9480] gi|327545591|gb|EGF30759.1| zinc-binding protein [Oxalobacteraceae bacterium IMCC9480] Length = 60 Score = 45.4 bits (106), Expect = 0.002, Method: Composition-based stats. Identities = 14/42 (33%), Positives = 19/42 (45%), Gaps = 4/42 (9%) Query: 13 CPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAV 50 CP C ++ PFCS +C+ IDL W +Y I Sbjct: 3 CPTCGTKVEWSEASKYRPFCSERCKQIDLGAWAEEKYTIPGS 44 >gi|227327080|ref|ZP_03831104.1| hypothetical protein PcarcW_07074 [Pectobacterium carotovorum subsp. carotovorum WPP14] Length = 64 Score = 45.4 bits (106), Expect = 0.002, Method: Composition-based stats. Identities = 16/51 (31%), Positives = 24/51 (47%), Gaps = 4/51 (7%) Query: 12 ICPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C++ + + PFCS +C+ IDL W E I + + EE Sbjct: 9 KCPTCKQAVIWEAASIYRPFCSKRCQLIDLGEWADEEKRIPSDDMVSDSEE 59 >gi|260913753|ref|ZP_05920229.1| conserved hypothetical protein [Pasteurella dagmatis ATCC 43325] gi|260632292|gb|EEX50467.1| conserved hypothetical protein [Pasteurella dagmatis ATCC 43325] Length = 67 Score = 45.4 bits (106), Expect = 0.002, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 24/55 (43%), Gaps = 5/55 (9%) Query: 12 ICPECRKGS----MVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDE-KSEEEVKD 61 CP C+K + PFCS +C+ IDL W E I + EE +D Sbjct: 9 PCPICKKAVIWSNESPYRPFCSKRCQLIDLGEWASEEKAIPCETADFAMSEENED 63 >gi|332526515|ref|ZP_08402627.1| hypothetical protein RBXJA2T_11563 [Rubrivivax benzoatilyticus JA2] gi|332110783|gb|EGJ10960.1| hypothetical protein RBXJA2T_11563 [Rubrivivax benzoatilyticus JA2] Length = 66 Score = 45.4 bits (106), Expect = 0.002, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Query: 12 ICPECRKGS----MVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK 60 CP C+ + + PFCS +CRS+DL W Y +AA + E+ Sbjct: 8 PCPACKTPTPYSPQNRWRPFCSERCRSLDLGAWASESYRVAAEAPPDAGEDTP 60 >gi|90020506|ref|YP_526333.1| diguanylate cyclase/phosphodiesterase [Saccharophagus degradans 2-40] gi|89950106|gb|ABD80121.1| protein of unknown function DUF329 [Saccharophagus degradans 2-40] Length = 70 Score = 45.4 bits (106), Expect = 0.002, Method: Composition-based stats. Identities = 16/57 (28%), Positives = 26/57 (45%), Gaps = 4/57 (7%) Query: 5 DFRSLKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 + ++L CP C+K + PFCS +C+ ID W + I E + E+ Sbjct: 2 NVKTLAVACPTCKKQVLMTTDFPNRPFCSKRCQMIDFGDWAEERHAIKGQELTEDED 58 >gi|126665145|ref|ZP_01736128.1| zinc-binding protein [Marinobacter sp. ELB17] gi|126630515|gb|EBA01130.1| zinc-binding protein [Marinobacter sp. ELB17] Length = 65 Score = 45.4 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 19/55 (34%), Positives = 25/55 (45%), Gaps = 4/55 (7%) Query: 13 CPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDIL 63 CP CRK PFCS +C+ IDL W + EY + A + + D L Sbjct: 5 CPTCRKAVEWTDANPERPFCSHRCKLIDLGAWANEEYRVPAQNVSSEDLDQLDQL 59 >gi|313200290|ref|YP_004038948.1| hypothetical protein MPQ_0530 [Methylovorus sp. MP688] gi|312439606|gb|ADQ83712.1| conserved hypothetical protein [Methylovorus sp. MP688] Length = 54 Score = 45.4 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 20/52 (38%), Positives = 24/52 (46%), Gaps = 6/52 (11%) Query: 12 ICPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVI--AAVEDEKSEE 57 CP+C+ S F PFCS +C+ IDL W Y I DE EE Sbjct: 3 TCPQCQAVSEYSVENRFRPFCSERCKLIDLGLWADEGYRIAQPIEPDEFLEE 54 >gi|196228934|ref|ZP_03127800.1| protein of unknown function DUF329 [Chthoniobacter flavus Ellin428] gi|196227215|gb|EDY21719.1| protein of unknown function DUF329 [Chthoniobacter flavus Ellin428] Length = 70 Score = 45.0 bits (105), Expect = 0.003, Method: Composition-based stats. Identities = 14/47 (29%), Positives = 25/47 (53%), Gaps = 3/47 (6%) Query: 7 RSLKSICPECRKGSM---VEFYPFCSTQCRSIDLSRWLHGEYVIAAV 50 + + CP C++ + PFCS +C+ +DL +WL EY ++ Sbjct: 3 KPTRIRCPICQRENDFFAEPVGPFCSNRCKMVDLGKWLGEEYRVSEP 49 >gi|296101264|ref|YP_003611410.1| zinc-binding protein [Enterobacter cloacae subsp. cloacae ATCC 13047] gi|295055723|gb|ADF60461.1| zinc-binding protein [Enterobacter cloacae subsp. cloacae ATCC 13047] Length = 64 Score = 45.0 bits (105), Expect = 0.003, Method: Composition-based stats. Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 4/50 (8%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K G + F PFC +C+ IDL W E I + D ++ Sbjct: 9 CPTCGKTVVWGEVSPFRPFCCKRCQLIDLGEWAAEEKRIPSEGDLSDSDD 58 >gi|295098604|emb|CBK87694.1| Uncharacterized protein conserved in bacteria [Enterobacter cloacae subsp. cloacae NCTC 9394] Length = 64 Score = 45.0 bits (105), Expect = 0.003, Method: Composition-based stats. Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 4/50 (8%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K G + F PFC +C+ IDL W E I + D ++ Sbjct: 9 CPTCGKTVVWGDVSPFRPFCCKRCQLIDLGEWAAEEKRIPSEGDLSDSDD 58 >gi|323171264|gb|EFZ56912.1| hypothetical protein ECLT68_4200 [Escherichia coli LT-68] gi|332764946|gb|EGJ95174.1| hypothetical protein SFK671_0095 [Shigella flexneri K-671] Length = 59 Score = 45.0 bits (105), Expect = 0.003, Method: Composition-based stats. Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 4/50 (8%) Query: 13 CPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K + F PFCS +C+ IDL W E I + D ++ Sbjct: 3 CPTCGKTVVWGEISPFRPFCSKRCQLIDLGEWAAEEKRIPSSGDLSESDD 52 >gi|261250237|ref|ZP_05942813.1| zinc-binding protein [Vibrio orientalis CIP 102891] gi|260939353|gb|EEX95339.1| zinc-binding protein [Vibrio orientalis CIP 102891] Length = 64 Score = 45.0 bits (105), Expect = 0.003, Method: Composition-based stats. Identities = 16/50 (32%), Positives = 20/50 (40%), Gaps = 4/50 (8%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP+C + F PFCS QC+ ID W E I D + Sbjct: 8 PCPQCGQDVQWGEQSPFRPFCSKQCQMIDFGEWADEENTIPGAPDMSDSD 57 >gi|322834408|ref|YP_004214435.1| hypothetical protein Rahaq_3719 [Rahnella sp. Y9602] gi|321169609|gb|ADW75308.1| protein of unknown function DUF329 [Rahnella sp. Y9602] Length = 65 Score = 45.0 bits (105), Expect = 0.003, Method: Composition-based stats. Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 4/58 (6%) Query: 5 DFRSLKSICPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 D ++ CP C+K G + PFCS +C+ IDL W E I + D ++ Sbjct: 2 DPEIIEVNCPTCQKIVVWGEQSPYRPFCSKRCQLIDLGEWADEEKRIPSKGDVNDLDD 59 >gi|254428926|ref|ZP_05042633.1| conserved domain protein [Alcanivorax sp. DG881] gi|196195095|gb|EDX90054.1| conserved domain protein [Alcanivorax sp. DG881] Length = 66 Score = 45.0 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 15/50 (30%), Positives = 24/50 (48%), Gaps = 3/50 (6%) Query: 12 ICPECRKGS---MVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP+C+ + + PFCS +C+ IDL W + I +D + E Sbjct: 15 PCPQCKSLTRWDNNPWRPFCSERCKLIDLGDWATERHAIPGDDDAPGDFE 64 >gi|239817196|ref|YP_002946106.1| hypothetical protein Vapar_4227 [Variovorax paradoxus S110] gi|239803773|gb|ACS20840.1| protein of unknown function DUF329 [Variovorax paradoxus S110] Length = 70 Score = 45.0 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 15/48 (31%), Positives = 21/48 (43%), Gaps = 4/48 (8%) Query: 13 CPECRKGSMVE----FYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 CP C S+ + PFCS +C+ ID W E+ + A E Sbjct: 14 CPSCGGDSVYAERNPYRPFCSARCKGIDFGAWASEEFRMPAEAPADDE 61 >gi|212637459|ref|YP_002313984.1| hypothetical protein swp_4766 [Shewanella piezotolerans WP3] gi|226707600|sp|B8CUS1|Y4766_SHEPW RecName: Full=UPF0243 zinc-binding protein swp_4766 gi|212558943|gb|ACJ31397.1| Conserved hypothetical protein [Shewanella piezotolerans WP3] Length = 78 Score = 45.0 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 16/53 (30%), Positives = 22/53 (41%), Gaps = 4/53 (7%) Query: 8 SLKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 L CP C+ +F PFCS +C+ IDL W + I + E Sbjct: 2 PLTVKCPTCQTEVTWDETSKFKPFCSDRCKLIDLGDWAAEKNAIPVKPEFDPE 54 >gi|88859011|ref|ZP_01133652.1| hypothetical protein PTD2_08404 [Pseudoalteromonas tunicata D2] gi|88819237|gb|EAR29051.1| hypothetical protein PTD2_08404 [Pseudoalteromonas tunicata D2] Length = 79 Score = 45.0 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 7/57 (12%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIA---AVEDEKSEEEVKDI 62 CP C+K + PFCS QC+ IDL W + IA + + + + ++DI Sbjct: 7 CPNCKKQVIWGPDAPYRPFCSKQCQLIDLGEWAAENHKIATQSGNDQKVTPDMIEDI 63 >gi|300722071|ref|YP_003711351.1| hypothetical protein XNC1_1071 [Xenorhabdus nematophila ATCC 19061] gi|297628568|emb|CBJ89142.1| conserved hypothetical protein [Xenorhabdus nematophila ATCC 19061] Length = 65 Score = 44.6 bits (104), Expect = 0.004, Method: Composition-based stats. Identities = 16/58 (27%), Positives = 23/58 (39%), Gaps = 4/58 (6%) Query: 9 LKSICPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 L +CP C + PFCS +C+ IDL W E I + D + + Sbjct: 5 LTVVCPTCGNTVVWGEISPHRPFCSKRCQLIDLGEWASEEKKIPSQSDISENDSWSEA 62 >gi|304396573|ref|ZP_07378454.1| protein of unknown function DUF329 [Pantoea sp. aB] gi|304356082|gb|EFM20448.1| protein of unknown function DUF329 [Pantoea sp. aB] Length = 65 Score = 44.6 bits (104), Expect = 0.004, Method: Composition-based stats. Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Query: 9 LKSICPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 + CP+C K + + PFCS +C+ IDL W E I + +D + Sbjct: 6 MTVSCPQCGKDVIWDELSPWRPFCSKRCQLIDLGEWAAEEKRIPSSDDMNDSD 58 >gi|262190160|ref|ZP_06048442.1| zinc-binding protein [Vibrio cholerae CT 5369-93] gi|262033951|gb|EEY52409.1| zinc-binding protein [Vibrio cholerae CT 5369-93] Length = 81 Score = 44.6 bits (104), Expect = 0.004, Method: Composition-based stats. Identities = 14/44 (31%), Positives = 16/44 (36%), Gaps = 4/44 (9%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVE 51 CP+C PFCS QC+ ID W E I Sbjct: 9 KCPQCGTDVEWGEQSPHRPFCSKQCQMIDFGEWADEEKAIPGAP 52 >gi|52424413|ref|YP_087550.1| zinc-binding protein [Mannheimia succiniciproducens MBEL55E] gi|67461940|sp|Q65VP5|Y358_MANSM RecName: Full=UPF0243 zinc-binding protein MS0358 gi|52306465|gb|AAU36965.1| unknown [Mannheimia succiniciproducens MBEL55E] Length = 72 Score = 44.6 bits (104), Expect = 0.004, Method: Composition-based stats. Identities = 15/50 (30%), Positives = 22/50 (44%), Gaps = 4/50 (8%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C+K + PFCS +C+ IDL W E I + + + Sbjct: 14 CPICKKAVIWSPQSPYRPFCSKRCQLIDLGEWAAEEKAIPCENADFAMDP 63 >gi|317046907|ref|YP_004114555.1| hypothetical protein Pat9b_0674 [Pantoea sp. At-9b] gi|316948524|gb|ADU67999.1| protein of unknown function DUF329 [Pantoea sp. At-9b] Length = 65 Score = 44.6 bits (104), Expect = 0.004, Method: Composition-based stats. Identities = 17/51 (33%), Positives = 23/51 (45%), Gaps = 4/51 (7%) Query: 12 ICPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K M + PFCS +C+ IDL W E I + D ++ Sbjct: 9 PCPNCGKDVMWDELSPWRPFCSKRCQLIDLGEWAAEEKRIPSSGDMTDSDD 59 >gi|238918689|ref|YP_002932203.1| hypothetical protein NT01EI_0747 [Edwardsiella ictaluri 93-146] gi|259647116|sp|C5B9G7|Y747_EDWI9 RecName: Full=UPF0243 zinc-binding protein NT01EI_0747 gi|238868257|gb|ACR67968.1| conserved hypothetical protein [Edwardsiella ictaluri 93-146] Length = 66 Score = 44.6 bits (104), Expect = 0.004, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 24/54 (44%), Gaps = 4/54 (7%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 CP C + PFCS +C+ IDL W + E IA+ EE ++ Sbjct: 10 CPTCGSAVIWGEQSPYRPFCSKRCQLIDLGEWANEEKRIASDATHSDSEEWSEV 63 >gi|329298074|ref|ZP_08255410.1| DNA gyrase inhibitor [Plautia stali symbiont] Length = 65 Score = 44.6 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 4/51 (7%) Query: 12 ICPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K + + PFCS +C+ IDL W E I + D ++ Sbjct: 9 PCPNCGKAVIWDELSPWRPFCSKRCQLIDLGEWAAEEKRIPSSGDMTESDD 59 >gi|253689942|ref|YP_003019132.1| hypothetical protein PC1_3581 [Pectobacterium carotovorum subsp. carotovorum PC1] gi|259647003|sp|C6DET2|Y3581_PECCP RecName: Full=UPF0243 zinc-binding protein PC1_3581 gi|251756520|gb|ACT14596.1| protein of unknown function DUF329 [Pectobacterium carotovorum subsp. carotovorum PC1] Length = 64 Score = 44.6 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 15/51 (29%), Positives = 25/51 (49%), Gaps = 4/51 (7%) Query: 12 ICPECRKGSMVE----FYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C++ + + + PFCS +C+ IDL W E I + + E+ Sbjct: 9 KCPTCKQAVVWDETSIYRPFCSKRCQLIDLGEWADEEKRIPSDDMVSDSED 59 >gi|77163841|ref|YP_342366.1| hypothetical protein Noc_0308 [Nitrosococcus oceani ATCC 19707] gi|254434981|ref|ZP_05048488.1| conserved domain protein [Nitrosococcus oceani AFC27] gi|76882155|gb|ABA56836.1| Protein of unknown function DUF329 [Nitrosococcus oceani ATCC 19707] gi|207088092|gb|EDZ65364.1| conserved domain protein [Nitrosococcus oceani AFC27] Length = 62 Score = 44.6 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 4/44 (9%) Query: 13 CPECRKGS----MVEFYPFCSTQCRSIDLSRWLHGEYVIAAVED 52 CP C + + + PFCS +CR IDLS W + I E+ Sbjct: 11 CPTCGQEALWSEENPWRPFCSERCRLIDLSDWATESHRIPGEEE 54 >gi|261338906|ref|ZP_05966764.1| hypothetical protein ENTCAN_05103 [Enterobacter cancerogenus ATCC 35316] gi|288318730|gb|EFC57668.1| conserved domain protein [Enterobacter cancerogenus ATCC 35316] Length = 64 Score = 44.6 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 16/50 (32%), Positives = 22/50 (44%), Gaps = 4/50 (8%) Query: 13 CPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K + F PFC +C+ IDL W E I + D ++ Sbjct: 9 CPTCGKTVVWGEISPFRPFCCKRCQLIDLGEWAAEEKRIPSEGDLSDSDD 58 >gi|146310310|ref|YP_001175384.1| zinc-binding protein [Enterobacter sp. 638] gi|167016741|sp|A4W6K3|Y646_ENT38 RecName: Full=UPF0243 zinc-binding protein Ent638_0646 gi|145317186|gb|ABP59333.1| protein of unknown function DUF329 [Enterobacter sp. 638] Length = 64 Score = 44.6 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 15/50 (30%), Positives = 21/50 (42%), Gaps = 4/50 (8%) Query: 13 CPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K + F PFC +C+ IDL W E I + ++ Sbjct: 9 CPTCGKAVVWGEISPFRPFCCKRCQLIDLGEWAAEEKRIPSEGGLSDSDD 58 >gi|254786986|ref|YP_003074415.1| hypothetical protein TERTU_3039 [Teredinibacter turnerae T7901] gi|237686679|gb|ACR13943.1| conserved hypothetical protein [Teredinibacter turnerae T7901] Length = 66 Score = 44.3 bits (103), Expect = 0.005, Method: Composition-based stats. Identities = 18/60 (30%), Positives = 25/60 (41%), Gaps = 4/60 (6%) Query: 6 FRSLKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 F++L CP C K + PFCS +C++ID W + VI E D Sbjct: 3 FKTLAVKCPTCDKQVLMTDDFPYRPFCSDRCKTIDFGGWAAEKNVIEGNTLESDAWSEDD 62 >gi|308048080|ref|YP_003911646.1| hypothetical protein Fbal_0358 [Ferrimonas balearica DSM 9799] gi|307630270|gb|ADN74572.1| protein of unknown function DUF329 [Ferrimonas balearica DSM 9799] Length = 74 Score = 44.3 bits (103), Expect = 0.005, Method: Composition-based stats. Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 4/58 (6%) Query: 8 SLKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 +LK CP C+ F PFCS +C+ IDL W + IA + E ++ + Sbjct: 2 TLKVECPTCQAEVSWDEQHPFRPFCSERCKLIDLGEWAEERHAIAGKPELPDEFDISE 59 >gi|300113116|ref|YP_003759691.1| hypothetical protein Nwat_0403 [Nitrosococcus watsonii C-113] gi|299539053|gb|ADJ27370.1| protein of unknown function DUF329 [Nitrosococcus watsonii C-113] Length = 62 Score = 44.3 bits (103), Expect = 0.005, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 4/53 (7%) Query: 4 SDFRSLKSICPECRKGS----MVEFYPFCSTQCRSIDLSRWLHGEYVIAAVED 52 + R CP C + + + PFCS +CR IDLS W + I E+ Sbjct: 2 NKERKRYVNCPTCGRETLWSEENPWRPFCSERCRLIDLSDWAAENHRIPGEEE 54 >gi|87312186|ref|ZP_01094289.1| Hypothetical UPF0243 zinc-binding protein-related protein [Blastopirellula marina DSM 3645] gi|87285111|gb|EAQ77042.1| Hypothetical UPF0243 zinc-binding protein-related protein [Blastopirellula marina DSM 3645] Length = 60 Score = 44.3 bits (103), Expect = 0.006, Method: Composition-based stats. Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Query: 13 CPECRKG--SMVEFYPFCSTQCRSIDLSRWLHGEYVIA 48 CP C K ++ + PFC +CR IDL WL+ + + Sbjct: 3 CPTCEKEFNAVTKAMPFCCERCRQIDLGVWLNEGHSMP 40 >gi|90580237|ref|ZP_01236044.1| zinc-binding protein [Vibrio angustum S14] gi|90438539|gb|EAS63723.1| zinc-binding protein [Vibrio angustum S14] Length = 71 Score = 44.3 bits (103), Expect = 0.006, Method: Composition-based stats. Identities = 15/50 (30%), Positives = 19/50 (38%), Gaps = 4/50 (8%) Query: 12 ICPECRKGS----MVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP C+ F PFC +C+ IDL W E I D + Sbjct: 14 KCPTCKTEVVWGEQSPFRPFCCKRCQLIDLGEWAEEEKSIPGAPDLSDSD 63 >gi|242238112|ref|YP_002986293.1| hypothetical protein Dd703_0660 [Dickeya dadantii Ech703] gi|242130169|gb|ACS84471.1| protein of unknown function DUF329 [Dickeya dadantii Ech703] Length = 65 Score = 44.3 bits (103), Expect = 0.006, Method: Composition-based stats. Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 4/51 (7%) Query: 12 ICPECRKGSMVE----FYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C + + PFCS +C+ IDL W E I + ED ++ Sbjct: 9 KCPTCARAVEWSENSIYRPFCSKRCQLIDLGEWADEEKRIPSNEDVSDSDD 59 >gi|15601954|ref|NP_245026.1| zinc-binding protein [Pasteurella multocida subsp. multocida str. Pm70] gi|12720299|gb|AAK02173.1| unknown [Pasteurella multocida subsp. multocida str. Pm70] Length = 73 Score = 44.3 bits (103), Expect = 0.006, Method: Composition-based stats. Identities = 15/56 (26%), Positives = 23/56 (41%), Gaps = 4/56 (7%) Query: 10 KSICPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP C+K F PFC +C+ IDL W E I + + + ++ Sbjct: 13 SVPCPICQKQVEWSDKSPFRPFCCKRCQLIDLGEWAAEEKAIPCESADFAMNDEQE 68 >gi|262273804|ref|ZP_06051617.1| zinc-binding protein [Grimontia hollisae CIP 101886] gi|262222219|gb|EEY73531.1| zinc-binding protein [Grimontia hollisae CIP 101886] Length = 73 Score = 44.3 bits (103), Expect = 0.006, Method: Composition-based stats. Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 4/50 (8%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP+C + F PFCS +C+ IDL W E IA+ D + Sbjct: 18 KCPQCGLPVVWGDVSPFRPFCSKKCQLIDLGEWADEEKRIASAPDMSDSD 67 >gi|89074161|ref|ZP_01160660.1| zinc-binding protein [Photobacterium sp. SKA34] gi|89050097|gb|EAR55623.1| zinc-binding protein [Photobacterium sp. SKA34] Length = 71 Score = 44.3 bits (103), Expect = 0.006, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 20/54 (37%), Gaps = 4/54 (7%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP C+ F PFC +C+ IDL W E I D + D Sbjct: 14 KCPTCKTDVVWGEQSPFRPFCCKRCQLIDLGEWAEEEKSIPGAPDLSDSDGWSD 67 >gi|56412412|ref|YP_149487.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] gi|197361348|ref|YP_002140983.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601] gi|67461911|sp|Q5PDD8|YACG_SALPA RecName: Full=UPF0243 zinc-binding protein yacG gi|226708847|sp|B5BLD4|YACG_SALPK RecName: Full=UPF0243 zinc-binding protein yacG gi|56126669|gb|AAV76175.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] gi|197092823|emb|CAR58249.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601] Length = 63 Score = 43.9 bits (102), Expect = 0.007, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 20/40 (50%), Gaps = 4/40 (10%) Query: 13 CPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIA 48 CP C K + F PFCS +C+ IDL W E IA Sbjct: 9 CPTCGKPVVWGEISPFRPFCSKRCQLIDLGEWAAEEKRIA 48 >gi|32490941|ref|NP_871195.1| hypothetical protein WGLp192 [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] gi|31563249|sp|Q8D309|Y192_WIGBR RecName: Full=UPF0243 zinc-binding protein WIGBR1920 gi|25166147|dbj|BAC24338.1| yacG [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] Length = 48 Score = 43.9 bits (102), Expect = 0.007, Method: Composition-based stats. Identities = 12/24 (50%), Positives = 19/24 (79%) Query: 24 FYPFCSTQCRSIDLSRWLHGEYVI 47 F+PFCS +C+ IDL +W+ G+Y + Sbjct: 24 FFPFCSKKCKIIDLYQWISGKYKL 47 >gi|16759135|ref|NP_454752.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Typhi str. CT18] gi|16763528|ref|NP_459143.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2] gi|29140685|ref|NP_804027.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] gi|62178707|ref|YP_215124.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] gi|161612483|ref|YP_001586448.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] gi|167990012|ref|ZP_02571112.1| conserved domain protein [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] gi|168230419|ref|ZP_02655477.1| zinc-binding protein YacG [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] gi|168234904|ref|ZP_02659962.1| conserved domain protein [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] gi|168243446|ref|ZP_02668378.1| conserved domain protein [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] gi|168464309|ref|ZP_02698212.1| zinc-binding protein YacG [Salmonella enterica subsp. enterica serovar Newport str. SL317] gi|168820866|ref|ZP_02832866.1| conserved domain protein [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] gi|194444422|ref|YP_002039370.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Newport str. SL254] gi|194448599|ref|YP_002044108.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] gi|194469830|ref|ZP_03075814.1| zinc-binding protein YacG [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] gi|194734113|ref|YP_002113155.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] gi|197248595|ref|YP_002145125.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Agona str. SL483] gi|197262442|ref|ZP_03162516.1| zinc-binding protein YacG [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] gi|198242997|ref|YP_002214091.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] gi|200387032|ref|ZP_03213644.1| zinc-binding protein YacG [Salmonella enterica subsp. enterica serovar Virchow str. SL491] gi|204926779|ref|ZP_03217981.1| conserved domain protein [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] gi|205351479|ref|YP_002225280.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91] gi|207855653|ref|YP_002242304.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109] gi|213023098|ref|ZP_03337545.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Typhi str. 404ty] gi|213161255|ref|ZP_03346965.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Typhi str. E00-7866] gi|213420662|ref|ZP_03353728.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Typhi str. E01-6750] gi|213427397|ref|ZP_03360147.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Typhi str. E02-1180] gi|213585941|ref|ZP_03367767.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Typhi str. E98-0664] gi|213618657|ref|ZP_03372483.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Typhi str. E98-2068] gi|213648258|ref|ZP_03378311.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Typhi str. J185] gi|213857983|ref|ZP_03384954.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Typhi str. M223] gi|224581983|ref|YP_002635781.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594] gi|238911196|ref|ZP_04655033.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Tennessee str. CDC07-0191] gi|289823722|ref|ZP_06543334.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Typhi str. E98-3139] gi|54040052|sp|P67482|YACG_SALTI RecName: Full=UPF0243 zinc-binding protein yacG gi|54042761|sp|P67481|YACG_SALTY RecName: Full=UPF0243 zinc-binding protein yacG gi|75484856|sp|Q57TB8|YACG_SALCH RecName: Full=UPF0243 zinc-binding protein yacG gi|189040674|sp|A9MZN0|YACG_SALPB RecName: Full=UPF0243 zinc-binding protein yacG gi|226708841|sp|B5F7X5|YACG_SALA4 RecName: Full=UPF0243 zinc-binding protein yacG gi|226708842|sp|B5FI83|YACG_SALDC RecName: Full=UPF0243 zinc-binding protein yacG gi|226708843|sp|B5R2N6|YACG_SALEP RecName: Full=UPF0243 zinc-binding protein yacG gi|226708844|sp|B5RH76|YACG_SALG2 RecName: Full=UPF0243 zinc-binding protein yacG gi|226708845|sp|B4TJ97|YACG_SALHS RecName: Full=UPF0243 zinc-binding protein yacG gi|226708846|sp|B4SU60|YACG_SALNS RecName: Full=UPF0243 zinc-binding protein yacG gi|226708848|sp|B4TXI7|YACG_SALSV RecName: Full=UPF0243 zinc-binding protein yacG gi|254807328|sp|C0Q5J8|YACG_SALPC RecName: Full=UPF0243 zinc-binding protein yacG gi|25513271|pir||AI0519 conserved hypothetical protein yacG [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) gi|16418638|gb|AAL19102.1| putative cytoplasmic protein [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2] gi|16501425|emb|CAD01297.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Typhi] gi|29136309|gb|AAO67876.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] gi|62126340|gb|AAX64043.1| putative cytoplasmic protein [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] gi|161361847|gb|ABX65615.1| hypothetical protein SPAB_00173 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] gi|194403085|gb|ACF63307.1| zinc-binding protein YacG [Salmonella enterica subsp. enterica serovar Newport str. SL254] gi|194406903|gb|ACF67122.1| conserved domain protein [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] gi|194456194|gb|EDX45033.1| zinc-binding protein YacG [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] gi|194709615|gb|ACF88836.1| conserved domain protein [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] gi|195632894|gb|EDX51348.1| zinc-binding protein YacG [Salmonella enterica subsp. enterica serovar Newport str. SL317] gi|197212298|gb|ACH49695.1| zinc-binding protein YacG [Salmonella enterica subsp. enterica serovar Agona str. SL483] gi|197240697|gb|EDY23317.1| zinc-binding protein YacG [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] gi|197292056|gb|EDY31406.1| conserved domain protein [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] gi|197937513|gb|ACH74846.1| conserved domain protein [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] gi|199604130|gb|EDZ02675.1| zinc-binding protein YacG [Salmonella enterica subsp. enterica serovar Virchow str. SL491] gi|204323444|gb|EDZ08639.1| conserved domain protein [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] gi|205271260|emb|CAR36048.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91] gi|205331485|gb|EDZ18249.1| conserved domain protein [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] gi|205335201|gb|EDZ21965.1| zinc-binding protein YacG [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] gi|205337530|gb|EDZ24294.1| conserved domain protein [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] gi|205342417|gb|EDZ29181.1| conserved domain protein [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] gi|206707456|emb|CAR31730.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109] gi|224466510|gb|ACN44340.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594] gi|261245371|emb|CBG23160.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Typhimurium str. D23580] gi|267991817|gb|ACY86702.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S] gi|301156766|emb|CBW16241.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344] gi|312911108|dbj|BAJ35082.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Typhimurium str. T000240] gi|320084384|emb|CBY94177.1| UPF0243 zinc-binding protein ESA_03238 [Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1] gi|321222287|gb|EFX47359.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Typhimurium str. TN061786] gi|322615960|gb|EFY12877.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. 315996572] gi|322620744|gb|EFY17604.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. 495297-1] gi|322623904|gb|EFY20741.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. 495297-3] gi|322627352|gb|EFY24143.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. 495297-4] gi|322630659|gb|EFY27423.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. 515920-1] gi|322638121|gb|EFY34822.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. 515920-2] gi|322640607|gb|EFY37258.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. 531954] gi|322647748|gb|EFY44233.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. NC_MB110209-0054] gi|322648097|gb|EFY44564.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. OH_2009072675] gi|322656870|gb|EFY53156.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. CASC_09SCPH15965] gi|322657419|gb|EFY53691.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. 19N] gi|322663738|gb|EFY59938.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. 81038-01] gi|322666571|gb|EFY62749.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. MD_MDA09249507] gi|322672270|gb|EFY68382.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. 414877] gi|322676418|gb|EFY72489.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. 366867] gi|322679489|gb|EFY75534.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. 413180] gi|322686182|gb|EFY82166.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. 446600] gi|322713160|gb|EFZ04731.1| conserved domain protein [Salmonella enterica subsp. enterica serovar Choleraesuis str. A50] gi|323128458|gb|ADX15888.1| conserved domain protein [Salmonella enterica subsp. enterica serovar Typhimurium str. 4/74] gi|323195026|gb|EFZ80212.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. 609458-1] gi|323200065|gb|EFZ85152.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. 556150-1] gi|323201114|gb|EFZ86183.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. 609460] gi|323209511|gb|EFZ94444.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. 507440-20] gi|323212237|gb|EFZ97061.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. 556152] gi|323216542|gb|EGA01268.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. MB101509-0077] gi|323219891|gb|EGA04369.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. MB102109-0047] gi|323225829|gb|EGA10049.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. MB110209-0055] gi|323228629|gb|EGA12758.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. MB111609-0052] gi|323236757|gb|EGA20833.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. 2009083312] gi|323239742|gb|EGA23789.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. 2009085258] gi|323242210|gb|EGA26239.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. 315731156] gi|323249366|gb|EGA33282.1| DNA gyrase inhibitor [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2009159199] gi|323252301|gb|EGA36152.1| DNA gyrase inhibitor [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008282] gi|323256609|gb|EGA40339.1| DNA gyrase inhibitor [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008283] gi|323262978|gb|EGA46528.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008284] gi|323265463|gb|EGA48959.1| DNA gyrase inhibitor [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008285] gi|323271749|gb|EGA55167.1| DNA gyrase inhibitor [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008287] gi|326626506|gb|EGE32849.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Gallinarum str. 9] gi|332987091|gb|AEF06074.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Typhimurium str. UK-1] Length = 63 Score = 43.9 bits (102), Expect = 0.007, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 20/40 (50%), Gaps = 4/40 (10%) Query: 13 CPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIA 48 CP C K + F PFCS +C+ IDL W E IA Sbjct: 9 CPTCGKPVVWGEISPFRPFCSKRCQLIDLGEWAAEEKRIA 48 >gi|289805854|ref|ZP_06536483.1| zinc-binding protein [Salmonella enterica subsp. enterica serovar Typhi str. AG3] Length = 60 Score = 43.9 bits (102), Expect = 0.007, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 20/40 (50%), Gaps = 4/40 (10%) Query: 13 CPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIA 48 CP C K + F PFCS +C+ IDL W E IA Sbjct: 6 CPTCGKPVVWGEISPFRPFCSKRCQLIDLGEWAAEEKRIA 45 >gi|308185671|ref|YP_003929802.1| UPF0243 zinc-binding protein [Pantoea vagans C9-1] gi|308056181|gb|ADO08353.1| UPF0243 zinc-binding protein [Pantoea vagans C9-1] Length = 66 Score = 43.9 bits (102), Expect = 0.007, Method: Composition-based stats. Identities = 16/53 (30%), Positives = 24/53 (45%), Gaps = 4/53 (7%) Query: 9 LKSICPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 + CP+C K + + PFCS +C+ IDL W E I + D + Sbjct: 6 MTVSCPQCGKDVIWDELSPWRPFCSKRCQLIDLGEWAAEEKRIPSSNDMNDSD 58 >gi|188532943|ref|YP_001906740.1| Zinc-binding protein YacG [Erwinia tasmaniensis Et1/99] gi|226708083|sp|B2VD52|Y796_ERWT9 RecName: Full=UPF0243 zinc-binding protein ETA_07960 gi|188027985|emb|CAO95842.1| Zinc-binding protein YacG [Erwinia tasmaniensis Et1/99] Length = 67 Score = 43.9 bits (102), Expect = 0.007, Method: Composition-based stats. Identities = 16/50 (32%), Positives = 23/50 (46%), Gaps = 4/50 (8%) Query: 13 CPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K + + PFCS +C+ IDL W E I + D ++ Sbjct: 9 CPTCNKQVIWDELSTWRPFCSKRCQLIDLGEWAAEEKRIPSSGDLNDSDD 58 >gi|241763812|ref|ZP_04761858.1| protein of unknown function DUF329 [Acidovorax delafieldii 2AN] gi|241366944|gb|EER61349.1| protein of unknown function DUF329 [Acidovorax delafieldii 2AN] Length = 73 Score = 43.9 bits (102), Expect = 0.007, Method: Composition-based stats. Identities = 13/47 (27%), Positives = 19/47 (40%), Gaps = 4/47 (8%) Query: 13 CPECRKGS----MVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKS 55 CP C S F PFCS +C+ +DL W ++ + Sbjct: 17 CPHCGGDSIYGPQNPFRPFCSERCKQLDLGAWASEDFRMPTEAPPDD 63 >gi|238752442|ref|ZP_04613919.1| hypothetical protein yrohd0001_5040 [Yersinia rohdei ATCC 43380] gi|238709375|gb|EEQ01616.1| hypothetical protein yrohd0001_5040 [Yersinia rohdei ATCC 43380] Length = 67 Score = 43.9 bits (102), Expect = 0.007, Method: Composition-based stats. Identities = 16/50 (32%), Positives = 22/50 (44%), Gaps = 4/50 (8%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K G + PFC +C+ IDL W E I + + +E Sbjct: 10 CPTCGKVVIWGEQSPYRPFCCKRCQLIDLGEWADEEKRIPSSGELSDSDE 59 >gi|221133813|ref|ZP_03560118.1| hypothetical protein GHTCC_02704 [Glaciecola sp. HTCC2999] Length = 75 Score = 43.9 bits (102), Expect = 0.007, Method: Composition-based stats. Identities = 19/55 (34%), Positives = 23/55 (41%), Gaps = 5/55 (9%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIA-AVEDEKSEEEVKDI 62 CP C+K S F PFC +C+ IDL W E I E+ DI Sbjct: 5 CPTCKKPVNWVSTNIFRPFCCKKCQLIDLGEWADEEKAIPCGSSHNTQPAELPDI 59 >gi|254291775|ref|ZP_04962560.1| conserved hypothetical protein [Vibrio cholerae AM-19226] gi|150422287|gb|EDN14249.1| conserved hypothetical protein [Vibrio cholerae AM-19226] Length = 65 Score = 43.9 bits (102), Expect = 0.007, Method: Composition-based stats. Identities = 15/50 (30%), Positives = 18/50 (36%), Gaps = 4/50 (8%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP+C PFCS QC+ ID W E I D + Sbjct: 9 KCPQCGTDVEWGEQSPHRPFCSKQCQMIDFGEWADEEKAIPGAPDMSDSD 58 >gi|326423857|ref|NP_760511.2| hypothetical protein VV1_1619 [Vibrio vulnificus CMCP6] gi|31563251|sp|Q8DC30|Y1619_VIBVU RecName: Full=UPF0243 zinc-binding protein VV1_1619 gi|319999229|gb|AAO10038.2| Hypothetical UPF0243 zinc-binding protein VP2529 [Vibrio vulnificus CMCP6] Length = 64 Score = 43.9 bits (102), Expect = 0.008, Method: Composition-based stats. Identities = 14/50 (28%), Positives = 18/50 (36%), Gaps = 4/50 (8%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP+C PFCS +C+ ID W E I D + Sbjct: 8 KCPQCGTNVEWGEQSPHRPFCSKKCQMIDFGEWADEENAIPGAPDMSDSD 57 >gi|312883950|ref|ZP_07743667.1| zinc-binding protein [Vibrio caribbenthicus ATCC BAA-2122] gi|309368408|gb|EFP95943.1| zinc-binding protein [Vibrio caribbenthicus ATCC BAA-2122] Length = 64 Score = 43.9 bits (102), Expect = 0.008, Method: Composition-based stats. Identities = 17/51 (33%), Positives = 22/51 (43%), Gaps = 4/51 (7%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP+C K + PFCS QC+ ID W E+ IA D + Sbjct: 8 PCPQCNKDVIWGEQSPYRPFCSKQCQMIDFGDWADEEHSIAGAPDMSDGDA 58 >gi|283783887|ref|YP_003363752.1| hypothetical protein ROD_01061 [Citrobacter rodentium ICC168] gi|282947341|emb|CBG86886.1| conserved hypothetical protein [Citrobacter rodentium ICC168] Length = 64 Score = 43.9 bits (102), Expect = 0.008, Method: Composition-based stats. Identities = 16/40 (40%), Positives = 19/40 (47%), Gaps = 4/40 (10%) Query: 13 CPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIA 48 CP C K + F PFCS +C+ IDL W E I Sbjct: 9 CPTCGKTVVWGEISPFRPFCSKRCQLIDLGEWAAEEKRIP 48 >gi|260771246|ref|ZP_05880173.1| hypothetical protein VFA_004311 [Vibrio furnissii CIP 102972] gi|260613843|gb|EEX39035.1| hypothetical protein VFA_004311 [Vibrio furnissii CIP 102972] gi|315179148|gb|ADT86062.1| zinc-binding protein [Vibrio furnissii NCTC 11218] Length = 65 Score = 43.9 bits (102), Expect = 0.008, Method: Composition-based stats. Identities = 15/50 (30%), Positives = 19/50 (38%), Gaps = 4/50 (8%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP C +G PFCS +C+ ID W E I D + Sbjct: 9 KCPTCGQGVEWGEQSPHRPFCSKKCQMIDFGEWADEEKSIPGAPDMSDSD 58 >gi|47117408|sp|Q7MHT4|Y2784_VIBVY RecName: Full=UPF0243 zinc-binding protein VV2784 Length = 64 Score = 43.9 bits (102), Expect = 0.008, Method: Composition-based stats. Identities = 14/50 (28%), Positives = 18/50 (36%), Gaps = 4/50 (8%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP+C PFCS +C+ ID W E I D + Sbjct: 8 KCPQCGTDVEWGEQSPHRPFCSKKCQMIDFGEWADEENAIPGAPDMSDSD 57 >gi|227113975|ref|ZP_03827631.1| hypothetical protein PcarbP_13464 [Pectobacterium carotovorum subsp. brasiliensis PBR1692] Length = 64 Score = 43.9 bits (102), Expect = 0.008, Method: Composition-based stats. Identities = 15/51 (29%), Positives = 25/51 (49%), Gaps = 4/51 (7%) Query: 12 ICPECRKGSMVE----FYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C++ + + + PFCS +C+ IDL W E I + + E+ Sbjct: 9 KCPTCKQAVIWDETSIYRPFCSKRCQLIDLGEWADEEKRIPSDDMVSDSED 59 >gi|161504734|ref|YP_001571846.1| zinc-binding protein [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980] gi|189040673|sp|A9MQA6|YACG_SALAR RecName: Full=UPF0243 zinc-binding protein yacG gi|160866081|gb|ABX22704.1| hypothetical protein SARI_02857 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] Length = 63 Score = 43.9 bits (102), Expect = 0.008, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 20/40 (50%), Gaps = 4/40 (10%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIA 48 CP C K + F PFCS +C+ IDL W E IA Sbjct: 9 CPTCGKPVVWGEVSPFRPFCSKRCQLIDLGEWAAEEKRIA 48 >gi|261211525|ref|ZP_05925813.1| zinc-binding protein [Vibrio sp. RC341] gi|260839480|gb|EEX66106.1| zinc-binding protein [Vibrio sp. RC341] Length = 65 Score = 43.9 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 15/50 (30%), Positives = 18/50 (36%), Gaps = 4/50 (8%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP+C PFCS QC+ ID W E I D + Sbjct: 9 KCPQCGTDVEWGEQSPHRPFCSKQCQMIDFGEWAEEEKAIPGAPDMSDSD 58 >gi|147673953|ref|YP_001217930.1| zinc-binding protein [Vibrio cholerae O395] gi|153214087|ref|ZP_01949221.1| conserved hypothetical protein [Vibrio cholerae 1587] gi|153802790|ref|ZP_01957376.1| conserved hypothetical protein [Vibrio cholerae MZO-3] gi|153827236|ref|ZP_01979903.1| conserved hypothetical protein [Vibrio cholerae MZO-2] gi|153830650|ref|ZP_01983317.1| conserved hypothetical protein [Vibrio cholerae 623-39] gi|229514055|ref|ZP_04403517.1| hypothetical protein VCB_001702 [Vibrio cholerae TMA 21] gi|229521257|ref|ZP_04410677.1| hypothetical protein VIF_001783 [Vibrio cholerae TM 11079-80] gi|229524414|ref|ZP_04413819.1| hypothetical protein VCA_002006 [Vibrio cholerae bv. albensis VL426] gi|229527035|ref|ZP_04416430.1| hypothetical protein VCG_000101 [Vibrio cholerae 12129(1)] gi|258625149|ref|ZP_05720066.1| conserved hypothetical protein [Vibrio mimicus VM603] gi|262168409|ref|ZP_06036106.1| zinc-binding protein [Vibrio cholerae RC27] gi|262170625|ref|ZP_06038303.1| hypothetical protein VII_001436 [Vibrio mimicus MB-451] gi|262404741|ref|ZP_06081296.1| zinc-binding protein [Vibrio sp. RC586] gi|297581053|ref|ZP_06942978.1| conserved hypothetical protein [Vibrio cholerae RC385] gi|124115513|gb|EAY34333.1| conserved hypothetical protein [Vibrio cholerae 1587] gi|124121655|gb|EAY40398.1| conserved hypothetical protein [Vibrio cholerae MZO-3] gi|146315836|gb|ABQ20375.1| conserved hypothetical protein [Vibrio cholerae O395] gi|148873859|gb|EDL71994.1| conserved hypothetical protein [Vibrio cholerae 623-39] gi|149738850|gb|EDM53186.1| conserved hypothetical protein [Vibrio cholerae MZO-2] gi|227014321|gb|ACP10531.1| conserved hypothetical protein [Vibrio cholerae O395] gi|229335432|gb|EEO00914.1| hypothetical protein VCG_000101 [Vibrio cholerae 12129(1)] gi|229337995|gb|EEO03012.1| hypothetical protein VCA_002006 [Vibrio cholerae bv. albensis VL426] gi|229341789|gb|EEO06791.1| hypothetical protein VIF_001783 [Vibrio cholerae TM 11079-80] gi|229349236|gb|EEO14193.1| hypothetical protein VCB_001702 [Vibrio cholerae TMA 21] gi|258582600|gb|EEW07432.1| conserved hypothetical protein [Vibrio mimicus VM603] gi|261891701|gb|EEY37687.1| hypothetical protein VII_001436 [Vibrio mimicus MB-451] gi|262023301|gb|EEY42005.1| zinc-binding protein [Vibrio cholerae RC27] gi|262349773|gb|EEY98911.1| zinc-binding protein [Vibrio sp. RC586] gi|297534879|gb|EFH73715.1| conserved hypothetical protein [Vibrio cholerae RC385] Length = 65 Score = 43.5 bits (101), Expect = 0.009, Method: Composition-based stats. Identities = 15/50 (30%), Positives = 18/50 (36%), Gaps = 4/50 (8%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP+C PFCS QC+ ID W E I D + Sbjct: 9 KCPQCGTDVEWGEQSPHRPFCSKQCQMIDFGEWADEEKAIPGAPDMSDSD 58 >gi|121729931|ref|ZP_01682353.1| conserved hypothetical protein [Vibrio cholerae V52] gi|121628319|gb|EAX60826.1| conserved hypothetical protein [Vibrio cholerae V52] Length = 65 Score = 43.5 bits (101), Expect = 0.010, Method: Composition-based stats. Identities = 15/50 (30%), Positives = 18/50 (36%), Gaps = 4/50 (8%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP+C PFCS QC+ ID W E I D + Sbjct: 9 KCPQCGTDVEWGEQSPHRPFCSKQCQMIDFGEWADEEKAIPGAPDMSDSD 58 >gi|22124668|ref|NP_668091.1| zinc-binding protein [Yersinia pestis KIM 10] gi|45440112|ref|NP_991651.1| zinc-binding protein [Yersinia pestis biovar Microtus str. 91001] gi|51595050|ref|YP_069241.1| zinc-binding protein [Yersinia pseudotuberculosis IP 32953] gi|108808924|ref|YP_652840.1| zinc-binding protein [Yersinia pestis Antiqua] gi|108810822|ref|YP_646589.1| zinc-binding protein [Yersinia pestis Nepal516] gi|145600182|ref|YP_001164258.1| zinc-binding protein [Yersinia pestis Pestoides F] gi|153948111|ref|YP_001402333.1| zinc-binding protein [Yersinia pseudotuberculosis IP 31758] gi|153997525|ref|ZP_02022625.1| hypothetical protein YPE_3984 [Yersinia pestis CA88-4125] gi|162421359|ref|YP_001605607.1| zinc-binding protein [Yersinia pestis Angola] gi|165925857|ref|ZP_02221689.1| zinc-binding protein YacG [Yersinia pestis biovar Orientalis str. F1991016] gi|165936643|ref|ZP_02225210.1| zinc-binding protein YacG [Yersinia pestis biovar Orientalis str. IP275] gi|166010002|ref|ZP_02230900.1| zinc-binding protein YacG [Yersinia pestis biovar Antiqua str. E1979001] gi|166214093|ref|ZP_02240128.1| zinc-binding protein YacG [Yersinia pestis biovar Antiqua str. B42003004] gi|167399126|ref|ZP_02304650.1| zinc-binding protein YacG [Yersinia pestis biovar Antiqua str. UG05-0454] gi|167420660|ref|ZP_02312413.1| zinc-binding protein YacG [Yersinia pestis biovar Orientalis str. MG05-1020] gi|167423670|ref|ZP_02315423.1| zinc-binding protein YacG [Yersinia pestis biovar Mediaevalis str. K1973002] gi|170025720|ref|YP_001722225.1| zinc-binding protein [Yersinia pseudotuberculosis YPIII] gi|186894057|ref|YP_001871169.1| zinc-binding protein [Yersinia pseudotuberculosis PB1/+] gi|218930449|ref|YP_002348324.1| zinc-binding protein [Yersinia pestis CO92] gi|229839075|ref|ZP_04459234.1| zinc-binding protein [Yersinia pestis biovar Orientalis str. PEXU2] gi|229896554|ref|ZP_04511722.1| zinc-binding protein [Yersinia pestis Pestoides A] gi|229899639|ref|ZP_04514780.1| zinc-binding protein [Yersinia pestis biovar Orientalis str. India 195] gi|229901026|ref|ZP_04516149.1| zinc-binding protein [Yersinia pestis Nepal516] gi|270489204|ref|ZP_06206278.1| conserved hypothetical protein [Yersinia pestis KIM D27] gi|31563276|sp|Q8ZBH8|Y3432_YERPE RecName: Full=UPF0243 zinc-binding protein YPO3432/y0755/YP_0252 gi|67461942|sp|Q66EJ3|Y700_YERPS RecName: Full=UPF0243 zinc-binding protein YPTB0700 gi|122382846|sp|Q1C3S7|Y2933_YERPA RecName: Full=UPF0243 zinc-binding protein YPA_2933 gi|122385177|sp|Q1CLZ1|Y657_YERPN RecName: Full=UPF0243 zinc-binding protein YPN_0657 gi|166228928|sp|A4TPS3|Y2923_YERPP RecName: Full=UPF0243 zinc-binding protein YPDSF_2923 gi|166990829|sp|A7FM55|Y3376_YERP3 RecName: Full=UPF0243 zinc-binding protein YpsIP31758_3376 gi|226703847|sp|B1JK68|Y3505_YERPY RecName: Full=UPF0243 zinc-binding protein YPK_3505 gi|226708046|sp|B2K4F9|Y728_YERPB RecName: Full=UPF0243 zinc-binding protein YPTS_0728 gi|226734065|sp|A9R1J7|Y1047_YERPG RecName: Full=UPF0243 zinc-binding protein YpAngola_A1047 gi|21957478|gb|AAM84342.1|AE013677_7 hypothetical protein y0755 [Yersinia pestis KIM 10] gi|45434967|gb|AAS60528.1| conserved hypothetical protein [Yersinia pestis biovar Microtus str. 91001] gi|51588332|emb|CAH19940.1| conserved hypothetical protein [Yersinia pseudotuberculosis IP 32953] gi|108774470|gb|ABG16989.1| hypothetical protein YPN_0657 [Yersinia pestis Nepal516] gi|108780837|gb|ABG14895.1| hypothetical protein YPA_2933 [Yersinia pestis Antiqua] gi|115349060|emb|CAL22021.1| conserved hypothetical protein [Yersinia pestis CO92] gi|145211878|gb|ABP41285.1| hypothetical protein YPDSF_2923 [Yersinia pestis Pestoides F] gi|149289162|gb|EDM39242.1| hypothetical protein YPE_3984 [Yersinia pestis CA88-4125] gi|152959606|gb|ABS47067.1| zinc-binding protein YacG [Yersinia pseudotuberculosis IP 31758] gi|162354174|gb|ABX88122.1| zinc-binding protein YacG [Yersinia pestis Angola] gi|165915292|gb|EDR33902.1| zinc-binding protein YacG [Yersinia pestis biovar Orientalis str. IP275] gi|165922469|gb|EDR39646.1| zinc-binding protein YacG [Yersinia pestis biovar Orientalis str. F1991016] gi|165990909|gb|EDR43210.1| zinc-binding protein YacG [Yersinia pestis biovar Antiqua str. E1979001] gi|166204724|gb|EDR49204.1| zinc-binding protein YacG [Yersinia pestis biovar Antiqua str. B42003004] gi|166961466|gb|EDR57487.1| zinc-binding protein YacG [Yersinia pestis biovar Orientalis str. MG05-1020] gi|167051630|gb|EDR63038.1| zinc-binding protein YacG [Yersinia pestis biovar Antiqua str. UG05-0454] gi|167057840|gb|EDR67586.1| zinc-binding protein YacG [Yersinia pestis biovar Mediaevalis str. K1973002] gi|169752254|gb|ACA69772.1| protein of unknown function DUF329 [Yersinia pseudotuberculosis YPIII] gi|186697083|gb|ACC87712.1| protein of unknown function DUF329 [Yersinia pseudotuberculosis PB1/+] gi|229681751|gb|EEO77844.1| zinc-binding protein [Yersinia pestis Nepal516] gi|229687131|gb|EEO79206.1| zinc-binding protein [Yersinia pestis biovar Orientalis str. India 195] gi|229695441|gb|EEO85488.1| zinc-binding protein [Yersinia pestis biovar Orientalis str. PEXU2] gi|229700628|gb|EEO88659.1| zinc-binding protein [Yersinia pestis Pestoides A] gi|270337708|gb|EFA48485.1| conserved hypothetical protein [Yersinia pestis KIM D27] gi|320016637|gb|ADW00209.1| zinc-binding protein [Yersinia pestis biovar Medievalis str. Harbin 35] Length = 68 Score = 43.5 bits (101), Expect = 0.010, Method: Composition-based stats. Identities = 17/50 (34%), Positives = 22/50 (44%), Gaps = 4/50 (8%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K G F PFC +C+ IDL W E I + + +E Sbjct: 10 CPTCGKVVIWGEQSPFRPFCCKRCQLIDLGEWADEEKRIPSDTELSDSDE 59 >gi|256821925|ref|YP_003145888.1| hypothetical protein Kkor_0700 [Kangiella koreensis DSM 16069] gi|256795464|gb|ACV26120.1| protein of unknown function DUF329 [Kangiella koreensis DSM 16069] Length = 65 Score = 43.5 bits (101), Expect = 0.010, Method: Composition-based stats. Identities = 18/56 (32%), Positives = 24/56 (42%), Gaps = 4/56 (7%) Query: 7 RSLKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 ++L CP C K E PFCS +C+ IDL W + IA + E Sbjct: 3 KALIVKCPTCEKAVAWIDDNECKPFCSKRCKLIDLGEWASEGHRIAGKPLDPEIVE 58 >gi|120612329|ref|YP_972007.1| hypothetical protein Aave_3685 [Acidovorax citrulli AAC00-1] gi|120590793|gb|ABM34233.1| protein of unknown function DUF329 [Acidovorax citrulli AAC00-1] Length = 84 Score = 43.5 bits (101), Expect = 0.010, Method: Composition-based stats. Identities = 17/48 (35%), Positives = 22/48 (45%), Gaps = 4/48 (8%) Query: 13 CPECRKGS----MVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 CP C S F PFCS +CR IDL W ++ +AA + Sbjct: 25 CPTCGGRSLYAHENRFRPFCSERCRQIDLGAWAAEDFRMAADAPPDED 72 >gi|331007266|ref|ZP_08330469.1| hypothetical protein IMCC1989_1265 [gamma proteobacterium IMCC1989] gi|330418915|gb|EGG93378.1| hypothetical protein IMCC1989_1265 [gamma proteobacterium IMCC1989] Length = 58 Score = 43.5 bits (101), Expect = 0.010, Method: Composition-based stats. Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 4/42 (9%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAV 50 CP+CRK PFCS +C+ IDL W + + I Sbjct: 7 CPQCRKKVLWSDEYPNRPFCSKRCQLIDLGEWANESFSIPVS 48 >gi|309700311|emb|CBI99599.1| putative zinc binding protein [Escherichia coli ETEC H10407] Length = 65 Score = 43.5 bits (101), Expect = 0.010, Method: Composition-based stats. Identities = 17/50 (34%), Positives = 22/50 (44%), Gaps = 4/50 (8%) Query: 13 CPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K + F PFCS C+ IDL W E I + D ++ Sbjct: 9 CPTCGKTVVWGEISPFRPFCSKLCQLIDLGEWAAEEKRIPSSGDLSESDD 58 >gi|290476441|ref|YP_003469346.1| hypothetical protein XBJ1_3464 [Xenorhabdus bovienii SS-2004] gi|289175779|emb|CBJ82582.1| conserved hypothetical protein [Xenorhabdus bovienii SS-2004] Length = 65 Score = 43.5 bits (101), Expect = 0.010, Method: Composition-based stats. Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 4/49 (8%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP C K G + + PFCS +C+ IDL W E IA+ +D + Sbjct: 9 CPTCAKTVIWGEINPYRPFCSKRCQLIDLGEWASEEKKIASQDDSSEND 57 >gi|26246036|ref|NP_752075.1| zinc-binding protein [Escherichia coli CFT073] gi|300993826|ref|ZP_07180566.1| zinc-binding protein YacG family protein [Escherichia coli MS 45-1] gi|301050006|ref|ZP_07196922.1| zinc-binding protein YacG family protein [Escherichia coli MS 185-1] gi|31563264|sp|Q8FL57|YACG_ECOL6 RecName: Full=UPF0243 zinc-binding protein yacG gi|26106433|gb|AAN78619.1|AE016755_119 Hypothetical protein yacG [Escherichia coli CFT073] gi|300298279|gb|EFJ54664.1| zinc-binding protein YacG family protein [Escherichia coli MS 185-1] gi|300406466|gb|EFJ90004.1| zinc-binding protein YacG family protein [Escherichia coli MS 45-1] gi|307551946|gb|ADN44721.1| conserved hypothetical protein [Escherichia coli ABU 83972] gi|315294666|gb|EFU54013.1| zinc-binding protein YacG family protein [Escherichia coli MS 153-1] gi|320197447|gb|EFW72061.1| zinc-binding protein [Escherichia coli WV_060327] Length = 65 Score = 43.5 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 16/40 (40%), Positives = 19/40 (47%), Gaps = 4/40 (10%) Query: 13 CPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIA 48 CP C K + F PFCS +C+ IDL W E I Sbjct: 9 CPTCGKTVVWGEISPFRPFCSKRCQLIDLGEWAAEEKRIP 48 >gi|332528445|ref|ZP_08404437.1| hypothetical protein HGR_01041 [Hylemonella gracilis ATCC 19624] gi|332042124|gb|EGI78458.1| hypothetical protein HGR_01041 [Hylemonella gracilis ATCC 19624] Length = 74 Score = 43.5 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 12/50 (24%), Positives = 21/50 (42%), Gaps = 4/50 (8%) Query: 12 ICPECRKGSMVE----FYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP C S+ + PFC +C+ +DL W + + + E+ Sbjct: 18 PCPRCGGDSIYASSNPYRPFCGERCKKMDLGAWASESFRVPTETPPEDEQ 67 >gi|268591744|ref|ZP_06125965.1| conserved domain protein [Providencia rettgeri DSM 1131] gi|291312705|gb|EFE53158.1| conserved domain protein [Providencia rettgeri DSM 1131] Length = 65 Score = 43.5 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 4/50 (8%) Query: 13 CPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C+K + F PFCS +C+ IDL W E IA+ D ++ Sbjct: 9 CPTCKKIVVWNENSPFRPFCSKRCQLIDLGEWASEEKRIASQGDISDSDD 58 >gi|31563287|sp|Q9CPF4|Y089_PASMU RecName: Full=UPF0243 zinc-binding protein PM0089 Length = 67 Score = 43.5 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 15/56 (26%), Positives = 23/56 (41%), Gaps = 4/56 (7%) Query: 10 KSICPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP C+K F PFC +C+ IDL W E I + + + ++ Sbjct: 7 SVPCPICQKQVEWSDKSPFRPFCCKRCQLIDLGEWAAEEKAIPCESADFAMNDEQE 62 >gi|32472147|ref|NP_865141.1| hypothetical protein RB2774 [Rhodopirellula baltica SH 1] gi|47117455|sp|Q7UVA1|Y2774_RHOBA RecName: Full=UPF0243 zinc-binding protein RB2774 gi|32397519|emb|CAD72825.1| conserved hypothetical protein [Rhodopirellula baltica SH 1] Length = 82 Score = 43.1 bits (100), Expect = 0.012, Method: Composition-based stats. Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 3/51 (5%) Query: 8 SLKSICPECRK---GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKS 55 +K CP C + PFCS +C+ IDL RW++ E + D Sbjct: 4 PVKINCPTCGRRFLSDETPAMPFCSKRCQLIDLGRWMNEEIGLPHEGDPGD 54 >gi|50122726|ref|YP_051893.1| hypothetical protein ECA3804 [Pectobacterium atrosepticum SCRI1043] gi|67462039|sp|Q6D0J4|Y3804_ERWCT RecName: Full=UPF0243 zinc-binding protein ECA3804 gi|49613252|emb|CAG76703.1| conserved hypothetical protein [Pectobacterium atrosepticum SCRI1043] Length = 64 Score = 43.1 bits (100), Expect = 0.013, Method: Composition-based stats. Identities = 15/51 (29%), Positives = 24/51 (47%), Gaps = 4/51 (7%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C++ + + PFCS +C+ IDL W E I + + E+ Sbjct: 9 KCPTCKQAVIWDAASIYRPFCSKRCQLIDLGEWADEEKCIPSDDMVSDSED 59 >gi|15642426|ref|NP_232059.1| zinc-binding protein [Vibrio cholerae O1 biovar El Tor str. N16961] gi|153823961|ref|ZP_01976628.1| conserved hypothetical protein [Vibrio cholerae B33] gi|227082550|ref|YP_002811101.1| hypothetical protein VCM66_2352 [Vibrio cholerae M66-2] gi|229507511|ref|ZP_04397016.1| hypothetical protein VCF_002740 [Vibrio cholerae BX 330286] gi|229512293|ref|ZP_04401772.1| hypothetical protein VCE_003705 [Vibrio cholerae B33] gi|229519430|ref|ZP_04408873.1| hypothetical protein VCC_003460 [Vibrio cholerae RC9] gi|229607017|ref|YP_002877665.1| zinc-binding protein [Vibrio cholerae MJ-1236] gi|254849553|ref|ZP_05238903.1| zinc-binding protein [Vibrio cholerae MO10] gi|255746899|ref|ZP_05420844.1| hypothetical protein VCH_003296 [Vibrio cholera CIRS 101] gi|298500213|ref|ZP_07010018.1| conserved hypothetical protein [Vibrio cholerae MAK 757] gi|31563292|sp|Q9KPE1|Y2429_VIBCH RecName: Full=UPF0243 zinc-binding protein VC_2429 gi|259646620|sp|C3LQX2|Y2352_VIBCM RecName: Full=UPF0243 zinc-binding protein VCM66_2352 gi|9657004|gb|AAF95572.1| conserved hypothetical protein [Vibrio cholerae O1 biovar El Tor str. N16961] gi|126518520|gb|EAZ75743.1| conserved hypothetical protein [Vibrio cholerae B33] gi|227010438|gb|ACP06650.1| conserved hypothetical protein [Vibrio cholerae M66-2] gi|229344119|gb|EEO09094.1| hypothetical protein VCC_003460 [Vibrio cholerae RC9] gi|229352258|gb|EEO17199.1| hypothetical protein VCE_003705 [Vibrio cholerae B33] gi|229355016|gb|EEO19937.1| hypothetical protein VCF_002740 [Vibrio cholerae BX 330286] gi|229369672|gb|ACQ60095.1| hypothetical protein VCD_001926 [Vibrio cholerae MJ-1236] gi|254845258|gb|EET23672.1| zinc-binding protein [Vibrio cholerae MO10] gi|255735301|gb|EET90701.1| hypothetical protein VCH_003296 [Vibrio cholera CIRS 101] gi|297540906|gb|EFH76960.1| conserved hypothetical protein [Vibrio cholerae MAK 757] Length = 65 Score = 43.1 bits (100), Expect = 0.014, Method: Composition-based stats. Identities = 15/50 (30%), Positives = 17/50 (34%), Gaps = 4/50 (8%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP C PFCS QC+ ID W E I D + Sbjct: 9 KCPRCGTDVEWGEQSPHRPFCSKQCQMIDFGEWADEEKAIPGAPDMSDSD 58 >gi|312173495|emb|CBX81749.1| UPF0243 zinc-binding protein yacG [Erwinia amylovora ATCC BAA-2158] Length = 67 Score = 43.1 bits (100), Expect = 0.014, Method: Composition-based stats. Identities = 15/40 (37%), Positives = 19/40 (47%), Gaps = 4/40 (10%) Query: 13 CPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIA 48 CP C K + + PFCS +C+ IDL W E I Sbjct: 9 CPTCGKQVIWDELSTWRPFCSKRCQLIDLGEWAAEEKRIP 48 >gi|171057236|ref|YP_001789585.1| hypothetical protein Lcho_0545 [Leptothrix cholodnii SP-6] gi|170774681|gb|ACB32820.1| protein of unknown function DUF329 [Leptothrix cholodnii SP-6] Length = 68 Score = 43.1 bits (100), Expect = 0.014, Method: Composition-based stats. Identities = 15/51 (29%), Positives = 26/51 (50%), Gaps = 4/51 (7%) Query: 12 ICPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C++ ++ + PFCS +C+ ID+ W +Y +AA +E Sbjct: 17 PCPTCKRPTVYRRDNPWRPFCSERCKRIDIGAWASEDYRVAAPPPAPDDEP 67 >gi|307824338|ref|ZP_07654564.1| protein of unknown function DUF329 [Methylobacter tundripaludum SV96] gi|307734718|gb|EFO05569.1| protein of unknown function DUF329 [Methylobacter tundripaludum SV96] Length = 68 Score = 43.1 bits (100), Expect = 0.014, Method: Composition-based stats. Identities = 17/64 (26%), Positives = 24/64 (37%), Gaps = 4/64 (6%) Query: 3 TSDFRSLKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 +S + L CP C + PFCS +C+ IDL W E I ++ Sbjct: 2 SSSSKPLIVKCPNCGCSVPWVPEQQSKPFCSERCKLIDLGEWAMEEKRIPGQSVSLEDDS 61 Query: 59 VKDI 62 D Sbjct: 62 EDDT 65 >gi|260775495|ref|ZP_05884392.1| zinc-binding protein [Vibrio coralliilyticus ATCC BAA-450] gi|260608676|gb|EEX34841.1| zinc-binding protein [Vibrio coralliilyticus ATCC BAA-450] Length = 64 Score = 43.1 bits (100), Expect = 0.014, Method: Composition-based stats. Identities = 15/50 (30%), Positives = 19/50 (38%), Gaps = 4/50 (8%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP+C + PFCS QC+ ID W E I D + Sbjct: 8 PCPKCGTEVEWGEQSPYRPFCSKQCQMIDFGEWADEENSIPGAPDMSDSD 57 >gi|319789351|ref|YP_004150984.1| protein of unknown function DUF329 [Thermovibrio ammonificans HB-1] gi|317113853|gb|ADU96343.1| protein of unknown function DUF329 [Thermovibrio ammonificans HB-1] Length = 57 Score = 42.7 bits (99), Expect = 0.015, Method: Composition-based stats. Identities = 19/41 (46%), Positives = 22/41 (53%), Gaps = 3/41 (7%) Query: 9 LKSICPECRKGSMVE---FYPFCSTQCRSIDLSRWLHGEYV 46 K CP C K E F PFC QC+ DLS+WL+ EY Sbjct: 2 KKVKCPNCGKEVEWENNPFRPFCCEQCKLADLSKWLNEEYA 42 >gi|307252502|ref|ZP_07534398.1| hypothetical protein appser6_10190 [Actinobacillus pleuropneumoniae serovar 6 str. Femo] gi|306860094|gb|EFM92111.1| hypothetical protein appser6_10190 [Actinobacillus pleuropneumoniae serovar 6 str. Femo] Length = 48 Score = 42.7 bits (99), Expect = 0.016, Method: Composition-based stats. Identities = 15/42 (35%), Positives = 25/42 (59%) Query: 20 SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 ++ PFCS +C+ IDL W + E IAAVE++ +++ Sbjct: 5 PESKYRPFCSERCQLIDLGEWANEEKRIAAVENDVMTSDLEG 46 >gi|292489330|ref|YP_003532217.1| hypothetical protein EAMY_2862 [Erwinia amylovora CFBP1430] gi|292898446|ref|YP_003537815.1| hypothetical protein EAM_0725 [Erwinia amylovora ATCC 49946] gi|291198294|emb|CBJ45400.1| conserved hypothetical protein [Erwinia amylovora ATCC 49946] gi|291554764|emb|CBA22559.1| UPF0243 zinc-binding protein yacG [Erwinia amylovora CFBP1430] Length = 67 Score = 42.7 bits (99), Expect = 0.017, Method: Composition-based stats. Identities = 15/40 (37%), Positives = 19/40 (47%), Gaps = 4/40 (10%) Query: 13 CPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIA 48 CP C K + + PFCS +C+ IDL W E I Sbjct: 9 CPTCGKQVIWDELSTWRPFCSKRCQLIDLGEWAAEEKRIP 48 >gi|284008391|emb|CBA74807.1| conserved hypothetical protein [Arsenophonus nasoniae] Length = 70 Score = 42.7 bits (99), Expect = 0.018, Method: Composition-based stats. Identities = 16/51 (31%), Positives = 24/51 (47%), Gaps = 4/51 (7%) Query: 12 ICPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K + PFCS +CR IDL W E I++ ++ ++ Sbjct: 8 KCPTCHKIVIWQESSLYRPFCSKRCRLIDLGEWAGEEKRISSQQNISEIDD 58 >gi|123441043|ref|YP_001005032.1| zinc-binding protein [Yersinia enterocolitica subsp. enterocolitica 8081] gi|166228825|sp|A1JJK4|Y683_YERE8 RecName: Full=UPF0243 zinc-binding protein YE0683 gi|122088004|emb|CAL10792.1| conserved hypothetical protein [Yersinia enterocolitica subsp. enterocolitica 8081] Length = 68 Score = 42.7 bits (99), Expect = 0.019, Method: Composition-based stats. Identities = 16/50 (32%), Positives = 23/50 (46%), Gaps = 4/50 (8%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K G + PFC +C+ IDL W E I++ + +E Sbjct: 10 CPTCGKIVIWGEQSPYRPFCCKRCQLIDLGEWADEEKRISSNGELSDSDE 59 >gi|167550665|ref|ZP_02344422.1| conserved domain protein [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] gi|205324465|gb|EDZ12304.1| conserved domain protein [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] Length = 63 Score = 42.3 bits (98), Expect = 0.020, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 20/40 (50%), Gaps = 4/40 (10%) Query: 13 CPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIA 48 CP C K + F PFCS +C+ IDL W E IA Sbjct: 9 CPTCGKLVVWGEISPFRPFCSKRCQLIDLGEWAAEEKRIA 48 >gi|330720596|gb|EGG98861.1| zinc-binding protein [gamma proteobacterium IMCC2047] Length = 67 Score = 42.3 bits (98), Expect = 0.021, Method: Composition-based stats. Identities = 16/53 (30%), Positives = 22/53 (41%), Gaps = 4/53 (7%) Query: 13 CPECRKGS----MVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP C+K + PFC +C+ IDL W + E I +E D Sbjct: 12 CPTCKKSTAWSNDNPNRPFCCERCKLIDLGAWANEENSIPGDPVNPYVDENND 64 >gi|269138006|ref|YP_003294706.1| putative zinc-binding protein [Edwardsiella tarda EIB202] gi|267983666|gb|ACY83495.1| putative zinc-binding protein [Edwardsiella tarda EIB202] gi|304558053|gb|ADM40717.1| zinc-binding protein [Edwardsiella tarda FL6-60] Length = 66 Score = 42.3 bits (98), Expect = 0.022, Method: Composition-based stats. Identities = 18/50 (36%), Positives = 23/50 (46%), Gaps = 4/50 (8%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C G + PFCS +C+ IDL W + E IA+ EE Sbjct: 10 CPTCGSTVIWGERSPYRPFCSKRCQLIDLGEWANEEKRIASDAAHSDSEE 59 >gi|262393313|ref|YP_003285167.1| zinc-binding protein [Vibrio sp. Ex25] gi|262336907|gb|ACY50702.1| zinc-binding protein [Vibrio sp. Ex25] Length = 64 Score = 42.3 bits (98), Expect = 0.023, Method: Composition-based stats. Identities = 15/49 (30%), Positives = 18/49 (36%), Gaps = 4/49 (8%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP+C PFCS QC+ ID W E I D + Sbjct: 9 CPQCGADVEWGEQSPHRPFCSKQCQMIDFGEWADEENTIPGAPDMSDSD 57 >gi|209696043|ref|YP_002263973.1| zinc-binding protein [Aliivibrio salmonicida LFI1238] gi|226701467|sp|B6ELG6|Y2635_ALISL RecName: Full=UPF0243 zinc-binding protein VSAL_I2635 gi|208009996|emb|CAQ80319.1| zinc-binding protein [Aliivibrio salmonicida LFI1238] Length = 69 Score = 42.3 bits (98), Expect = 0.023, Method: Composition-based stats. Identities = 18/60 (30%), Positives = 25/60 (41%), Gaps = 4/60 (6%) Query: 2 QTSDFRSLKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 Q + + CP C+ + EF PFCS +C+ ID W E IA D + Sbjct: 3 QPNSQQPTIVKCPTCQNKVVWNTESEFRPFCSKKCQMIDFGEWADEEKSIAGAPDMSDSD 62 >gi|91203325|emb|CAJ72964.1| conserved hypothetical protein [Candidatus Kuenenia stuttgartiensis] Length = 67 Score = 42.3 bits (98), Expect = 0.023, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 6/41 (14%) Query: 13 CPECRKG------SMVEFYPFCSTQCRSIDLSRWLHGEYVI 47 CP CRK + ++PFCS +C+ +D WL Y I Sbjct: 6 CPNCRKILFYQVIKDLPYFPFCSNRCKLVDFGAWLDESYCI 46 >gi|332160423|ref|YP_004297000.1| zinc-binding protein [Yersinia enterocolitica subsp. palearctica 105.5R(r)] gi|318607116|emb|CBY28614.1| zinc-binding protein [Yersinia enterocolitica subsp. palearctica Y11] gi|325664653|gb|ADZ41297.1| zinc-binding protein [Yersinia enterocolitica subsp. palearctica 105.5R(r)] Length = 68 Score = 42.3 bits (98), Expect = 0.024, Method: Composition-based stats. Identities = 16/50 (32%), Positives = 23/50 (46%), Gaps = 4/50 (8%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K G + PFC +C+ IDL W E I++ + +E Sbjct: 10 CPTCGKLVIWGEQSPYRPFCCKRCQLIDLGEWADEEKRISSNGELSDSDE 59 >gi|311695307|gb|ADP98180.1| zinc-binding protein [marine bacterium HP15] Length = 51 Score = 42.3 bits (98), Expect = 0.025, Method: Composition-based stats. Identities = 12/32 (37%), Positives = 17/32 (53%) Query: 25 YPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 PFCS +C+ IDL W + EY + A + Sbjct: 10 RPFCSERCKLIDLGAWANEEYRVPAENASPED 41 >gi|163803449|ref|ZP_02197322.1| zinc-binding protein [Vibrio sp. AND4] gi|159172750|gb|EDP57598.1| zinc-binding protein [Vibrio sp. AND4] Length = 64 Score = 41.9 bits (97), Expect = 0.026, Method: Composition-based stats. Identities = 15/50 (30%), Positives = 20/50 (40%), Gaps = 4/50 (8%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP+C + PFCS QC+ ID W + IA D + Sbjct: 8 PCPQCGADVEWGEQSPYRPFCSKQCQMIDFGEWADEDNAIAGAPDMSDSD 57 >gi|226328308|ref|ZP_03803826.1| hypothetical protein PROPEN_02202 [Proteus penneri ATCC 35198] gi|225203041|gb|EEG85395.1| hypothetical protein PROPEN_02202 [Proteus penneri ATCC 35198] Length = 70 Score = 41.9 bits (97), Expect = 0.027, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 23/55 (41%), Gaps = 4/55 (7%) Query: 12 ICPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 CP C+ + + PFCS +C+ IDL W I + D ++ + Sbjct: 8 KCPTCQTEVVWNESSPYRPFCSKRCQLIDLGEWADESKRIPSQSDINDSDDWSEA 62 >gi|119944917|ref|YP_942597.1| hypothetical protein Ping_1161 [Psychromonas ingrahamii 37] gi|119863521|gb|ABM02998.1| protein of unknown function DUF329 [Psychromonas ingrahamii 37] Length = 63 Score = 41.9 bits (97), Expect = 0.027, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 19/55 (34%), Gaps = 4/55 (7%) Query: 13 CPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDIL 63 CP C+K PFC +C+ IDL W E VI + Sbjct: 5 CPTCKKQVEWIIENSHRPFCCKRCQLIDLGEWASEEKVIQGESVSPENMPADKTI 59 >gi|145297495|ref|YP_001140336.1| hypothetical protein ASA_0408 [Aeromonas salmonicida subsp. salmonicida A449] gi|166227224|sp|A4SI66|Y408_AERS4 RecName: Full=UPF0243 zinc-binding protein ASA_0408 gi|142850267|gb|ABO88588.1| conserved hypothetical protein [Aeromonas salmonicida subsp. salmonicida A449] Length = 64 Score = 41.9 bits (97), Expect = 0.028, Method: Composition-based stats. Identities = 16/49 (32%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Query: 10 KSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEK 54 K CP C+ F PFCS +C+ IDL W E I + Sbjct: 4 KVKCPTCKTELEWGPQSPFRPFCSKRCQLIDLGEWADEEKRIPGPINPD 52 >gi|156975739|ref|YP_001446646.1| zinc-binding protein [Vibrio harveyi ATCC BAA-1116] gi|156527333|gb|ABU72419.1| hypothetical protein VIBHAR_03474 [Vibrio harveyi ATCC BAA-1116] Length = 66 Score = 41.9 bits (97), Expect = 0.030, Method: Composition-based stats. Identities = 16/50 (32%), Positives = 19/50 (38%), Gaps = 4/50 (8%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP+C PFCS QC+ ID W E IA D + Sbjct: 10 PCPQCGADVEWGEQSPHRPFCSKQCQMIDFGEWADEENTIAGAPDMSDSD 59 >gi|238761567|ref|ZP_04622542.1| hypothetical protein ykris0001_10430 [Yersinia kristensenii ATCC 33638] gi|238700081|gb|EEP92823.1| hypothetical protein ykris0001_10430 [Yersinia kristensenii ATCC 33638] Length = 68 Score = 41.9 bits (97), Expect = 0.032, Method: Composition-based stats. Identities = 16/50 (32%), Positives = 23/50 (46%), Gaps = 4/50 (8%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K G + PFC +C+ IDL W E I++ + +E Sbjct: 10 CPTCGKVVIWGEQSPYRPFCCKRCQLIDLGEWADEEKRISSSGELSDSDE 59 >gi|313667732|ref|YP_004048016.1| UPF0243 zinc-binding protein ORFY [Neisseria lactamica ST-640] gi|313005194|emb|CBN86627.1| UPF0243 zinc-binding protein ORFY [Neisseria lactamica 020-06] Length = 69 Score = 41.9 bits (97), Expect = 0.032, Method: Composition-based stats. Identities = 20/66 (30%), Positives = 27/66 (40%), Gaps = 6/66 (9%) Query: 1 MQTSDFRSLKSICP-----ECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKS 55 M S L+ CP K F PFCS +C+ IDL W G+Y ++ + Sbjct: 1 MAESRQTRLQVKCPTRQTAVVWKP-ENAFRPFCSQRCKLIDLGGWADGKYTVSDQTESLP 59 Query: 56 EEEVKD 61 E D Sbjct: 60 EISEPD 65 >gi|117620426|ref|YP_858313.1| hypothetical protein AHA_3874 [Aeromonas hydrophila subsp. hydrophila ATCC 7966] gi|166232654|sp|A0KPW2|Y3874_AERHH RecName: Full=UPF0243 zinc-binding protein AHA_3874 gi|117561833|gb|ABK38781.1| conserved domain protein [Aeromonas hydrophila subsp. hydrophila ATCC 7966] Length = 64 Score = 41.6 bits (96), Expect = 0.036, Method: Composition-based stats. Identities = 17/49 (34%), Positives = 21/49 (42%), Gaps = 4/49 (8%) Query: 10 KSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEK 54 K CP C+ F PFCS +C+ IDL W E I D + Sbjct: 4 KVKCPTCQTELEWGPQSPFRPFCSKRCQLIDLGEWADEEKRIPGEIDPE 52 >gi|330828054|ref|YP_004391006.1| Dephospho-CoA kinase [Aeromonas veronii B565] gi|328803190|gb|AEB48389.1| Dephospho-CoA kinase [Aeromonas veronii B565] Length = 64 Score = 41.6 bits (96), Expect = 0.038, Method: Composition-based stats. Identities = 17/56 (30%), Positives = 23/56 (41%), Gaps = 4/56 (7%) Query: 10 KSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 K CP C+ F PFCS +C+ IDL W E I + E ++ Sbjct: 4 KVKCPTCQSEVEWGPQSPFRPFCSKRCQLIDLGEWADEEKRIPGEINPDLLPEPEE 59 >gi|330446852|ref|ZP_08310503.1| conserved hypothetical protein [Photobacterium leiognathi subsp. mandapamensis svers.1.1.] gi|328491043|dbj|GAA05000.1| conserved hypothetical protein [Photobacterium leiognathi subsp. mandapamensis svers.1.1.] Length = 73 Score = 41.6 bits (96), Expect = 0.039, Method: Composition-based stats. Identities = 15/50 (30%), Positives = 19/50 (38%), Gaps = 4/50 (8%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP C+ F PFC +C+ IDL W E I D + Sbjct: 16 KCPTCKTDVVWGEQSPFRPFCCKRCQLIDLGEWADEEKSIPGAPDLSDSD 65 >gi|28899303|ref|NP_798908.1| zinc-binding protein [Vibrio parahaemolyticus RIMD 2210633] gi|153838714|ref|ZP_01991381.1| conserved domain protein [Vibrio parahaemolyticus AQ3810] gi|260363570|ref|ZP_05776396.1| conserved domain protein [Vibrio parahaemolyticus K5030] gi|260879005|ref|ZP_05891360.1| conserved domain protein [Vibrio parahaemolyticus AN-5034] gi|260897209|ref|ZP_05905705.1| conserved domain protein [Vibrio parahaemolyticus Peru-466] gi|260900215|ref|ZP_05908610.1| conserved domain protein [Vibrio parahaemolyticus AQ4037] gi|31563243|sp|Q87LT2|Y2529_VIBPA RecName: Full=UPF0243 zinc-binding protein VP2529 gi|28807527|dbj|BAC60792.1| conserved hypothetical protein [Vibrio parahaemolyticus RIMD 2210633] gi|149747874|gb|EDM58752.1| conserved domain protein [Vibrio parahaemolyticus AQ3810] gi|308088449|gb|EFO38144.1| conserved domain protein [Vibrio parahaemolyticus Peru-466] gi|308089595|gb|EFO39290.1| conserved domain protein [Vibrio parahaemolyticus AN-5034] gi|308110275|gb|EFO47815.1| conserved domain protein [Vibrio parahaemolyticus AQ4037] gi|308113408|gb|EFO50948.1| conserved domain protein [Vibrio parahaemolyticus K5030] gi|328474164|gb|EGF44969.1| DNA gyrase inhibitor [Vibrio parahaemolyticus 10329] Length = 64 Score = 41.6 bits (96), Expect = 0.039, Method: Composition-based stats. Identities = 15/49 (30%), Positives = 19/49 (38%), Gaps = 4/49 (8%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP+C PFCS +C+ ID W E IA D + Sbjct: 9 CPQCGTDVEWGEQSPHRPFCSKKCQMIDFGEWADEENAIAGAPDMSDSD 57 >gi|332305389|ref|YP_004433240.1| hypothetical protein Glaag_1011 [Glaciecola agarilytica 4H-3-7+YE-5] gi|332172718|gb|AEE21972.1| protein of unknown function DUF329 [Glaciecola agarilytica 4H-3-7+YE-5] Length = 76 Score = 41.6 bits (96), Expect = 0.041, Method: Composition-based stats. Identities = 16/52 (30%), Positives = 23/52 (44%), Gaps = 4/52 (7%) Query: 9 LKSICPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 +K CP C+ F PFCS +C+ IDL W + I + +E Sbjct: 1 MKVNCPTCKTSVEWNQASPFRPFCSKKCQLIDLGEWADEQKAIPCGPSKDAE 52 >gi|59712798|ref|YP_205574.1| zinc-binding protein [Vibrio fischeri ES114] gi|67462011|sp|Q5E2R0|Y2191_VIBF1 RecName: Full=UPF0243 zinc-binding protein VF_2191 gi|59480899|gb|AAW86686.1| non-essential pilus assembly protein [Vibrio fischeri ES114] Length = 69 Score = 41.2 bits (95), Expect = 0.049, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 21/55 (38%), Gaps = 4/55 (7%) Query: 7 RSLKSICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 + CP C+ + F PFCS +C+ ID W E I D + Sbjct: 8 QPTTVKCPTCQSAVIWNAESPFRPFCSKKCQMIDFGEWADEEKSIPGAPDMSDSD 62 >gi|212712768|ref|ZP_03320896.1| hypothetical protein PROVALCAL_03865 [Providencia alcalifaciens DSM 30120] gi|212684684|gb|EEB44212.1| hypothetical protein PROVALCAL_03865 [Providencia alcalifaciens DSM 30120] Length = 65 Score = 41.2 bits (95), Expect = 0.053, Method: Composition-based stats. Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 4/49 (8%) Query: 13 CPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP C+K + F PFCS +C+ IDL W + I + D E Sbjct: 9 CPTCQKIVVWNESSPFRPFCSKRCQLIDLGEWATEDKRIESQGDISDSE 57 >gi|149191269|ref|ZP_01869524.1| zinc-binding protein [Vibrio shilonii AK1] gi|148834867|gb|EDL51849.1| zinc-binding protein [Vibrio shilonii AK1] Length = 64 Score = 41.2 bits (95), Expect = 0.055, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 22/55 (40%), Gaps = 4/55 (7%) Query: 7 RSLKSICPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 + CP+C+ + F PFCS QC+ ID W E I D + Sbjct: 3 KPTVVPCPQCKAEVVWNEDSPFRPFCSKQCQMIDFGEWADEENTIPGAPDMSDSD 57 >gi|261823005|ref|YP_003261111.1| hypothetical protein Pecwa_3769 [Pectobacterium wasabiae WPP163] gi|261607018|gb|ACX89504.1| protein of unknown function DUF329 [Pectobacterium wasabiae WPP163] Length = 64 Score = 40.8 bits (94), Expect = 0.056, Method: Composition-based stats. Identities = 14/41 (34%), Positives = 19/41 (46%), Gaps = 4/41 (9%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIA 48 CP C++ + PFCS +C+ IDL W E I Sbjct: 9 KCPTCKQAVIWDENSTYRPFCSKRCQLIDLGEWADEEKRIP 49 >gi|183599890|ref|ZP_02961383.1| hypothetical protein PROSTU_03411 [Providencia stuartii ATCC 25827] gi|188022165|gb|EDU60205.1| hypothetical protein PROSTU_03411 [Providencia stuartii ATCC 25827] Length = 65 Score = 40.8 bits (94), Expect = 0.056, Method: Composition-based stats. Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 4/49 (8%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP C+K G + PFCS +C+ IDL W E I + D + Sbjct: 9 CPTCQKVVVWGEESPYRPFCSKRCQLIDLGEWAAEEKRITSQGDISDSD 57 >gi|121610842|ref|YP_998649.1| hypothetical protein Veis_3924 [Verminephrobacter eiseniae EF01-2] gi|121555482|gb|ABM59631.1| protein of unknown function DUF329 [Verminephrobacter eiseniae EF01-2] Length = 73 Score = 40.8 bits (94), Expect = 0.056, Method: Composition-based stats. Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 4/50 (8%) Query: 2 QTSDFRSLKSICPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVI 47 +++D R CP CR S+ + PFCS +C+ DL W ++ + Sbjct: 5 RSTDARERIVRCPGCRGDSVYGPGNAYRPFCSQRCKLADLGAWASEQFRM 54 >gi|124514348|gb|EAY55861.1| hypothetical protein UBAL2_86920016 [Leptospirillum rubarum] Length = 73 Score = 40.8 bits (94), Expect = 0.057, Method: Composition-based stats. Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 3/40 (7%) Query: 11 SICPECRKGSMVEFY---PFCSTQCRSIDLSRWLHGEYVI 47 C C+ E Y FCS +CR IDL+RWL+ EY I Sbjct: 7 RRCVVCQAVLEGERYLRTSFCSQRCRKIDLARWLNEEYRI 46 >gi|109899644|ref|YP_662899.1| hypothetical protein Patl_3339 [Pseudoalteromonas atlantica T6c] gi|109701925|gb|ABG41845.1| protein of unknown function DUF329 [Pseudoalteromonas atlantica T6c] Length = 76 Score = 40.8 bits (94), Expect = 0.057, Method: Composition-based stats. Identities = 16/52 (30%), Positives = 23/52 (44%), Gaps = 4/52 (7%) Query: 9 LKSICPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 +K CP C+ F PFCS +C+ IDL W + I + +E Sbjct: 1 MKVNCPSCKTSVEWHESSPFRPFCSKKCQLIDLGEWADEQKAIPCGPSKDAE 52 >gi|238754445|ref|ZP_04615800.1| hypothetical protein yruck0001_23800 [Yersinia ruckeri ATCC 29473] gi|238707274|gb|EEP99636.1| hypothetical protein yruck0001_23800 [Yersinia ruckeri ATCC 29473] Length = 66 Score = 40.8 bits (94), Expect = 0.059, Method: Composition-based stats. Identities = 16/58 (27%), Positives = 24/58 (41%), Gaps = 4/58 (6%) Query: 5 DFRSLKSICPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 D ++ CP C G + PFC +C+ IDL W E I + + +E Sbjct: 2 DSSEIQVNCPTCGNTVIWGEQSPYRPFCCKRCQLIDLGEWADEEKRIPSQGELSDSDE 59 >gi|197336361|ref|YP_002156988.1| hypothetical protein VFMJ11_2304 [Vibrio fischeri MJ11] gi|226701247|sp|B5FB26|Y2304_VIBFM RecName: Full=UPF0243 zinc-binding protein VFMJ11_2304 gi|197317851|gb|ACH67298.1| conserved domain protein [Vibrio fischeri MJ11] Length = 69 Score = 40.8 bits (94), Expect = 0.061, Method: Composition-based stats. Identities = 15/50 (30%), Positives = 20/50 (40%), Gaps = 4/50 (8%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP C+ + F PFCS +C+ ID W E I D + Sbjct: 13 KCPTCQSAVVWNAESPFRPFCSKKCQMIDFGEWADEEKSIPGAPDMSDSD 62 >gi|90416347|ref|ZP_01224279.1| zinc-binding protein [marine gamma proteobacterium HTCC2207] gi|90332072|gb|EAS47286.1| zinc-binding protein [marine gamma proteobacterium HTCC2207] Length = 80 Score = 40.8 bits (94), Expect = 0.067, Method: Composition-based stats. Identities = 16/61 (26%), Positives = 21/61 (34%), Gaps = 4/61 (6%) Query: 7 RSLKSICPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 + K CP C+ F PFC +C+ ID W + I E D Sbjct: 3 SATKLNCPTCKTQIEWTDKFPFRPFCCQRCQQIDFGDWAQESFAIKGAALLDPEVMDSDQ 62 Query: 63 L 63 L Sbjct: 63 L 63 >gi|238760608|ref|ZP_04621737.1| hypothetical protein yaldo0001_39570 [Yersinia aldovae ATCC 35236] gi|238701168|gb|EEP93756.1| hypothetical protein yaldo0001_39570 [Yersinia aldovae ATCC 35236] Length = 68 Score = 40.8 bits (94), Expect = 0.071, Method: Composition-based stats. Identities = 17/58 (29%), Positives = 26/58 (44%), Gaps = 4/58 (6%) Query: 5 DFRSLKSICPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 D ++ CP C K G + PFC +C+ IDL W E I++ + +E Sbjct: 2 DLEEIEVNCPTCAKIVIWGEQSPYRPFCCKRCQLIDLGEWADEEKRISSSGELSDSDE 59 >gi|206602769|gb|EDZ39250.1| Hypothetical protein CGL2_11212101 [Leptospirillum sp. Group II '5-way CG'] Length = 67 Score = 40.4 bits (93), Expect = 0.085, Method: Composition-based stats. Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 3/40 (7%) Query: 11 SICPECRKGSMVEFY---PFCSTQCRSIDLSRWLHGEYVI 47 C C+ E Y FCS +CR IDL+RWL+ EY I Sbjct: 7 RRCVVCQAVLEGERYLRTSFCSQRCRKIDLARWLNEEYRI 46 >gi|56459558|ref|YP_154839.1| hypothetical protein IL0447 [Idiomarina loihiensis L2TR] gi|67461919|sp|Q5R0N5|Y447_IDILO RecName: Full=UPF0243 zinc-binding protein IL0447 gi|56178568|gb|AAV81290.1| Uncharacterized zinc finger protein [Idiomarina loihiensis L2TR] Length = 64 Score = 40.4 bits (93), Expect = 0.086, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 23/55 (41%), Gaps = 4/55 (7%) Query: 8 SLKSICPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 S+ CP C+ PFCS +C+ IDL W + E I + ++ Sbjct: 2 SISVNCPTCQTKVEWSEKSPARPFCSERCKLIDLGEWANEEKSIPGEPVVIANDD 56 >gi|300715320|ref|YP_003740123.1| conserved uncharacterized protein, zinc-binding protein [Erwinia billingiae Eb661] gi|299061156|emb|CAX58263.1| conserved uncharacterized protein, zinc-binding protein [Erwinia billingiae Eb661] Length = 69 Score = 40.0 bits (92), Expect = 0.100, Method: Composition-based stats. Identities = 16/49 (32%), Positives = 22/49 (44%), Gaps = 4/49 (8%) Query: 13 CPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP C K + + PFC +C+ IDL W E IA+ + E Sbjct: 11 CPTCAKEVIWDELSPWRPFCCKRCQLIDLGEWAAEEKRIASNDQHSESE 59 >gi|326318394|ref|YP_004236066.1| hypothetical protein Acav_3600 [Acidovorax avenae subsp. avenae ATCC 19860] gi|323375230|gb|ADX47499.1| Uncharacterized zinc-binding family protein [Acidovorax avenae subsp. avenae ATCC 19860] Length = 84 Score = 40.0 bits (92), Expect = 0.100, Method: Composition-based stats. Identities = 16/48 (33%), Positives = 21/48 (43%), Gaps = 4/48 (8%) Query: 13 CPECRKGS----MVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 CP C S PFCS +CR IDL W ++ +AA + Sbjct: 25 CPTCGGRSLYAPENRSRPFCSERCRQIDLGAWAAEDFRMAADAPPDED 72 >gi|332531742|ref|ZP_08407627.1| hypothetical protein PH505_aa00470 [Pseudoalteromonas haloplanktis ANT/505] gi|332038718|gb|EGI75160.1| hypothetical protein PH505_aa00470 [Pseudoalteromonas haloplanktis ANT/505] Length = 76 Score = 40.0 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 7/57 (12%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAV---EDEKSEEEVKDI 62 CP C+ F PFCS +C+ IDL W I+A +E S++ ++DI Sbjct: 7 CPTCKTKVEWSEQSPFRPFCSKRCQLIDLGEWSFENNKISAPITSAEEFSQDMIEDI 63 >gi|1573910|gb|AAC22551.1| conserved hypothetical protein [Haemophilus influenzae Rd KW20] Length = 52 Score = 39.6 bits (91), Expect = 0.14, Method: Composition-based stats. Identities = 12/38 (31%), Positives = 18/38 (47%) Query: 21 MVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 F PFCS +C+ IDL W E I + + + + Sbjct: 6 ESTFRPFCSKRCQLIDLGEWAAEEKAIPSDTADFAMDP 43 >gi|197285903|ref|YP_002151775.1| hypothetical protein PMI2054 [Proteus mirabilis HI4320] gi|227356409|ref|ZP_03840797.1| zinc-binding protein [Proteus mirabilis ATCC 29906] gi|226701139|sp|B4F0Z6|Y2054_PROMH RecName: Full=UPF0243 zinc-binding protein PMI2054 gi|194683390|emb|CAR44115.1| conserved hypothetical protein [Proteus mirabilis HI4320] gi|227163519|gb|EEI48440.1| zinc-binding protein [Proteus mirabilis ATCC 29906] Length = 71 Score = 39.6 bits (91), Expect = 0.14, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 23/55 (41%), Gaps = 4/55 (7%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 CP CR + PFC +C+ IDL W E I + + +E ++ Sbjct: 8 KCPTCRTEVIWDESSPYRPFCCKRCQLIDLGEWAAEEKRIPSQSESNDSDEWSEM 62 >gi|218671897|ref|ZP_03521566.1| zinc-binding protein [Rhizobium etli GR56] Length = 40 Score = 39.6 bits (91), Expect = 0.16, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 16/31 (51%) Query: 3 TSDFRSLKSICPECRKGSMVEFYPFCSTQCR 33 + CPEC K S E YPFCS +CR Sbjct: 10 KVEPLRKTRPCPECGKQSNREHYPFCSNRCR 40 >gi|77359343|ref|YP_338918.1| hypothetical protein PSHAa0377 [Pseudoalteromonas haloplanktis TAC125] gi|123588635|sp|Q3IID3|Y377_PSEHT RecName: Full=UPF0243 zinc-binding protein PSHAa0377 gi|76874254|emb|CAI85475.1| conserved protein of unknown function [Pseudoalteromonas haloplanktis TAC125] Length = 76 Score = 39.3 bits (90), Expect = 0.18, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 24/55 (43%), Gaps = 5/55 (9%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDIL 63 CP C+ PFCS +C+ IDL W I + +E+ +D++ Sbjct: 7 CPTCKSKVEWSEQSPHRPFCSKRCQLIDLGEWSFENNRI-SAPITSAEDFSQDMI 60 >gi|119472648|ref|ZP_01614639.1| hypothetical protein ATW7_12438 [Alteromonadales bacterium TW-7] gi|119444852|gb|EAW26153.1| hypothetical protein ATW7_12438 [Alteromonadales bacterium TW-7] Length = 76 Score = 39.3 bits (90), Expect = 0.20, Method: Composition-based stats. Identities = 12/32 (37%), Positives = 15/32 (46%), Gaps = 4/32 (12%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRW 40 CP C+ PFCS +C+ IDL W Sbjct: 7 CPTCKTNVEWSEQSPHRPFCSKRCQLIDLGEW 38 >gi|148979238|ref|ZP_01815392.1| zinc-binding protein [Vibrionales bacterium SWAT-3] gi|145961886|gb|EDK27177.1| zinc-binding protein [Vibrionales bacterium SWAT-3] Length = 65 Score = 38.9 bits (89), Expect = 0.23, Method: Composition-based stats. Identities = 16/50 (32%), Positives = 19/50 (38%), Gaps = 4/50 (8%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP+C PFCS QC+ ID W E IA D + Sbjct: 9 KCPQCNTDVEWGEQSPHRPFCSKQCQMIDFGEWADEENSIAGAPDMSDSD 58 >gi|320155367|ref|YP_004187746.1| zinc-binding protein [Vibrio vulnificus MO6-24/O] gi|319930679|gb|ADV85543.1| zinc-binding protein [Vibrio vulnificus MO6-24/O] Length = 49 Score = 38.9 bits (89), Expect = 0.25, Method: Composition-based stats. Identities = 11/37 (29%), Positives = 14/37 (37%) Query: 21 MVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 PFCS +C+ ID W E I D + Sbjct: 6 QSPHRPFCSKKCQMIDFGEWADEENAIPGAPDMSDSD 42 >gi|261345633|ref|ZP_05973277.1| hypothetical protein PROVRUST_06975 [Providencia rustigianii DSM 4541] gi|282566115|gb|EFB71650.1| conserved domain protein [Providencia rustigianii DSM 4541] Length = 65 Score = 38.9 bits (89), Expect = 0.25, Method: Composition-based stats. Identities = 15/49 (30%), Positives = 21/49 (42%), Gaps = 4/49 (8%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP C+K + PFC +C+ IDL W E I + D + Sbjct: 9 CPTCQKVVIWNENSPYRPFCCKRCQLIDLGEWAAEEKRIGSQGDISDSD 57 >gi|262166468|ref|ZP_06034205.1| zinc-binding protein [Vibrio mimicus VM223] gi|262026184|gb|EEY44852.1| zinc-binding protein [Vibrio mimicus VM223] Length = 49 Score = 38.5 bits (88), Expect = 0.29, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 14/37 (37%) Query: 21 MVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 PFCS QC+ ID W E I D + Sbjct: 6 QSPHRPFCSKQCQMIDFGEWADEEKAIPGAPDMSDSD 42 >gi|254509219|ref|ZP_05121316.1| conserved domain protein [Vibrio parahaemolyticus 16] gi|219547877|gb|EED24905.1| conserved domain protein [Vibrio parahaemolyticus 16] Length = 49 Score = 38.5 bits (88), Expect = 0.31, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 15/37 (40%) Query: 21 MVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 + PFCS QC+ ID W E I D + Sbjct: 6 QSPYRPFCSKQCQMIDFGEWADEENTIPGAPDMSDSD 42 >gi|119713305|gb|ABL97369.1| hypothetical protein MBMO_EB80-02D08.0001 [uncultured marine bacterium EB80_02D08] Length = 54 Score = 38.5 bits (88), Expect = 0.31, Method: Composition-based stats. Identities = 14/49 (28%), Positives = 22/49 (44%), Gaps = 4/49 (8%) Query: 11 SICPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKS 55 S CP C K + + PFCS +C+ ID W + + I+ + Sbjct: 2 SNCPRCEKPTSLSMNNTYRPFCSEKCKLIDFGDWANEDNKISRPIQNED 50 >gi|315127776|ref|YP_004069779.1| hypothetical protein PSM_A2714 [Pseudoalteromonas sp. SM9913] gi|315016290|gb|ADT69628.1| hypothetical protein PSM_A2714 [Pseudoalteromonas sp. SM9913] Length = 76 Score = 38.5 bits (88), Expect = 0.32, Method: Composition-based stats. Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 7/57 (12%) Query: 13 CPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAV---EDEKSEEEVKDI 62 CP C+ PFCS +C+ IDL W I+A DE S++ ++DI Sbjct: 7 CPTCKAKVEWSEQSPNRPFCSKRCQLIDLGEWSFENNKISAPITSADEFSQDMIEDI 63 >gi|297170248|gb|ADI21285.1| hypothetical protein [uncultured gamma proteobacterium HF0010_09F21] Length = 54 Score = 38.5 bits (88), Expect = 0.33, Method: Composition-based stats. Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Query: 12 ICPECRK--GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSE 56 CP+C+ EF PFCS C+++D W + E I +D S+ Sbjct: 8 KCPQCKNIVEISSEFNPFCSKTCKNLDFLNWANEEKSIPMPDDSTSD 54 >gi|218710515|ref|YP_002418136.1| zinc-binding protein [Vibrio splendidus LGP32] gi|218323534|emb|CAV19729.1| conserved hypothetical protein [Vibrio splendidus LGP32] Length = 65 Score = 38.1 bits (87), Expect = 0.41, Method: Composition-based stats. Identities = 16/50 (32%), Positives = 19/50 (38%), Gaps = 4/50 (8%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP+C PFCS QC+ ID W E IA D + Sbjct: 9 KCPQCNTDVEWGEQSPHRPFCSKQCQIIDFGEWADEENSIAGAPDMSDSD 58 >gi|84394294|ref|ZP_00993019.1| zinc-binding protein [Vibrio splendidus 12B01] gi|84375097|gb|EAP92019.1| zinc-binding protein [Vibrio splendidus 12B01] Length = 65 Score = 38.1 bits (87), Expect = 0.44, Method: Composition-based stats. Identities = 16/50 (32%), Positives = 19/50 (38%), Gaps = 4/50 (8%) Query: 12 ICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEE 57 CP+C PFCS QC+ ID W E IA D + Sbjct: 9 KCPQCNADVEWGEQSPHRPFCSKQCQMIDFGEWADEENSIAGAPDMSDSD 58 >gi|40063150|gb|AAR37987.1| conserved hypothetical protein [uncultured marine bacterium 562] Length = 54 Score = 37.3 bits (85), Expect = 0.66, Method: Composition-based stats. Identities = 14/49 (28%), Positives = 22/49 (44%), Gaps = 4/49 (8%) Query: 11 SICPECRKG----SMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKS 55 S CP C K + + PFCS +C+ ID W + + I+ + Sbjct: 2 SSCPRCEKPVKLSTDNIYRPFCSEKCKLIDFGDWANEDNKISRPIQSED 50 >gi|115384542|ref|XP_001208818.1| conserved hypothetical protein [Aspergillus terreus NIH2624] gi|114196510|gb|EAU38210.1| conserved hypothetical protein [Aspergillus terreus NIH2624] Length = 358 Score = 37.3 bits (85), Expect = 0.74, Method: Composition-based stats. Identities = 13/40 (32%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Query: 3 TSDFRSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLH 42 T S + P C + + + +PF S R+IDL WL Sbjct: 91 TQPPNSGRRFRPIC-RMTAPQRHPFVSIDFRNIDLESWLA 129 >gi|297184488|gb|ADI20602.1| hypothetical protein [uncultured gamma proteobacterium EBAC_27G05] Length = 55 Score = 36.2 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 13/47 (27%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Query: 13 CPECRKGSM----VEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKS 55 CP+C+ + +F PFC +C+ +DL W + E +I+ + + Sbjct: 5 CPQCKASADLTKKNKFRPFCCERCKLVDLGIWANEEKLISRPIESED 51 >gi|297180010|gb|ADI16235.1| hypothetical protein [uncultured bacterium HF0010_16H03] Length = 54 Score = 35.0 bits (79), Expect = 3.2, Method: Composition-based stats. Identities = 15/49 (30%), Positives = 22/49 (44%), Gaps = 4/49 (8%) Query: 11 SICPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKS 55 S CP C K S + PFCS +C+ ID W + + I+ + Sbjct: 2 SNCPRCEKITDLSSNNKNRPFCSEKCKLIDFGSWANEDNSISRPIQSED 50 >gi|119477438|ref|ZP_01617629.1| zinc-binding protein [marine gamma proteobacterium HTCC2143] gi|119449364|gb|EAW30603.1| zinc-binding protein [marine gamma proteobacterium HTCC2143] Length = 63 Score = 33.9 bits (76), Expect = 7.6, Method: Composition-based stats. Identities = 11/47 (23%), Positives = 17/47 (36%), Gaps = 4/47 (8%) Query: 13 CPECRKGS----MVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKS 55 CP C+ + PFCS CR+ D W + + + Sbjct: 11 CPGCKISTEWRTDNPHRPFCSDSCRNKDFIAWANEDNAMPGNPVYDD 57 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.307 0.136 0.475 Lambda K H 0.267 0.0419 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,111,876,982 Number of Sequences: 14124377 Number of extensions: 31787049 Number of successful extensions: 132024 Number of sequences better than 10.0: 573 Number of HSP's better than 10.0 without gapping: 872 Number of HSP's successfully gapped in prelim test: 149 Number of HSP's that attempted gapping in prelim test: 131000 Number of HSP's gapped (non-prelim): 1021 length of query: 63 length of database: 4,842,793,630 effective HSP length: 35 effective length of query: 28 effective length of database: 4,348,440,435 effective search space: 121756332180 effective search space used: 121756332180 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.0 bits) S2: 76 (33.9 bits)