RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780469|ref|YP_003064882.1| zinc-binding protein [Candidatus Liberibacter asiaticus str. psy62] (63 letters) >gnl|CDD|146490 pfam03884, DUF329, Domain of unknown function (DUF329). The function of this short domain is unknown it contains four conserved cysteines and may therefore be involved in zinc binding. Length = 57 Score = 50.8 bits (122), Expect = 7e-08 Identities = 20/50 (40%), Positives = 24/50 (48%), Gaps = 4/50 (8%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K F PFCS +C+ IDL W EY I D++ EE Sbjct: 5 CPTCGKPVVWSEENPFRPFCSERCKLIDLGAWASEEYRIPGEPDDEDEES 54 >gnl|CDD|32840 COG3024, COG3024, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 65 Score = 49.3 bits (117), Expect = 2e-07 Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVKD 61 CP C K G F PFCS +C+ IDL W EY I ++ ++ + Sbjct: 10 CPTCGKPVVWGEESPFRPFCSKRCKLIDLGEWAAEEYAIPDETEDSDSDDWSE 62 >gnl|CDD|112637 pfam03833, PolC_DP2, DNA polymerase II large subunit DP2. Length = 852 Score = 27.4 bits (61), Expect = 0.96 Identities = 16/58 (27%), Positives = 23/58 (39%), Gaps = 10/58 (17%) Query: 13 CPECRKGSMVEFYPFCSTQC--------RSIDLSRWLHGEYVIAAVEDEKSEEEVKDI 62 CP C K S P C ++ R IDLS L + + K +E+K + Sbjct: 632 CPSCGKESPESTCPKCGSRERKLDGYGKRKIDLSDLLRR--ALENLGIRKDLDELKGV 687 >gnl|CDD|153136 cd01586, AcnA_IRP, Aconitase A catalytic domain. Aconitase A catalytic domain. This is the major form of the TCA cycle enzyme aconitate hydratase, also known as aconitase and citrate hydrolyase. It includes bacterial and archaeal aconitase A, and the eukaryotic cytosolic form of aconitase. This group also includes sequences that have been shown to act as an iron-responsive element (IRE) binding protein in animals and may have the same role in other eukaryotes. Length = 404 Score = 25.3 bits (56), Expect = 3.3 Identities = 17/53 (32%), Positives = 21/53 (39%), Gaps = 18/53 (33%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLS---------------RWLHGEYVIAAV 50 PE G+ F+P TQ +DLS LHG VIAA+ Sbjct: 223 APE--YGATCGFFPV-DTQVVELDLSTVEPSVSGPKRPQDRVPLHGSVVIAAI 272 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.320 0.133 0.409 Gapped Lambda K H 0.267 0.0748 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 759,175 Number of extensions: 28208 Number of successful extensions: 83 Number of sequences better than 10.0: 1 Number of HSP's gapped: 83 Number of HSP's successfully gapped: 6 Length of query: 63 Length of database: 6,263,737 Length adjustment: 35 Effective length of query: 28 Effective length of database: 5,507,422 Effective search space: 154207816 Effective search space used: 154207816 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (23.4 bits)