RPS-BLAST 2.2.22 [Sep-27-2009]

Database: mmdb70 
           33,805 sequences; 4,956,049 total letters

Searching..................................................done

Query= gi|254780469|ref|YP_003064882.1| zinc-binding protein
[Candidatus Liberibacter asiaticus str. psy62]
         (63 letters)



>1lv3_A Hypothetical protein YACG; zinc finger, rubredoxin
          knuckle, C4 tetrahedral Zn+2, antiparallel beta strand
          and alpha helix, NESG project; NMR {Escherichia coli}
          (A:)
          Length = 68

 Score = 54.9 bits (132), Expect = 4e-09
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 4/50 (8%)

Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58
          CP C K    G +  F PFCS +C+ IDL  W   E  I +  D    ++
Sbjct: 12 CPTCGKTVVWGEISPFRPFCSKRCQLIDLGEWAAEEKRIPSSGDLSESDD 61


  Database: mmdb70
    Posted date:  Jun 20, 2010  3:12 AM
  Number of letters in database: 4,956,049
  Number of sequences in database:  33,805
  
Lambda     K      H
   0.320    0.133    0.409 

Gapped
Lambda     K      H
   0.267   0.0567    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 33805
Number of Hits to DB: 485,267
Number of extensions: 16503
Number of successful extensions: 77
Number of sequences better than 10.0: 1
Number of HSP's gapped: 77
Number of HSP's successfully gapped: 3
Length of query: 63
Length of database: 4,956,049
Length adjustment: 31
Effective length of query: 32
Effective length of database: 3,908,094
Effective search space: 125059008
Effective search space used: 125059008
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.4 bits)