RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780469|ref|YP_003064882.1| zinc-binding protein [Candidatus Liberibacter asiaticus str. psy62] (63 letters) >gnl|CDD|167213 PRK01343, PRK01343, zinc-binding protein; Provisional. Length = 57 Score = 68.6 bits (168), Expect = 4e-13 Identities = 28/46 (60%), Positives = 32/46 (69%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CPEC K S E YPFCS +CR IDL+RWL G YVI DE+ +EE Sbjct: 12 CPECGKPSTREAYPFCSERCRDIDLNRWLSGSYVIPGAPDEEDDEE 57 >gnl|CDD|179015 PRK00418, PRK00418, DNA gyrase inhibitor; Reviewed. Length = 62 Score = 33.9 bits (78), Expect = 0.010 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 5/54 (9%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIA-AVEDEKSEEEVKD 61 CP C K G + F PFCS +C+ IDL W E I + + +S++ ++ Sbjct: 9 CPTCGKPVEWGEISPFRPFCSKRCQLIDLGEWAAEEKRIPSSGDLSESDDWSEE 62 >gnl|CDD|161834 TIGR00354, polC, DNA polymerase, archaeal type II, large subunit. This model represents the large subunit, DP2, of a two subunit novel Archaeal replicative DNA polymerase first characterized for Pyrococcus furiosus. Structure of DP2 appears to be organized as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit. Length = 1095 Score = 25.6 bits (56), Expect = 2.7 Identities = 7/18 (38%), Positives = 8/18 (44%) Query: 13 CPECRKGSMVEFYPFCST 30 CP+C K S P C Sbjct: 628 CPQCGKESFWLKCPVCGE 645 >gnl|CDD|172782 PRK14294, PRK14294, chaperone protein DnaJ; Provisional. Length = 366 Score = 25.1 bits (55), Expect = 4.0 Identities = 8/23 (34%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Query: 2 QTSDFRSLKSICPECR-KGSMVE 23 Q+ F S+++ CP CR G ++ Sbjct: 175 QSQGFFSIRTTCPRCRGMGKVIV 197 >gnl|CDD|184948 PRK14986, PRK14986, glycogen phosphorylase; Provisional. Length = 815 Score = 24.8 bits (54), Expect = 4.8 Identities = 12/29 (41%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Query: 35 IDLSRWLHGEYVIAAVEDEKSEEEVKDIL 63 I+L ++ G+Y AAVED+ E V +L Sbjct: 242 INLGKFNQGDY-FAAVEDKNHSENVSRVL 269 >gnl|CDD|152526 pfam12091, DUF3567, Protein of unknown function (DUF3567). This family of proteins is functionally uncharacterized. This protein is found in bacteria. Proteins in this family are about 90 amino acids in length. This protein has a conserved EIVDK sequence motif. Length = 85 Score = 24.6 bits (54), Expect = 5.0 Identities = 11/20 (55%), Positives = 14/20 (70%) Query: 44 EYVIAAVEDEKSEEEVKDIL 63 E V A +EDE ++EEV D L Sbjct: 52 EDVKALIEDEPTQEEVDDFL 71 >gnl|CDD|181267 PRK08173, PRK08173, DNA topoisomerase III; Validated. Length = 862 Score = 24.6 bits (54), Expect = 5.9 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 2/29 (6%) Query: 5 DFRSLKSICPECRKGSMVEFYP-FCSTQC 32 D+ +L++ CP C G + E Y F T+C Sbjct: 619 DYATLQTPCPNC-GGVVKENYRRFACTKC 646 >gnl|CDD|179686 PRK03958, PRK03958, tRNA 2'-O-methylase; Reviewed. Length = 176 Score = 24.1 bits (53), Expect = 7.1 Identities = 10/25 (40%), Positives = 15/25 (60%) Query: 38 SRWLHGEYVIAAVEDEKSEEEVKDI 62 +R L + +I A DE +E V+DI Sbjct: 26 ARALGADKIILASNDEHVKESVEDI 50 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.320 0.133 0.409 Gapped Lambda K H 0.267 0.0604 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 961,597 Number of extensions: 40804 Number of successful extensions: 127 Number of sequences better than 10.0: 1 Number of HSP's gapped: 127 Number of HSP's successfully gapped: 13 Length of query: 63 Length of database: 5,994,473 Length adjustment: 35 Effective length of query: 28 Effective length of database: 5,238,193 Effective search space: 146669404 Effective search space used: 146669404 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.3 bits)